BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 007345
         (607 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1X4L|A Chain A, Solution Structure Of Lim Domain In Four And A Half Lim
           Domains Protein 2
          Length = 72

 Score = 30.8 bits (68), Expect = 2.5,   Method: Composition-based stats.
 Identities = 20/58 (34%), Positives = 24/58 (41%), Gaps = 8/58 (13%)

Query: 435 NPISGFSAERRPSLSQTQSRNDFFNLLKKKTSMNTSG--------LPADSGTDIPSPA 484
           NPISG    +  S  + Q  ND FN  K   S+   G        L  D G DI  P+
Sbjct: 13  NPISGLGGTKYISFEERQWHNDCFNCKKCSLSLVGRGFLTERDDILCPDCGKDISGPS 70


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.307    0.124    0.348 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 15,515,253
Number of Sequences: 62578
Number of extensions: 611083
Number of successful extensions: 1296
Number of sequences better than 100.0: 7
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 7
Number of HSP's that attempted gapping in prelim test: 1296
Number of HSP's gapped (non-prelim): 7
length of query: 607
length of database: 14,973,337
effective HSP length: 104
effective length of query: 503
effective length of database: 8,465,225
effective search space: 4258008175
effective search space used: 4258008175
T: 11
A: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.6 bits)
S2: 54 (25.4 bits)