BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 007420
         (604 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2QK1|A Chain A, Structural Basis Of Microtubule Plus End Tracking By
           Xmap215, Clip-170 And Eb1
          Length = 249

 Score = 28.9 bits (63), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 12/42 (28%), Positives = 24/42 (57%)

Query: 453 RKLIRNPNTYSSLIGLVWSLVSFRWNVQMPAIVAKSISILSD 494
           +KL      YS+L+G+   ++    N+Q  A+ A+S+ ++ D
Sbjct: 49  KKLKSTSQNYSNLLGIYGHIIQKDANIQAVALAAQSVELICD 90


>pdb|1Z7L|A Chain A, Crystal Structure Of Fragment Of Mouse
           Ubiquitin-Activating Enzyme
 pdb|1Z7L|B Chain B, Crystal Structure Of Fragment Of Mouse
           Ubiquitin-Activating Enzyme
 pdb|1Z7L|C Chain C, Crystal Structure Of Fragment Of Mouse
           Ubiquitin-Activating Enzyme
          Length = 276

 Score = 28.9 bits (63), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 17/72 (23%), Positives = 36/72 (50%), Gaps = 4/72 (5%)

Query: 201 KLHVTVRKSNASRSDIFSRRSQGLSSTTPRPSNLTNAEIYSLQSSRNPTPRGSSFNHADF 260
           K+HV+ ++  ++ + +   R + L +T P P  L   ++Y +   ++     S+F H DF
Sbjct: 191 KIHVSDQELQSANASVDDSRLEELKATLPSPDKLPGFKMYPIDFEKD---DDSNF-HMDF 246

Query: 261 YSMMAGGRSSNF 272
               +  R+ N+
Sbjct: 247 IVAASNLRAENY 258


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.322    0.135    0.405 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 16,265,828
Number of Sequences: 62578
Number of extensions: 602021
Number of successful extensions: 818
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 817
Number of HSP's gapped (non-prelim): 3
length of query: 604
length of database: 14,973,337
effective HSP length: 104
effective length of query: 500
effective length of database: 8,465,225
effective search space: 4232612500
effective search space used: 4232612500
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 54 (25.4 bits)