BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 007516
         (600 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1FQV|A Chain A, Insights Into Scf Ubiquitin Ligases From The Structure Of
           The Skp1-Skp2 Complex
 pdb|1FQV|C Chain C, Insights Into Scf Ubiquitin Ligases From The Structure Of
           The Skp1-Skp2 Complex
 pdb|1FQV|E Chain E, Insights Into Scf Ubiquitin Ligases From The Structure Of
           The Skp1-Skp2 Complex
 pdb|1FQV|G Chain G, Insights Into Scf Ubiquitin Ligases From The Structure Of
           The Skp1-Skp2 Complex
 pdb|1FQV|I Chain I, Insights Into Scf Ubiquitin Ligases From The Structure Of
           The Skp1-Skp2 Complex
 pdb|1FQV|K Chain K, Insights Into Scf Ubiquitin Ligases From The Structure Of
           The Skp1-Skp2 Complex
 pdb|1FQV|M Chain M, Insights Into Scf Ubiquitin Ligases From The Structure Of
           The Skp1-Skp2 Complex
 pdb|1FQV|O Chain O, Insights Into Scf Ubiquitin Ligases From The Structure Of
           The Skp1-Skp2 Complex
 pdb|2ASS|B Chain B, Crystal Structure Of The Skp1-Skp2-Cks1 Complex
 pdb|2AST|B Chain B, Crystal Structure Of Skp1-Skp2-Cks1 In Complex With A P27
           Peptide
          Length = 336

 Score = 29.3 bits (64), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 38/73 (52%), Gaps = 3/73 (4%)

Query: 495 LRKLKHLEVLSVAGIETVTDEFVRGFVYACGHNMKELILTDCVKLTDFSLKVIAETCPRL 554
           L +   L+ LS+ G+  ++D  V     A   N+  L L+ C   ++F+L+ +  +C RL
Sbjct: 114 LSQCSKLQNLSLEGLR-LSDPIVNTL--AKNSNLVRLNLSGCSGFSEFALQTLLSSCSRL 170

Query: 555 CTLDLSNLYKLTD 567
             L+LS  +  T+
Sbjct: 171 DELNLSWCFDFTE 183


>pdb|2POF|A Chain A, Crystal Structure Of Cdp-Diacylglycerol Pyrophosphatase
 pdb|2POF|B Chain B, Crystal Structure Of Cdp-Diacylglycerol Pyrophosphatase
          Length = 227

 Score = 29.3 bits (64), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 19/68 (27%), Positives = 33/68 (48%), Gaps = 3/68 (4%)

Query: 288 SNSSILWIPRKGQRQGPKLIIPSLKELSMKILVQNADAITSLEHVPDALRHKLSFMLCDS 347
           +N S  W+P  G  +G + +    + ++   LVQ +      E VP+A  H  S+ L   
Sbjct: 135 ANISSRWLPLPGGLRGHEYLA---RRVTESELVQRSPFXXLAEEVPEAREHXGSYGLAXV 191

Query: 348 RQMNSHFL 355
           RQ ++ F+
Sbjct: 192 RQSDNSFV 199


>pdb|1FS2|A Chain A, Insights Into Scf Ubiquitin Ligases From The Structure Of
           The Skp1-Skp2 Complex
 pdb|1FS2|C Chain C, Insights Into Scf Ubiquitin Ligases From The Structure Of
           The Skp1-Skp2 Complex
          Length = 272

 Score = 28.9 bits (63), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 38/73 (52%), Gaps = 3/73 (4%)

Query: 495 LRKLKHLEVLSVAGIETVTDEFVRGFVYACGHNMKELILTDCVKLTDFSLKVIAETCPRL 554
           L +   L+ LS+ G+  ++D  V     A   N+  L L+ C   ++F+L+ +  +C RL
Sbjct: 76  LSQCSKLQNLSLEGLR-LSDPIVNTL--AKNSNLVRLNLSGCSGFSEFALQTLLSSCSRL 132

Query: 555 CTLDLSNLYKLTD 567
             L+LS  +  T+
Sbjct: 133 DELNLSWCFDFTE 145


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.318    0.135    0.393 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 15,923,202
Number of Sequences: 62578
Number of extensions: 604300
Number of successful extensions: 1294
Number of sequences better than 100.0: 4
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 1288
Number of HSP's gapped (non-prelim): 8
length of query: 600
length of database: 14,973,337
effective HSP length: 104
effective length of query: 496
effective length of database: 8,465,225
effective search space: 4198751600
effective search space used: 4198751600
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 54 (25.4 bits)