Citrus Sinensis ID: 007474

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600--
MAILGASGAGKSTLIDALAGRIEKESLKGTVTLNGAVLESRLLKIISAYVMQDELLFPMLTVEETLMFSAECRLPRSVSKKRKRERVEALIDQLGLRSAAKTFIGDEQHRGVSGGERRRVSIGIDIIHDPILLFLDEPTSGLDSTSAFKVVKVLGEIAKSGSVVIMSIHQPSYRIFSLLNRLIFLSHGQTVYSGTPATDFSLFFAEFGHPIPENENPCEFSLDLIRELEETPSGISSLVQFNKSWQMTRNPKMASDTDRQPDVDLEDAIEASISRGKLVSAGKNKNVQTFVNPFWTEMLFLSKRSNTNSRRMPELFGTRLGAQLVIACVLATLYWQLDDSPKGTRLRLAFVAFAMTTIFYNCAREIPALLQERNIFIRETSYNAYRVSSYVLAHALASIPSMITLSLVFALTTFWAVGLAGGFSGFLFFFITMFASYWAGTSFMAFVAGFIPNIQIGFTIVVAILGLSLLFCGFYISHDEIPSYWIWFHYVSLVKYPFQGALQNEYGDPNRCFLTGLQFFDGTPFDGLPNSTKIELLQSMSNVLGRNITGSTCLTTGMKILEQKGITDISKWKCIWILVAFGFLFRVLFYFTLLFGSKNKRR
ccccccccccHHHHHHHHHcccccccEEEEEEEcccccccccccccEEEEEEcccccccccHHHHHHHHHHccccccccHHHHHHHHHHHHHHcccccccccccccccccccccHHHHHHHHHHHHHccccEEEEcccccccHHHHHHHHHHHHHHHHHcccEEEEEcccccHHHHHHHHHHHHHccccEEEEccccccHHHHHHHccccccccccHHHHHHHHHcccccccccccHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHccCECccccccccEEEHHccccHHHHHHHHHHHHcccccccccccccccccccccccccHHHHHHHHHHccccccccccccccccHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHccccccc
*AI****GAGKSTLIDALAGRIEKESLKGTVTLNGAVLESRLLKIISAYVMQDELLFPMLTVEETLMFSAECRLPR****KRKRERVEALIDQLGLRSAAKTFIGDEQHRGVSGGERRRVSIGIDIIHDPILLFLDEPTSGLDSTSAFKVVKVLGEIAKSGSVVIMSIHQPSYRIFSLLNRLIFLSHGQTVYSGTPATDFSLFFAEFGHPIPENENPCEFSLDLIRELEE**********F***W******************************************QTFVNPFWTEMLFLSKRSNTNSRRMPELFGTRLGAQLVIACVLATLYWQLDDSPKGTRLRLAFVAFAMTTIFYNCAREIPALLQERNIFIRETSYNAYRVSSYVLAHALASIPSMITLSLVFALTTFWAVGLAGGFSGFLFFFITMFASYWAGTSFMAFVAGFIPNIQIGFTIVVAILGLSLLFCGFYISHDEIPSYWIWFHYVSLVKYPFQGALQNEYGDPNRCFLTGLQFFDGTPFDGLPNSTKIELLQSMSNVLGRNITGSTCLTTGMKILEQKGITDISKWKCIWILVAFGFLFRVLFYFTLLFGSKN***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHHxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAILGASGAGKSTLIDALAGRIEKESLKGTVTLNGAVLESRLLKIISAYVMQDELLFPMLTVEETLMFSAECRLPRSVSKKRKRERVEALIDQLGLRSAAKTFIGDEQHRGVSGGERRRVSIGIDIIHDPILLFLDEPTSGLDSTSAFKVVKVLGEIAKSGSVVIMSIHQPSYRIFSLLNRLIFLSHGQTVYSGTPATDFSLFFAEFGHPIPENENPCEFSLDLIRELEETPSGISSLVQFNKSWQMTRNPKMASDTDRQPDVDLEDAIEASISRGKLVSAGKNKNVQTFVNPFWTEMLFLSKRSNTNSRRMPELFGTRLGAQLVIACVLATLYWQLDDSPKGTRLRLAFVAFAMTTIFYNCAREIPALLQERNIFIRETSYNAYRVSSYVLAHALASIPSMITLSLVFALTTFWAVGLAGGFSGFLFFFITMFASYWAGTSFMAFVAGFIPNIQIGFTIVVAILGLSLLFCGFYISHDEIPSYWIWFHYVSLVKYPFQGALQNEYGDPNRCFLTGLQFFDGTPFDGLPNSTKIELLQSMSNVLGRNITGSTCLTTGMKILEQKGITDISKWKCIWILVAFGFLFRVLFYFTLLFGSKNKRR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
ATP-binding cassette sub-family G member 2 Xenobiotic transporter that may play an important role in the exclusion of xenobiotics from the brain. May be involved in brain-to-blood efflux.probableQ4GZT4
ABC transporter G family member 2 probableQ9ZUT0
ATP-binding cassette sub-family G member 2 Xenobiotic transporter that may play an important role in the exclusion of xenobiotics from the brain. May be involved in brain-to-blood efflux. Appears to play a major role in the multidrug resistance phenotype of several cancer cell lines. When overexpressed, the transfected cells become resistant to mitoxantrone, daunorubicin and doxorubicin, display diminished intracellular accumulation of daunorubicin, and manifest an ATP-dependent increase in the efflux of rhodamine 123.probableQ9UNQ0

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2YZ2, chain A
Confidence level:confident
Coverage over the Query: 2-201
View the alignment between query and template
View the model in PyMOL
Template: 2IHY, chain A
Confidence level:confident
Coverage over the Query: 2-211
View the alignment between query and template
View the model in PyMOL
Template: 3J16, chain B
Confidence level:probable
Coverage over the Query: 2-284
View the alignment between query and template
View the model in PyMOL