BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 007516
(600 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|1FQV|A Chain A, Insights Into Scf Ubiquitin Ligases From The Structure Of
The Skp1-Skp2 Complex
pdb|1FQV|C Chain C, Insights Into Scf Ubiquitin Ligases From The Structure Of
The Skp1-Skp2 Complex
pdb|1FQV|E Chain E, Insights Into Scf Ubiquitin Ligases From The Structure Of
The Skp1-Skp2 Complex
pdb|1FQV|G Chain G, Insights Into Scf Ubiquitin Ligases From The Structure Of
The Skp1-Skp2 Complex
pdb|1FQV|I Chain I, Insights Into Scf Ubiquitin Ligases From The Structure Of
The Skp1-Skp2 Complex
pdb|1FQV|K Chain K, Insights Into Scf Ubiquitin Ligases From The Structure Of
The Skp1-Skp2 Complex
pdb|1FQV|M Chain M, Insights Into Scf Ubiquitin Ligases From The Structure Of
The Skp1-Skp2 Complex
pdb|1FQV|O Chain O, Insights Into Scf Ubiquitin Ligases From The Structure Of
The Skp1-Skp2 Complex
pdb|2ASS|B Chain B, Crystal Structure Of The Skp1-Skp2-Cks1 Complex
pdb|2AST|B Chain B, Crystal Structure Of Skp1-Skp2-Cks1 In Complex With A P27
Peptide
Length = 336
Score = 29.3 bits (64), Expect = 6.6, Method: Compositional matrix adjust.
Identities = 21/73 (28%), Positives = 38/73 (52%), Gaps = 3/73 (4%)
Query: 495 LRKLKHLEVLSVAGIETVTDEFVRGFVYACGHNMKELILTDCVKLTDFSLKVIAETCPRL 554
L + L+ LS+ G+ ++D V A N+ L L+ C ++F+L+ + +C RL
Sbjct: 114 LSQCSKLQNLSLEGLR-LSDPIVNTL--AKNSNLVRLNLSGCSGFSEFALQTLLSSCSRL 170
Query: 555 CTLDLSNLYKLTD 567
L+LS + T+
Sbjct: 171 DELNLSWCFDFTE 183
>pdb|2POF|A Chain A, Crystal Structure Of Cdp-Diacylglycerol Pyrophosphatase
pdb|2POF|B Chain B, Crystal Structure Of Cdp-Diacylglycerol Pyrophosphatase
Length = 227
Score = 29.3 bits (64), Expect = 6.6, Method: Compositional matrix adjust.
Identities = 19/68 (27%), Positives = 33/68 (48%), Gaps = 3/68 (4%)
Query: 288 SNSSILWIPRKGQRQGPKLIIPSLKELSMKILVQNADAITSLEHVPDALRHKLSFMLCDS 347
+N S W+P G +G + + + ++ LVQ + E VP+A H S+ L
Sbjct: 135 ANISSRWLPLPGGLRGHEYLA---RRVTESELVQRSPFXXLAEEVPEAREHXGSYGLAXV 191
Query: 348 RQMNSHFL 355
RQ ++ F+
Sbjct: 192 RQSDNSFV 199
>pdb|1FS2|A Chain A, Insights Into Scf Ubiquitin Ligases From The Structure Of
The Skp1-Skp2 Complex
pdb|1FS2|C Chain C, Insights Into Scf Ubiquitin Ligases From The Structure Of
The Skp1-Skp2 Complex
Length = 272
Score = 28.9 bits (63), Expect = 9.6, Method: Compositional matrix adjust.
Identities = 21/73 (28%), Positives = 38/73 (52%), Gaps = 3/73 (4%)
Query: 495 LRKLKHLEVLSVAGIETVTDEFVRGFVYACGHNMKELILTDCVKLTDFSLKVIAETCPRL 554
L + L+ LS+ G+ ++D V A N+ L L+ C ++F+L+ + +C RL
Sbjct: 76 LSQCSKLQNLSLEGLR-LSDPIVNTL--AKNSNLVRLNLSGCSGFSEFALQTLLSSCSRL 132
Query: 555 CTLDLSNLYKLTD 567
L+LS + T+
Sbjct: 133 DELNLSWCFDFTE 145
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.318 0.135 0.393
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 15,923,202
Number of Sequences: 62578
Number of extensions: 604300
Number of successful extensions: 1294
Number of sequences better than 100.0: 4
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 1288
Number of HSP's gapped (non-prelim): 8
length of query: 600
length of database: 14,973,337
effective HSP length: 104
effective length of query: 496
effective length of database: 8,465,225
effective search space: 4198751600
effective search space used: 4198751600
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 54 (25.4 bits)