Citrus Sinensis ID: 007491


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-
MSEKQLIVAVEGTAAMGPYWQSIVSDYLEKIIRCFCVNELAGQKTSASNVELSLVTFNTHGSYCACLVQRSGWTKDVDIFLHWLSTIPFAGGGFNDAAIAEGLSEALMMFSVAPNGSQNQQNVDGQRHCILVAASNPHPLPTPVYRPQMQNLDQNENNEAQAESRLSDAETVAKSFVQCSVSLSVICPKQLPKLTAIYNAAKRNPRAADPPVDNSKNPHFLVLISENFMEARAALSRPGVANLAPNQNPVKMDIAPVTSVTGPAPTSIPSVNGINRPPISVGNVPTATVKVEPSTVTSMVNGPTFPHIPSVPRPASQGVPSLQTSSPSSTSQEMITSGDSVPEVKPLVSGMSQPLRPMAPAAANVNILNNLSQARQVMNNAALTGGTSIGLQSMGQTPMAMHMSNMISSGMASSVPTSQPVFSSAQSGITSIGGSGTLTGTSQVPQNSGLNSFTSAPSNLSGNSNPSISQPMGTLQGGASMGQSVGMSQGNHSGGQMVQNGISMNQNMMSGLGPSGVSSGTGTMIPTPGMSQQAQSGMQPLSVNNNTAVNMQLSQQTSSALHSSQSKYVKVWEGSLSGQRQGQPVFITKLEGYRSASASET
cccccEEEEEEccccccccHHHHHHHHHHHHHHHHccccccccccccccEEEEEEEEccccccccccEEEccccccHHHHHHHHccccccccccccHHHHHHHHHHHHHHcccccccccccccccccEEEEEcccccccccccccccccccccccccHHHHHHcccccHHHHHHHHHHcccccEEEccccccHHHHHHHHHccccccccccccccccccEEEEEEcHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEccccccccccccEEEcccccccccccccc
**EKQLIVAVEGTAAMGPYWQSIVSDYLEKIIRCFCVNELAGQKTSASNVELSLVTFNTHGSYCACLVQRSGWTKDVDIFLHWLSTIPFAGGGFNDAAIAEGLSEALMMFSV**************RHCILVAASNPHPLPTPVYRPQMQ****************SDAETVAKSFVQCSVSLSVICPKQLPKLTAIYNA******************HFLVLISENFMEAR**************************************************************************************************************************************IL********************************************************************************************************************************************************************************************************VKVW************VFI**************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSEKQLIVAVEGTAAMGPYWQSIVSDYLEKIIRCFCVNELAGQKTSASNVELSLVTFNTHGSYCACLVQRSGWTKDVDIFLHWLSTIPFAGGGFNDAAIAEGLSEALMMFSVAPNGSQNQQNVDGQRHCILVAASNPHPLPTPVYRPQMQNxxxxxxxxxxxxxxxxxxxxxAKSFVQCSVSLSVICPKQLPKLTAIYNAAKRNPRAADPPVDNSKNPHFLVLISENFMEARAALSRPGVANLAPNQNPVKMDIAPVTSVTGPAPTSIPSVNGINRPPISVGNVPTATVKVEPSTVTSMVNGPTFPHIPSVPRPASQGVPSLQTSSPSSTSQEMITSGDSVPEVKPLVSGMSQPLRPMAPAAANVNILNNLSQARQVMNNAALTGGTSIGLQSMGQTPMAMHMSNMISSGMASSVPTSQPVFSSAQSGITSIGGSGTLTGTSQVPQNSGLNSFTSAPSNLSGNSNPSISQPMGTLQGGASMGQSVGMSQGNHSGGQMVQNGISMNQNMMSGLGPSGVSSGTGTMIPTPGMSQQAQSGMQPLSVNNNTAVNMQLSQQTSSALHSSQSKYVKVWEGSLSGQRQGQPVFITKLEGYRSASASET

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Mediator of RNA polymerase II transcription subunit 25 Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. Positive regulator of shade avoidance and of jasmonate signaling. Acts in repression of PhyB-mediated light signaling and regulates the expression of FLOWERING LOCUS T (FT) and of CONSTANS (CO).probableQ7XYY2

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3T3P, chain B
Confidence level:confident
Coverage over the Query: 4-199
View the alignment between query and template
View the model in PyMOL