Citrus Sinensis ID: 007572
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 597 | 2.2.26 [Sep-21-2011] | |||||||
| Q8VZD4 | 709 | Glyoxysomal processing pr | yes | no | 0.926 | 0.779 | 0.527 | 1e-167 | |
| Q2T9J0 | 566 | Peroxisomal leader peptid | yes | no | 0.273 | 0.287 | 0.367 | 1e-19 | |
| Q9DBA6 | 568 | Peroxisomal leader peptid | yes | no | 0.276 | 0.290 | 0.344 | 2e-16 | |
| P45129 | 466 | Probable periplasmic seri | yes | no | 0.269 | 0.345 | 0.313 | 2e-07 | |
| P39099 | 455 | Periplasmic pH-dependent | N/A | no | 0.336 | 0.441 | 0.271 | 4e-06 | |
| P57322 | 478 | Probable serine protease | yes | no | 0.189 | 0.236 | 0.312 | 2e-05 | |
| P0C0V0 | 474 | Periplasmic serine endopr | N/A | no | 0.206 | 0.259 | 0.326 | 2e-05 | |
| P0C0V1 | 474 | Periplasmic serine endopr | N/A | no | 0.206 | 0.259 | 0.326 | 2e-05 | |
| P26982 | 475 | Periplasmic serine endopr | yes | no | 0.206 | 0.258 | 0.326 | 2e-05 | |
| F6AA62 | 479 | Probable periplasmic seri | yes | no | 0.217 | 0.271 | 0.296 | 0.0001 |
| >sp|Q8VZD4|DEG15_ARATH Glyoxysomal processing protease, glyoxysomal OS=Arabidopsis thaliana GN=DEG15 PE=1 SV=2 | Back alignment and function desciption |
|---|
Score = 590 bits (1520), Expect = e-167, Method: Compositional matrix adjust.
Identities = 319/605 (52%), Positives = 410/605 (67%), Gaps = 52/605 (8%)
Query: 1 MEASSGLPEHEWEVGWSLAPYNNSSQPLMGVVKTSIESNKISLMESHRPFAMEESSNLSL 60
+EASSG + W++GWSL N SQP +IE LM+ ++E N +
Sbjct: 149 IEASSGSKDSGWDIGWSLVSAANGSQP-----SINIEHYSKPLMQ------LDEPHNANF 197
Query: 61 MSKSTSRVAILGVSSYLKDLPNIALTPLNKRGDLLLAVGSPFGVLSPMHFFNSVSMGSVA 120
M+KS +R+AILGV L P++ + +GD L+A+GSPFG+LSP++FFNSVS GS+A
Sbjct: 198 MAKSATRMAILGVPLSLLGQPSMNFASSSSKGDTLVALGSPFGILSPVNFFNSVSTGSIA 257
Query: 121 NCYPPRSTTRSLLMADIRCLPGMEGGPVFGEHAHFVGILIRPLRQK-SGAEIQLVIPWEA 179
N YP S +SL++AD+RCLPGMEG PVF ++ H +GILIRPLRQK SG EIQLV+PW A
Sbjct: 258 NSYPSGSLKKSLMIADVRCLPGMEGAPVFAKNGHLIGILIRPLRQKNSGVEIQLVVPWGA 317
Query: 180 IATACSDLLLKEPQNAEKEIHINKGNLNAVGNSLLFNSHILNGACCYKYEHVDSRCRSPL 239
I TACS LLL+EP + G + + S +L+ D+ + +
Sbjct: 318 ITTACSHLLLEEP--------------SVEGKASQWGSEVLSVKS-------DASIPAQV 356
Query: 240 PIQKALASVCLITIDDGVWASGVLLNDQGLILTNAHLLEPWRFGKTTVSGWRNGVSFQP- 298
I+KA+ SVCLIT++DGVWASG++LN+ GLILTNAHLLEPWR+GK G G F+P
Sbjct: 357 AIEKAMESVCLITVNDGVWASGIILNEHGLILTNAHLLEPWRYGK----GGVYGEGFKPY 412
Query: 299 ----EDSASSGHTGVDQYQKSQTLPPKMPKIVDSSVDEH-RAYKLSSFSRGHRKIRVRLD 353
E+ +S+G +Q KSQTLP K P+ SSV E+ R YK + GHR IRVRL
Sbjct: 413 VLGAEEFSSTGSKFWEQ--KSQTLPRKAPRNHYSSVGENIREYKHNFLQTGHRDIRVRLC 470
Query: 354 HLDPWIWCDAKIVYVCKGPLDVSLLQLGYIPDQLCPIDADFGQPSLGSAAYVIGHGLFGP 413
HLD W WC A +VY+CK LD++LLQL Y+P +L PI A+F P LG+ A+V+GHGLFGP
Sbjct: 471 HLDSWTWCPANVVYICKEQLDIALLQLEYVPGKLQPITANFSSPPLGTTAHVVGHGLFGP 530
Query: 414 RCGLSPSVSSGVVAKVVKANLPSYGQSTLQRNSAYPVMLETTAAVHPGGSGGAVVNLDGH 473
RCGLSPS+ SGVVAKVV A QS Q + +P MLETTAAVHPGGSGGAV+N GH
Sbjct: 531 RCGLSPSICSGVVAKVVHAKRRLNTQSISQEVAEFPAMLETTAAVHPGGSGGAVLNSSGH 590
Query: 474 MIGLVTSNARHGGGTVIPHLNFSIPCAVLRPIFEFARDMQEVSLLRKLDEPNKHLASVWA 533
MIGLVTSNARHG GTVIPHLNFSIPCAVL PIF+FA DMQ ++L+ LD+P++ L+S+WA
Sbjct: 591 MIGLVTSNARHGAGTVIPHLNFSIPCAVLAPIFKFAEDMQNTTILQTLDQPSEELSSIWA 650
Query: 534 LMPPLSPKQGPSLPDLPQAALE-DNIEGKGSRFAKFIAERREVLKHSTQVGNAERVSGEI 592
LMP LSPK SLP+LP+ + +N + KGS+FAKFIAE +++ T ++S ++
Sbjct: 651 LMPSLSPKTEQSLPNLPKLLKDGNNKQTKGSQFAKFIAETQDMFVKPT------KLSRDV 704
Query: 593 FRSKL 597
SKL
Sbjct: 705 IPSKL 709
|
Trypsin-like serine endopeptidase involved in the processing of glyoxysomal higher molecular weight precursor. The dimeric form carries out the specific cleavages needed to remove PTS2-containing presequences, whereas the monomeric form degrades the removed presequences and misfolded proteins (Probable). Not required for degradation of glyoxylate cycle enzymes during seedling development. Arabidopsis thaliana (taxid: 3702) EC: 3EC: .EC: 4EC: .EC: 2EC: 1EC: .EC: - |
| >sp|Q2T9J0|TYSD1_HUMAN Peroxisomal leader peptide-processing protease OS=Homo sapiens GN=TYSND1 PE=1 SV=3 | Back alignment and function description |
|---|
| >sp|Q9DBA6|TYSD1_MOUSE Peroxisomal leader peptide-processing protease OS=Mus musculus GN=Tysnd1 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|P45129|HTOA_HAEIN Probable periplasmic serine protease do/HhoA-like OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_1259 PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|P39099|DEGQ_ECOLI Periplasmic pH-dependent serine endoprotease DegQ OS=Escherichia coli (strain K12) GN=degQ PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|P57322|DEGP_BUCAI Probable serine protease do-like OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=degP PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|P0C0V0|DEGP_ECOLI Periplasmic serine endoprotease DegP OS=Escherichia coli (strain K12) GN=degP PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|P0C0V1|DEGP_ECO57 Periplasmic serine endoprotease DegP OS=Escherichia coli O157:H7 GN=degP PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|P26982|DEGP_SALTY Periplasmic serine endoprotease DegP OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=degP PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|F6AA62|DEGPL_PSEF1 Probable periplasmic serine endoprotease DegP-like OS=Pseudomonas fulva (strain 12-X) GN=Psefu_3239 PE=3 SV=1 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 597 | ||||||
| 224077082 | 752 | predicted protein [Populus trichocarpa] | 0.989 | 0.785 | 0.669 | 0.0 | |
| 359483482 | 753 | PREDICTED: LOW QUALITY PROTEIN: glyoxyso | 0.988 | 0.783 | 0.639 | 0.0 | |
| 255536763 | 729 | trypsin domain-containing protein, putat | 0.973 | 0.796 | 0.631 | 0.0 | |
| 224125536 | 716 | predicted protein [Populus trichocarpa] | 0.929 | 0.775 | 0.660 | 0.0 | |
| 297740411 | 682 | unnamed protein product [Vitis vinifera] | 0.879 | 0.769 | 0.6 | 0.0 | |
| 147774460 | 840 | hypothetical protein VITISV_001901 [Viti | 0.949 | 0.675 | 0.565 | 0.0 | |
| 356546634 | 749 | PREDICTED: glyoxysomal processing protea | 0.974 | 0.777 | 0.562 | 0.0 | |
| 111183165 | 753 | putative protease/hydrolase [Solanum lyc | 0.988 | 0.783 | 0.539 | 1e-176 | |
| 357446685 | 819 | Peroxisomal leader peptide-processing pr | 0.994 | 0.725 | 0.519 | 1e-173 | |
| 297851284 | 713 | hypothetical protein ARALYDRAFT_473044 [ | 0.932 | 0.781 | 0.530 | 1e-168 |
| >gi|224077082|ref|XP_002305124.1| predicted protein [Populus trichocarpa] gi|222848088|gb|EEE85635.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Score = 754 bits (1948), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 405/605 (66%), Positives = 472/605 (78%), Gaps = 14/605 (2%)
Query: 1 MEASSGLPEHEWEVGWSLAPYNNSSQPLMGVVKTSIESNKISLMESHRPFAMEESSNLSL 60
+EASSG H WEVGWSLA N SQ M VV+T E S+ ES R A EESSN S+
Sbjct: 154 VEASSGSMNHGWEVGWSLASPENGSQSFMDVVQTQTEHGNASIAESQRR-AREESSNPSI 212
Query: 61 MSKSTSRVAILGVSSYLKDLPNIALTPLNKRGDLLLAVGSPFGVLSPMHFFNSVSMGSVA 120
M KST+RVAILGV +LKDLPN ++ ++RGD LLAVGSPFGVLSP+HFFNS+S+GS+A
Sbjct: 213 MGKSTTRVAILGVFLHLKDLPNFEISASSRRGDFLLAVGSPFGVLSPVHFFNSLSVGSIA 272
Query: 121 NCYPPRSTTRSLLMADIRCLPGMEGGPVFGEHAHFVGILIRPLRQKS-GAEIQLVIPWEA 179
NCYPPRS+ SLLMADIRCLPGMEG PVF E+++F+GILIRPLRQKS GAEIQLVIPWEA
Sbjct: 273 NCYPPRSSDISLLMADIRCLPGMEGSPVFCENSNFIGILIRPLRQKSSGAEIQLVIPWEA 332
Query: 180 IATACSDLLLKEPQNAEKEIHINKGNLNAVGNSLLFNSHILNGACCYKYEHVDSRCRSPL 239
IA ACSDLLLKEPQNAEK IHINK NLNAVGN+ +S +G K+EH S C SP
Sbjct: 333 IALACSDLLLKEPQNAEKGIHINKENLNAVGNAYSSSS---DGPFPLKHEHHISYCSSPP 389
Query: 240 PIQKALASVCLITIDDGVWASGVLLNDQGLILTNAHLLEPWRFGKTTVSGWRNGVSFQ-- 297
P++KA+AS+CLITID+ VWASGVLLNDQGLILTNAHLLEPWRFGKTTV+G +G Q
Sbjct: 390 PVEKAMASICLITIDELVWASGVLLNDQGLILTNAHLLEPWRFGKTTVNGGEDGTKLQDP 449
Query: 298 ---PEDSASSGHTGVDQYQKSQTLPPKMPKIVDSSV-DEHRAYKLSSFSRGHRKIRVRLD 353
PE+ ++ VD ++K+Q LPPK I++SSV DE + YKLS +G IRVRLD
Sbjct: 450 FIPPEEFPR--YSEVDGHEKTQRLPPKTLNIMNSSVADESKGYKLSLSYKGPMNIRVRLD 507
Query: 354 HLDPWIWCDAKIVYVCKGPLDVSLLQLGYIPDQLCPIDADFGQPSLGSAAYVIGHGLFGP 413
H DPWIWCDAK+V+VCKGPLDV+LLQL ++PDQL P DF SLGS AYVIGHGLFGP
Sbjct: 508 HADPWIWCDAKVVHVCKGPLDVALLQLEHVPDQLFPTKVDFECSSLGSKAYVIGHGLFGP 567
Query: 414 RCGLSPSVSSGVVAKVVKANLPSYGQSTLQRNSAYPVMLETTAAVHPGGSGGAVVNLDGH 473
RCG SPS+ SG V+KVVKA PSY QS S P MLETTAAVHPGGSGGAVVN +GH
Sbjct: 568 RCGFSPSICSGAVSKVVKAKAPSYCQSVQGGYSHIPAMLETTAAVHPGGSGGAVVNSEGH 627
Query: 474 MIGLVTSNARHGGGTVIPHLNFSIPCAVLRPIFEFARDMQEVSLLRKLDEPNKHLASVWA 533
MIGLVTS ARHGGGTVIPHLNFSIPCAVL PIF+FA+DM+++SLL+ LD PN+HL+SVWA
Sbjct: 628 MIGLVTSKARHGGGTVIPHLNFSIPCAVLAPIFDFAKDMRDISLLQNLDRPNEHLSSVWA 687
Query: 534 LMPPLSPKQGPSLPDLPQAALED-NIEGKGSRFAKFIAERREVLKHSTQVGNAERVSGEI 592
LMPPLSPK P LP LP++ L+D + KGSRFAKFIAER ++ + + Q+G A+ +S I
Sbjct: 688 LMPPLSPKPSPPLPSLPESILQDYEKQVKGSRFAKFIAEREKLFRGTPQLGKAKSISSVI 747
Query: 593 FRSKL 597
SKL
Sbjct: 748 IPSKL 752
|
Source: Populus trichocarpa Species: Populus trichocarpa Genus: Populus Family: Salicaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|359483482|ref|XP_002273997.2| PREDICTED: LOW QUALITY PROTEIN: glyoxysomal processing protease, glyoxysomal-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|255536763|ref|XP_002509448.1| trypsin domain-containing protein, putative [Ricinus communis] gi|223549347|gb|EEF50835.1| trypsin domain-containing protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|224125536|ref|XP_002329829.1| predicted protein [Populus trichocarpa] gi|222870891|gb|EEF08022.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|297740411|emb|CBI30593.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|147774460|emb|CAN59793.1| hypothetical protein VITISV_001901 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|356546634|ref|XP_003541729.1| PREDICTED: glyoxysomal processing protease, glyoxysomal-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|111183165|gb|ABH07902.1| putative protease/hydrolase [Solanum lycopersicum] | Back alignment and taxonomy information |
|---|
| >gi|357446685|ref|XP_003593618.1| Peroxisomal leader peptide-processing protease [Medicago truncatula] gi|355482666|gb|AES63869.1| Peroxisomal leader peptide-processing protease [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|297851284|ref|XP_002893523.1| hypothetical protein ARALYDRAFT_473044 [Arabidopsis lyrata subsp. lyrata] gi|297339365|gb|EFH69782.1| hypothetical protein ARALYDRAFT_473044 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 597 | ||||||
| TAIR|locus:2032142 | 709 | DEG15 "degradation of periplas | 0.577 | 0.486 | 0.555 | 2e-145 | |
| DICTYBASE|DDB_G0279049 | 849 | DDB_G0279049 "trypsin-like ser | 0.150 | 0.106 | 0.414 | 9.7e-27 | |
| UNIPROTKB|Q2T9J0 | 566 | TYSND1 "Peroxisomal leader pep | 0.271 | 0.286 | 0.333 | 1.5e-25 | |
| ZFIN|ZDB-GENE-030131-8525 | 565 | tysnd1 "trypsin domain contain | 0.221 | 0.233 | 0.318 | 2.5e-23 | |
| UNIPROTKB|F1SUE6 | 568 | TYSND1 "Uncharacterized protei | 0.266 | 0.279 | 0.313 | 1.3e-22 | |
| MGI|MGI:1919017 | 568 | Tysnd1 "trypsin domain contain | 0.269 | 0.283 | 0.326 | 2.6e-22 | |
| RGD|1307354 | 567 | Tysnd1 "trypsin domain contain | 0.269 | 0.283 | 0.308 | 8.4e-22 | |
| UNIPROTKB|J9P6K2 | 198 | TYSND1 "Uncharacterized protei | 0.271 | 0.818 | 0.327 | 1.1e-14 | |
| UNIPROTKB|E1BF31 | 565 | E1BF31 "Uncharacterized protei | 0.149 | 0.157 | 0.383 | 2.9e-13 | |
| UNIPROTKB|E2R4X7 | 418 | TYSND1 "Uncharacterized protei | 0.271 | 0.387 | 0.327 | 1.7e-12 |
| TAIR|locus:2032142 DEG15 "degradation of periplasmic proteins 15" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 978 (349.3 bits), Expect = 2.0e-145, Sum P(2) = 2.0e-145
Identities = 199/358 (55%), Positives = 251/358 (70%)
Query: 232 DSRCRSPLPIQKALASVCLITIDDGVWASGVLLNDQGLILTNAHLLEPWRFGKTTVSGWR 291
D+ + + I+KA+ SVCLIT++DGVWASG++LN+ GLILTNAHLLEPWR+GK V G
Sbjct: 349 DASIPAQVAIEKAMESVCLITVNDGVWASGIILNEHGLILTNAHLLEPWRYGKGGVYG-- 406
Query: 292 NGVSFQP-----EDSASSGHTGVDQYQKSQTLPPKMPKIVDSSVDEH-RAYKLSSFSRGH 345
G F+P E+ +S+G +Q KSQTLP K P+ SSV E+ R YK + GH
Sbjct: 407 EG--FKPYVLGAEEFSSTGSKFWEQ--KSQTLPRKAPRNHYSSVGENIREYKHNFLQTGH 462
Query: 346 RKIRVRLDHLDPWIWCDAKIVYVCKGPLDVSLLQLGYIPDQLCPIDADFGQPSLGSAAYV 405
R IRVRL HLD W WC A +VY+CK LD++LLQL Y+P +L PI A+F P LG+ A+V
Sbjct: 463 RDIRVRLCHLDSWTWCPANVVYICKEQLDIALLQLEYVPGKLQPITANFSSPPLGTTAHV 522
Query: 406 IGHGLFGPRCGLXXXXXXXXXXXXXXXNLPSYGQSTLQRNSAYPVMLETTAAVHPGGSGG 465
+GHGLFGPRCGL QS Q + +P MLETTAAVHPGGSGG
Sbjct: 523 VGHGLFGPRCGLSPSICSGVVAKVVHAKRRLNTQSISQEVAEFPAMLETTAAVHPGGSGG 582
Query: 466 AVVNLDGHMIGLVTSNARHGGGTVIPHLNFSIPCAVLRPIFEFARDMQEVSLLRKLDEPN 525
AV+N GHMIGLVTSNARHG GTVIPHLNFSIPCAVL PIF+FA DMQ ++L+ LD+P+
Sbjct: 583 AVLNSSGHMIGLVTSNARHGAGTVIPHLNFSIPCAVLAPIFKFAEDMQNTTILQTLDQPS 642
Query: 526 KHLASVWALMPPLSPKQGPSLPDLPQAALE-DNIEGKGSRFAKFIAERREVLKHSTQV 582
+ L+S+WALMP LSPK SLP+LP+ + +N + KGS+FAKFIAE +++ T++
Sbjct: 643 EELSSIWALMPSLSPKTEQSLPNLPKLLKDGNNKQTKGSQFAKFIAETQDMFVKPTKL 700
|
|
| DICTYBASE|DDB_G0279049 DDB_G0279049 "trypsin-like serine protease family protein" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q2T9J0 TYSND1 "Peroxisomal leader peptide-processing protease" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-030131-8525 tysnd1 "trypsin domain containing 1" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1SUE6 TYSND1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1919017 Tysnd1 "trypsin domain containing 1" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|1307354 Tysnd1 "trypsin domain containing 1" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|J9P6K2 TYSND1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BF31 E1BF31 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2R4X7 TYSND1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
| ID | Name | Annotated EC number | Identity | Query coverage | Hit coverage | RBH(Q2H) | RBH(H2Q) |
| Q8VZD4 | DEG15_ARATH | 3, ., 4, ., 2, 1, ., - | 0.5272 | 0.9262 | 0.7799 | yes | no |
EC Number Prediction by Ezypred Server
Original result from Ezypred Server
Fail to connect to Ezypred Server
EC Number Prediction by EFICAz Software
| Prediction Level | EC number | Confidence of Prediction |
| 3rd Layer | 3.4.21 | 0.691 |
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database part I
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 597 | |||
| pfam13365 | 138 | pfam13365, Trypsin_2, Trypsin-like peptidase domai | 6e-08 | |
| PRK10942 | 473 | PRK10942, PRK10942, serine endoprotease; Provision | 5e-07 | |
| PRK10139 | 455 | PRK10139, PRK10139, serine endoprotease; Provision | 1e-05 | |
| COG0265 | 347 | COG0265, DegQ, Trypsin-like serine proteases, typi | 2e-05 | |
| TIGR02037 | 428 | TIGR02037, degP_htrA_DO, periplasmic serine protea | 2e-05 | |
| TIGR02038 | 351 | TIGR02038, protease_degS, periplasmic serine pepet | 2e-04 | |
| pfam13365 | 138 | pfam13365, Trypsin_2, Trypsin-like peptidase domai | 0.003 |
| >gnl|CDD|222077 pfam13365, Trypsin_2, Trypsin-like peptidase domain | Back alignment and domain information |
|---|
Score = 51.8 bits (124), Expect = 6e-08
Identities = 29/117 (24%), Positives = 44/117 (37%), Gaps = 15/117 (12%)
Query: 361 CDAKIVYVCKGPLDVSLLQLGYIPDQLCPIDADFGQPSLGSAAYVIGHGLFGPRCGLSPS 420
A++V LD++LL++ P+ A P GS V G G G
Sbjct: 37 VPAEVVAADPD-LDLALLKVDGPLLPAAPLLASSAAPLGGSVVVVGGPGGIGLGASGGGG 95
Query: 421 VSSGVVAKVVKANLPSYGQSTLQRNSAYPVMLETTAAVHPGGSGGAVVNLDGHMIGL 477
G+V+ + Y + T A PG SGG V + DG ++G+
Sbjct: 96 GVGGLVSGSLGGVDGRY--------------ILTDADTSPGSSGGPVFDADGEVVGI 138
|
This family includes trypsin like peptidase domains. Length = 138 |
| >gnl|CDD|236802 PRK10942, PRK10942, serine endoprotease; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|182262 PRK10139, PRK10139, serine endoprotease; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223343 COG0265, DegQ, Trypsin-like serine proteases, typically periplasmic, contain C-terminal PDZ domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|233695 TIGR02037, degP_htrA_DO, periplasmic serine protease, Do/DeqQ family | Back alignment and domain information |
|---|
| >gnl|CDD|233696 TIGR02038, protease_degS, periplasmic serine pepetdase DegS | Back alignment and domain information |
|---|
| >gnl|CDD|222077 pfam13365, Trypsin_2, Trypsin-like peptidase domain | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 597 | |||
| PRK10139 | 455 | serine endoprotease; Provisional | 99.97 | |
| TIGR02038 | 351 | protease_degS periplasmic serine pepetdase DegS. T | 99.97 | |
| PRK10898 | 353 | serine endoprotease; Provisional | 99.96 | |
| PRK10942 | 473 | serine endoprotease; Provisional | 99.96 | |
| TIGR02037 | 428 | degP_htrA_DO periplasmic serine protease, Do/DeqQ | 99.95 | |
| COG0265 | 347 | DegQ Trypsin-like serine proteases, typically peri | 99.88 | |
| PRK10139 | 455 | serine endoprotease; Provisional | 99.86 | |
| PRK10942 | 473 | serine endoprotease; Provisional | 99.82 | |
| TIGR02038 | 351 | protease_degS periplasmic serine pepetdase DegS. T | 99.8 | |
| PRK10898 | 353 | serine endoprotease; Provisional | 99.79 | |
| TIGR02037 | 428 | degP_htrA_DO periplasmic serine protease, Do/DeqQ | 99.77 | |
| COG0265 | 347 | DegQ Trypsin-like serine proteases, typically peri | 99.72 | |
| PF13365 | 120 | Trypsin_2: Trypsin-like peptidase domain; PDB: 1Y8 | 99.6 | |
| KOG1320 | 473 | consensus Serine protease [Posttranslational modif | 99.51 | |
| KOG1320 | 473 | consensus Serine protease [Posttranslational modif | 99.26 | |
| PF00089 | 220 | Trypsin: Trypsin; InterPro: IPR001254 In the MEROP | 99.26 | |
| cd00190 | 232 | Tryp_SPc Trypsin-like serine protease; Many of the | 99.09 | |
| KOG1421 | 955 | consensus Predicted signaling-associated protein ( | 99.02 | |
| smart00020 | 229 | Tryp_SPc Trypsin-like serine protease. Many of the | 98.95 | |
| COG3591 | 251 | V8-like Glu-specific endopeptidase [Amino acid tra | 98.38 | |
| PF00863 | 235 | Peptidase_C4: Peptidase family C4 This family belo | 98.27 | |
| PF13365 | 120 | Trypsin_2: Trypsin-like peptidase domain; PDB: 1Y8 | 97.73 | |
| KOG3627 | 256 | consensus Trypsin [Amino acid transport and metabo | 97.5 | |
| PF03761 | 282 | DUF316: Domain of unknown function (DUF316) ; Inte | 97.17 | |
| COG5640 | 413 | Secreted trypsin-like serine protease [Posttransla | 96.92 | |
| PF05579 | 297 | Peptidase_S32: Equine arteritis virus serine endop | 96.76 | |
| PF00089 | 220 | Trypsin: Trypsin; InterPro: IPR001254 In the MEROP | 96.39 | |
| PF10459 | 698 | Peptidase_S46: Peptidase S46; InterPro: IPR019500 | 95.4 | |
| PF00548 | 172 | Peptidase_C3: 3C cysteine protease (picornain 3C); | 95.09 | |
| COG3591 | 251 | V8-like Glu-specific endopeptidase [Amino acid tra | 93.98 | |
| KOG1421 | 955 | consensus Predicted signaling-associated protein ( | 93.97 | |
| PF02907 | 148 | Peptidase_S29: Hepatitis C virus NS3 protease; Int | 92.07 | |
| PF00949 | 132 | Peptidase_S7: Peptidase S7, Flavivirus NS3 serine | 91.4 | |
| PF02907 | 148 | Peptidase_S29: Hepatitis C virus NS3 protease; Int | 90.53 | |
| PF10459 | 698 | Peptidase_S46: Peptidase S46; InterPro: IPR019500 | 90.34 | |
| PF00949 | 132 | Peptidase_S7: Peptidase S7, Flavivirus NS3 serine | 90.24 | |
| PF00863 | 235 | Peptidase_C4: Peptidase family C4 This family belo | 89.77 | |
| PF08192 | 695 | Peptidase_S64: Peptidase family S64; InterPro: IPR | 88.32 | |
| PF00944 | 158 | Peptidase_S3: Alphavirus core protein ; InterPro: | 88.24 | |
| smart00020 | 229 | Tryp_SPc Trypsin-like serine protease. Many of the | 87.65 | |
| cd00190 | 232 | Tryp_SPc Trypsin-like serine protease; Many of the | 87.55 | |
| PF05580 | 218 | Peptidase_S55: SpoIVB peptidase S55; InterPro: IPR | 86.59 | |
| PF08192 | 695 | Peptidase_S64: Peptidase family S64; InterPro: IPR | 80.57 |
| >PRK10139 serine endoprotease; Provisional | Back alignment and domain information |
|---|
Probab=99.97 E-value=1.6e-29 Score=277.46 Aligned_cols=192 Identities=29% Similarity=0.521 Sum_probs=158.0
Q ss_pred chHHHhccCceEEEEeCC----------------------------CeEEEEEEEeC-CcEEEecccccCCCCCcccccc
Q 007572 238 PLPIQKALASVCLITIDD----------------------------GVWASGVLLND-QGLILTNAHLLEPWRFGKTTVS 288 (597)
Q Consensus 238 p~~i~~a~~SVV~I~~~~----------------------------~~~GSGflIs~-~G~ILTnaHVV~p~~~~~t~~~ 288 (597)
..+++++.||||.|.+.. .++||||+|++ +||||||+||++.
T Consensus 43 ~~~~~~~~pavV~i~~~~~~~~~~~~~~~~~~~f~~~~~~~~~~~~~~~GSG~ii~~~~g~IlTn~HVv~~--------- 113 (455)
T PRK10139 43 APMLEKVLPAVVSVRVEGTASQGQKIPEEFKKFFGDDLPDQPAQPFEGLGSGVIIDAAKGYVLTNNHVINQ--------- 113 (455)
T ss_pred HHHHHHhCCcEEEEEEEEeecccccCchhHHHhccccCCccccccccceEEEEEEECCCCEEEeChHHhCC---------
Confidence 357899999999996410 14799999985 7999999999971
Q ss_pred CCcccccccCCCCCCCCCCCccccccccCCCCCCCcccccccccccccccccccCCceEEEEEEcCCCCceeEeeEEEEe
Q 007572 289 GWRNGVSFQPEDSASSGHTGVDQYQKSQTLPPKMPKIVDSSVDEHRAYKLSSFSRGHRKIRVRLDHLDPWIWCDAKIVYV 368 (597)
Q Consensus 289 g~~~~~~f~~~~~~~~~~~~~~~~q~~qtl~~k~i~i~~~~~~~~~~~~~~~~~~~~~~i~V~l~~~~~~~w~~A~Vv~~ 368 (597)
...+.|++.+++. |+|++++
T Consensus 114 --------------------------------------------------------a~~i~V~~~dg~~---~~a~vvg- 133 (455)
T PRK10139 114 --------------------------------------------------------AQKISIQLNDGRE---FDAKLIG- 133 (455)
T ss_pred --------------------------------------------------------CCEEEEEECCCCE---EEEEEEE-
Confidence 2247888888776 9999999
Q ss_pred ecCCCcEEEEEEccCCCCccceecCCC-CCCCCCeEEEEccCCCCCCCCCCCeeEeeEEeeeeeccCCCCCCcccccCCC
Q 007572 369 CKGPLDVSLLQLGYIPDQLCPIDADFG-QPSLGSAAYVIGHGLFGPRCGLSPSVSSGVVAKVVKANLPSYGQSTLQRNSA 447 (597)
Q Consensus 369 ~~~~~DLALLkl~~~~~~l~pi~l~~s-~~~~Ge~V~vIGyPlf~~~~g~~~svt~GiVS~v~~~~~~~~~~~~~~~~~~ 447 (597)
.|+.+||||||++. +..+++++++++ .+++||.|++|||| +|+..+++.|+||+..+.... ...
T Consensus 134 ~D~~~DlAvlkv~~-~~~l~~~~lg~s~~~~~G~~V~aiG~P-----~g~~~tvt~GivS~~~r~~~~---------~~~ 198 (455)
T PRK10139 134 SDDQSDIALLQIQN-PSKLTQIAIADSDKLRVGDFAVAVGNP-----FGLGQTATSGIISALGRSGLN---------LEG 198 (455)
T ss_pred EcCCCCEEEEEecC-CCCCceeEecCccccCCCCEEEEEecC-----CCCCCceEEEEEccccccccC---------CCC
Confidence 67789999999985 457889999775 58999999999995 577789999999998763110 023
Q ss_pred cCeEEEEcccccCCCCCCceecCCceEEEEEeeeecCCCCcccCceEEEEehhHHHHHHHHHHhcCCc
Q 007572 448 YPVMLETTAAVHPGGSGGAVVNLDGHMIGLVTSNARHGGGTVIPHLNFSIPCAVLRPIFEFARDMQEV 515 (597)
Q Consensus 448 ~~~~iqtdAav~~GnSGGPL~n~~G~VIGIvss~~~~~~g~~~p~lnFaIPi~~l~~~l~~~~~~gd~ 515 (597)
+..+|||||++++|||||||||.+|+||||+++.....++.. +++|+||++.++++++++.+.|.+
T Consensus 199 ~~~~iqtda~in~GnSGGpl~n~~G~vIGi~~~~~~~~~~~~--gigfaIP~~~~~~v~~~l~~~g~v 264 (455)
T PRK10139 199 LENFIQTDASINRGNSGGALLNLNGELIGINTAILAPGGGSV--GIGFAIPSNMARTLAQQLIDFGEI 264 (455)
T ss_pred cceEEEECCccCCCCCcceEECCCCeEEEEEEEEEcCCCCcc--ceEEEEEhHHHHHHHHHHhhcCcc
Confidence 456899999999999999999999999999999876654433 899999999999999999877665
|
|
| >TIGR02038 protease_degS periplasmic serine pepetdase DegS | Back alignment and domain information |
|---|
| >PRK10898 serine endoprotease; Provisional | Back alignment and domain information |
|---|
| >PRK10942 serine endoprotease; Provisional | Back alignment and domain information |
|---|
| >TIGR02037 degP_htrA_DO periplasmic serine protease, Do/DeqQ family | Back alignment and domain information |
|---|
| >COG0265 DegQ Trypsin-like serine proteases, typically periplasmic, contain C-terminal PDZ domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK10139 serine endoprotease; Provisional | Back alignment and domain information |
|---|
| >PRK10942 serine endoprotease; Provisional | Back alignment and domain information |
|---|
| >TIGR02038 protease_degS periplasmic serine pepetdase DegS | Back alignment and domain information |
|---|
| >PRK10898 serine endoprotease; Provisional | Back alignment and domain information |
|---|
| >TIGR02037 degP_htrA_DO periplasmic serine protease, Do/DeqQ family | Back alignment and domain information |
|---|
| >COG0265 DegQ Trypsin-like serine proteases, typically periplasmic, contain C-terminal PDZ domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13365 Trypsin_2: Trypsin-like peptidase domain; PDB: 1Y8T_A 2Z9I_A 3QO6_A 1L1J_A 1QY6_A 2O8L_A 3OTP_E 2ZLE_I 1KY9_A 3CS0_A | Back alignment and domain information |
|---|
| >KOG1320 consensus Serine protease [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1320 consensus Serine protease [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF00089 Trypsin: Trypsin; InterPro: IPR001254 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >cd00190 Tryp_SPc Trypsin-like serine protease; Many of these are synthesized as inactive precursor zymogens that are cleaved during limited proteolysis to generate their active forms | Back alignment and domain information |
|---|
| >KOG1421 consensus Predicted signaling-associated protein (contains a PDZ domain) [General function prediction only] | Back alignment and domain information |
|---|
| >smart00020 Tryp_SPc Trypsin-like serine protease | Back alignment and domain information |
|---|
| >COG3591 V8-like Glu-specific endopeptidase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PF00863 Peptidase_C4: Peptidase family C4 This family belongs to family C4 of the peptidase classification | Back alignment and domain information |
|---|
| >PF13365 Trypsin_2: Trypsin-like peptidase domain; PDB: 1Y8T_A 2Z9I_A 3QO6_A 1L1J_A 1QY6_A 2O8L_A 3OTP_E 2ZLE_I 1KY9_A 3CS0_A | Back alignment and domain information |
|---|
| >KOG3627 consensus Trypsin [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PF03761 DUF316: Domain of unknown function (DUF316) ; InterPro: IPR005514 This is a family of uncharacterised proteins from Caenorhabditis elegans | Back alignment and domain information |
|---|
| >COG5640 Secreted trypsin-like serine protease [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF05579 Peptidase_S32: Equine arteritis virus serine endopeptidase S32; InterPro: IPR008760 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >PF00089 Trypsin: Trypsin; InterPro: IPR001254 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >PF10459 Peptidase_S46: Peptidase S46; InterPro: IPR019500 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >PF00548 Peptidase_C3: 3C cysteine protease (picornain 3C); InterPro: IPR000199 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >COG3591 V8-like Glu-specific endopeptidase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG1421 consensus Predicted signaling-associated protein (contains a PDZ domain) [General function prediction only] | Back alignment and domain information |
|---|
| >PF02907 Peptidase_S29: Hepatitis C virus NS3 protease; InterPro: IPR004109 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >PF00949 Peptidase_S7: Peptidase S7, Flavivirus NS3 serine protease ; InterPro: IPR001850 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >PF02907 Peptidase_S29: Hepatitis C virus NS3 protease; InterPro: IPR004109 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >PF10459 Peptidase_S46: Peptidase S46; InterPro: IPR019500 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >PF00949 Peptidase_S7: Peptidase S7, Flavivirus NS3 serine protease ; InterPro: IPR001850 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >PF00863 Peptidase_C4: Peptidase family C4 This family belongs to family C4 of the peptidase classification | Back alignment and domain information |
|---|
| >PF08192 Peptidase_S64: Peptidase family S64; InterPro: IPR012985 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >PF00944 Peptidase_S3: Alphavirus core protein ; InterPro: IPR000930 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >smart00020 Tryp_SPc Trypsin-like serine protease | Back alignment and domain information |
|---|
| >cd00190 Tryp_SPc Trypsin-like serine protease; Many of these are synthesized as inactive precursor zymogens that are cleaved during limited proteolysis to generate their active forms | Back alignment and domain information |
|---|
| >PF05580 Peptidase_S55: SpoIVB peptidase S55; InterPro: IPR008763 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >PF08192 Peptidase_S64: Peptidase family S64; InterPro: IPR012985 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 597 | ||||
| 3stj_A | 345 | Crystal Structure Of The Protease + Pdz1 Domain Of | 2e-04 | ||
| 3sti_A | 245 | Crystal Structure Of The Protease Domain Of Degq Fr | 2e-04 | ||
| 4a8a_A | 436 | Asymmetric Cryo-Em Reconstruction Of E. Coli Degq 1 | 3e-04 | ||
| 3mh5_A | 456 | Htra Proteases Are Activated By A Conserved Mechani | 8e-04 | ||
| 2zle_A | 448 | Cryo-Em Structure Of Degp12OMP Length = 448 | 8e-04 |
| >pdb|3STJ|A Chain A, Crystal Structure Of The Protease + Pdz1 Domain Of Degq From Escherichia Coli Length = 345 | Back alignment and structure |
|
| >pdb|3STI|A Chain A, Crystal Structure Of The Protease Domain Of Degq From Escherichia Coli Length = 245 | Back alignment and structure |
| >pdb|4A8A|A Chain A, Asymmetric Cryo-Em Reconstruction Of E. Coli Degq 12-Mer In Complex With Lysozyme Length = 436 | Back alignment and structure |
| >pdb|3MH5|A Chain A, Htra Proteases Are Activated By A Conserved Mechanism That Can Be Triggered By Distinct Molecular Cues Length = 456 | Back alignment and structure |
| >pdb|2ZLE|A Chain A, Cryo-Em Structure Of Degp12OMP Length = 448 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Score = 61.0 bits (147), Expect = 7e-10
Identities = 43/317 (13%), Positives = 89/317 (28%), Gaps = 103/317 (32%)
Query: 123 YPPRSTTRSLLMADIR------------CLPGMEGGPVFGEHAHFVGILIRPLRQKSGAE 170
+ + +R +R + G+ G G K+
Sbjct: 126 FAKYNVSRLQPYLKLRQALLELRPAKNVLIDGVLG---SG---------------KT--- 164
Query: 171 IQLVIPWEAIATACSDLLLKEPQNAEKEIH-INKGNLNAVGNSLLFNSHILNGACCYKYE 229
W A C ++ + +I +N N N+ ++L L Y+ +
Sbjct: 165 ------WVA-LDVCLSYKVQ--CKMDFKIFWLNLKNCNSP-ETVLEMLQKL----LYQID 210
Query: 230 H-----VDSRCRSPLPIQKALASV-----------CLITIDDGVWASGVL----LNDQGL 269
D L I A + CL+ + + V + L+ + L
Sbjct: 211 PNWTSRSDHSSNIKLRIHSIQAELRRLLKSKPYENCLLVLLN-VQNAKAWNAFNLSCKIL 269
Query: 270 ILT----NAHLLEPWRFGKTTVSGWRNGVSFQPEDSAS--SGHTGVDQYQKSQTLPPKMP 323
+ T L ++ P++ S + + Q LP ++
Sbjct: 270 LTTRFKQVTDFLSAATTTHISLDHHSMT--LTPDEVKSLLLKYLDC----RPQDLPREVL 323
Query: 324 KI-------VDSSVDEHRA----YKLSSFSRGHRKIRVRLDHLDPWIWCDAKIVYVCKG- 371
+ S+ + A +K + + I L+ L+P + + ++
Sbjct: 324 TTNPRRLSIIAESIRDGLATWDNWKHVNCDKLTTIIESSLNVLEP---AEYRKMFDRLSV 380
Query: 372 -PLDVSLLQLGYIPDQL 387
P +IP L
Sbjct: 381 FPPSA------HIPTIL 391
|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >2vid_A Serine protease SPLB; hydrolase; 1.80A {Staphylococcus aureus} Length = 204 | Back alignment and structure |
|---|
| >3k6y_A Serine protease, possible membrane-associated serine protease; oxidative stress, disulfide, BENT helix, HY protease; 1.30A {Mycobacterium tuberculosis} PDB: 3k6z_A 3lt3_A Length = 237 | Back alignment and structure |
|---|
| >2as9_A Serine protease; trypsin-like fold, hydrolase; 1.70A {Staphylococcus aureus} Length = 210 | Back alignment and structure |
|---|
| >3lgi_A Protease DEGS; stress-sensor, HTRA, PDZ OMP, hydrolase, serine PR; 1.65A {Escherichia coli} PDB: 2qf3_A 2qf0_A 2rce_A* 3lh3_A* 3b8j_A 2qgr_A 3lh1_A 3lgy_A 3lgu_A 3lgv_A 3lgw_A 3lgt_A 2r3u_A Length = 237 | Back alignment and structure |
|---|
| >1y8t_A Hypothetical protein RV0983; serine protease, structural genomics, PSI, protein structure initiative; 2.00A {Mycobacterium tuberculosis} SCOP: b.36.1.4 b.47.1.1 PDB: 2z9i_A Length = 324 | Back alignment and structure |
|---|
| >3sti_A Protease DEGQ; serine protease, PDZ domain, chaperone, hydrolase; 2.60A {Escherichia coli} Length = 245 | Back alignment and structure |
|---|
| >2w7s_A Serine protease SPLA; hydrolase, family S1; 1.80A {Staphylococcus aureus} PDB: 2w7u_A Length = 200 | Back alignment and structure |
|---|
| >3stj_A Protease DEGQ; serine protease, PDZ domain, protease, chaperone, DEGP, DEGQ hydrolase; 2.60A {Escherichia coli} Length = 345 | Back alignment and structure |
|---|
| >1te0_A Protease DEGS; two domains, serine protease, PDZ, alpha-beta protein, hydro; 2.20A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3gdv_A* 3gcn_A* 3gds_A* 3gdu_A* 3gco_A* 1sot_A 1soz_A 1vcw_A 2r3y_A Length = 318 | Back alignment and structure |
|---|
| >2w5e_A Putative serine protease; coiled coil, transmembrane, thiol protease, RNA replication, ribosomal frameshifting, catalytic triad, membrane; 2.00A {Human astrovirus 1} Length = 163 | Back alignment and structure |
|---|
| >1l1j_A Heat shock protease HTRA; hydrolase, serine proteinase; 2.80A {Thermotoga maritima} SCOP: b.47.1.1 Length = 239 | Back alignment and structure |
|---|
| >4a8c_A Periplasmic PH-dependent serine endoprotease DEGQ; chaperone, hydrolase; 7.50A {Escherichia coli} PDB: 4a8a_A 4a8b_A 4a9g_A Length = 436 | Back alignment and structure |
|---|
| >1ky9_A Protease DO, DEGP, HTRA; protein quality control, serine protease, trypsin, chaperone, PDZ, ATP-independent, temperature-regulated, periplasm; 2.80A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3ou0_A 4a8d_A 3otp_A 3mh7_A 3mh4_A 3mh5_A* 3mh6_A* 3cs0_A 2zle_A Length = 448 | Back alignment and structure |
|---|
| >1agj_A Epidermolytic toxin A; hydrolase, serine protease; 1.70A {Staphylococcus aureus} SCOP: b.47.1.1 PDB: 1dua_A 1exf_A 1due_A Length = 242 | Back alignment and structure |
|---|
| >1qtf_A Exfoliative toxin B; serine protease, superantigen, hydrolase; 2.40A {Staphylococcus aureus} SCOP: b.47.1.1 PDB: 1dt2_A Length = 246 | Back alignment and structure |
|---|
| >3num_A Serine protease HTRA1; DEGP, hydrolase; 2.75A {Homo sapiens} PDB: 3nzi_A 3nwu_A 2ytw_A 2joa_A Length = 332 | Back alignment and structure |
|---|
| >3qo6_A Protease DO-like 1, chloroplastic; protease, HTRA, PH-sensor, hydrolase, photosynthesis; 2.50A {Arabidopsis thaliana} Length = 348 | Back alignment and structure |
|---|
| >3pv2_A DEGQ; trypsin fold, PDZ domain, chaperone protease, hydrolase; 2.15A {Legionella fallonii} PDB: 3pv3_A 3pv5_A 3pv4_A Length = 451 | Back alignment and structure |
|---|
| >3tjo_A Serine protease HTRA1; peptidase, hydrolase; HET: BOG; 2.30A {Homo sapiens} PDB: 3tjn_A 3nwu_A Length = 231 | Back alignment and structure |
|---|
| >1p3c_A Glutamyl-endopeptidase; serine protease, hydrolase; 1.50A {Bacillus intermedius} SCOP: b.47.1.1 PDB: 1p3e_A Length = 215 | Back alignment and structure |
|---|
| >1lcy_A HTRA2 serine protease; apoptosis, PDZ domain, caspase activation, binding, hydrolase; 2.00A {Homo sapiens} SCOP: b.36.1.4 b.47.1.1 Length = 325 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 597 | |||
| 3sti_A | 245 | Protease DEGQ; serine protease, PDZ domain, chaper | 99.97 | |
| 3stj_A | 345 | Protease DEGQ; serine protease, PDZ domain, protea | 99.97 | |
| 3lgi_A | 237 | Protease DEGS; stress-sensor, HTRA, PDZ OMP, hydro | 99.96 | |
| 4a8c_A | 436 | Periplasmic PH-dependent serine endoprotease DEGQ; | 99.96 | |
| 1l1j_A | 239 | Heat shock protease HTRA; hydrolase, serine protei | 99.96 | |
| 3tjo_A | 231 | Serine protease HTRA1; peptidase, hydrolase; HET: | 99.96 | |
| 4fln_A | 539 | Protease DO-like 2, chloroplastic; protease, DEG, | 99.96 | |
| 3qo6_A | 348 | Protease DO-like 1, chloroplastic; protease, HTRA, | 99.95 | |
| 1te0_A | 318 | Protease DEGS; two domains, serine protease, PDZ, | 99.95 | |
| 3pv2_A | 451 | DEGQ; trypsin fold, PDZ domain, chaperone protease | 99.95 | |
| 1ky9_A | 448 | Protease DO, DEGP, HTRA; protein quality control, | 99.95 | |
| 1y8t_A | 324 | Hypothetical protein RV0983; serine protease, stru | 99.95 | |
| 3num_A | 332 | Serine protease HTRA1; DEGP, hydrolase; 2.75A {Hom | 99.94 | |
| 1lcy_A | 325 | HTRA2 serine protease; apoptosis, PDZ domain, casp | 99.94 | |
| 3k6y_A | 237 | Serine protease, possible membrane-associated seri | 99.93 | |
| 2w5e_A | 163 | Putative serine protease; coiled coil, transmembra | 99.85 | |
| 4fln_A | 539 | Protease DO-like 2, chloroplastic; protease, DEG, | 99.82 | |
| 2as9_A | 210 | Serine protease; trypsin-like fold, hydrolase; 1.7 | 99.79 | |
| 1agj_A | 242 | Epidermolytic toxin A; hydrolase, serine protease; | 99.79 | |
| 3sti_A | 245 | Protease DEGQ; serine protease, PDZ domain, chaper | 99.79 | |
| 1ky9_A | 448 | Protease DO, DEGP, HTRA; protein quality control, | 99.76 | |
| 4a8c_A | 436 | Periplasmic PH-dependent serine endoprotease DEGQ; | 99.76 | |
| 3pv2_A | 451 | DEGQ; trypsin fold, PDZ domain, chaperone protease | 99.75 | |
| 3stj_A | 345 | Protease DEGQ; serine protease, PDZ domain, protea | 99.75 | |
| 1l1j_A | 239 | Heat shock protease HTRA; hydrolase, serine protei | 99.73 | |
| 2h5c_A | 198 | Alpha-lytic protease; serine protease, acylation t | 99.72 | |
| 2w7s_A | 200 | Serine protease SPLA; hydrolase, family S1; 1.80A | 99.69 | |
| 2o8l_A | 274 | V8 protease, taphylococcal serine; serine protease | 99.69 | |
| 1wcz_A | 268 | Glutamyl endopeptidase; virulence factor, hydrolas | 99.67 | |
| 2vid_A | 204 | Serine protease SPLB; hydrolase; 1.80A {Staphyloco | 99.67 | |
| 3lgi_A | 237 | Protease DEGS; stress-sensor, HTRA, PDZ OMP, hydro | 99.67 | |
| 3qo6_A | 348 | Protease DO-like 1, chloroplastic; protease, HTRA, | 99.65 | |
| 1qtf_A | 246 | Exfoliative toxin B; serine protease, superantigen | 99.63 | |
| 1te0_A | 318 | Protease DEGS; two domains, serine protease, PDZ, | 99.63 | |
| 1hpg_A | 187 | Glutamic acid specific protease; serine protease, | 99.62 | |
| 3tjo_A | 231 | Serine protease HTRA1; peptidase, hydrolase; HET: | 99.61 | |
| 1y8t_A | 324 | Hypothetical protein RV0983; serine protease, stru | 99.59 | |
| 3num_A | 332 | Serine protease HTRA1; DEGP, hydrolase; 2.75A {Hom | 99.56 | |
| 1lcy_A | 325 | HTRA2 serine protease; apoptosis, PDZ domain, casp | 99.56 | |
| 2oua_A | 188 | Serine protease, protein NAPA; kinetic stability, | 99.55 | |
| 2qa9_E | 185 | Streptogrisin-B; chymotrypsin-type serine peptidas | 99.52 | |
| 1mbm_A | 198 | NSP4 proteinase, chymotrypsin-like serine protease | 99.48 | |
| 2pfe_A | 186 | Protease A, alkaline serine protease, TFPA; beta-b | 99.47 | |
| 2ea3_A | 189 | Chymotrypsin; celloulomonas, protease, hydrolase; | 99.46 | |
| 2sga_A | 181 | Proteinase A; hydrolase (serine proteinase); 1.50A | 99.44 | |
| 2h5c_A | 198 | Alpha-lytic protease; serine protease, acylation t | 99.41 | |
| 3k6y_A | 237 | Serine protease, possible membrane-associated seri | 99.37 | |
| 3s9c_A | 234 | Vipera russelli proteinase RVV-V gamma; serine pro | 99.28 | |
| 3fan_A | 213 | Non-structural protein; chymotrypsin-like, N-termi | 99.27 | |
| 3s69_A | 234 | Thrombin-like enzyme defibrase; beta-barrel, serin | 99.27 | |
| 1pq7_A | 224 | Trypsin; ultra-high resolution, catalysis, hydrola | 99.27 | |
| 1a7s_A | 225 | Heparin binding protein; serine protease homolog, | 99.24 | |
| 1lo6_A | 223 | Kallikrein 6, HK6; serine protease, human kallikre | 99.23 | |
| 1ao5_A | 237 | Glandular kallikrein-13; serine protease, protein | 99.22 | |
| 2zch_P | 237 | Prostate-specific antigen; human PSA, kallikrein r | 99.22 | |
| 1npm_A | 225 | Neuropsin; serine proteinase, glycoprotein; HET: N | 99.22 | |
| 1orf_A | 234 | Granzyme A; hydrolase-hydrolase inhibitor complex; | 99.21 | |
| 1gvz_A | 237 | Kallikrein-1E2; antigen, prostate specific antigen | 99.21 | |
| 4e7n_A | 238 | Snake-venom thrombin-like enzyme; beta-barrel, hyd | 99.21 | |
| 2w5e_A | 163 | Putative serine protease; coiled coil, transmembra | 99.21 | |
| 2bdg_A | 223 | Kallikrein-4; serine proteinase, S1 subsite, 70-80 | 99.21 | |
| 1hj8_A | 222 | Trypsin I; hydrolase, radiation damage, disulphide | 99.2 | |
| 2xw9_A | 228 | Complement factor D; immune system, hydrolase, ser | 99.2 | |
| 2z7f_E | 218 | Leukocyte elastase; serine protease, serine protea | 99.19 | |
| 2as9_A | 210 | Serine protease; trypsin-like fold, hydrolase; 1.7 | 99.19 | |
| 1mza_A | 240 | Pro-granzyme K; apoptosis, serine protease, S1 fam | 99.19 | |
| 3h7t_A | 235 | Group 3 allergen smipp-S YVT004A06; hydrolase; 2.0 | 99.18 | |
| 2psx_A | 227 | Kallikrein-5; zinc inhibition, stratum corneum, gl | 99.18 | |
| 1ton_A | 235 | Tonin; hydrolase(serine proteinase); 1.80A {Rattus | 99.18 | |
| 3mfj_A | 223 | Cationic trypsin; serine proteinase, hydrolase; 0. | 99.17 | |
| 1spj_A | 238 | Kallikrein 1; serine protease, KLK1, HK1, hydrolas | 99.17 | |
| 4i8h_A | 223 | Cationic trypsin, beta-trypsin; serine protease, h | 99.17 | |
| 1fuj_A | 221 | PR3, myeloblastin; hydrolase, serine protease, gly | 99.17 | |
| 1hpg_A | 187 | Glutamic acid specific protease; serine protease, | 99.16 | |
| 1azz_A | 226 | Collagenase; complex (serine protease/inhibitor), | 99.16 | |
| 1sgf_A | 240 | 7S NGF, nerve growth factor; growth factor (beta-N | 99.15 | |
| 2qxi_A | 224 | Kallikrein-7; S1 pocket, chloromethyl ketone, alte | 99.15 | |
| 1p3c_A | 215 | Glutamyl-endopeptidase; serine protease, hydrolase | 99.14 | |
| 1fxy_A | 228 | Coagulation factor XA-trypsin chimera; protease, c | 99.14 | |
| 2aiq_A | 231 | Protein C activator; snake venom serine proteinase | 99.14 | |
| 1iau_A | 227 | Granzyme B; hydrolase-hydrolase inhibitor complex; | 99.14 | |
| 4dgj_A | 235 | Enteropeptidase catalytic light chain; serine prot | 99.13 | |
| 2zgc_A | 240 | Granzyme M; serine protease, cytolysis, glycoprote | 99.13 | |
| 4ag1_A | 226 | Chymase; hydrolase-de novo protein complex, inhibi | 99.12 | |
| 3gyl_B | 261 | Prostasin; ENAC, zymogen, divalent cation, channel | 99.11 | |
| 1si5_H | 240 | Scatter factor, hepatocyte growth factor, SF, hepa | 99.11 | |
| 2oq5_A | 232 | Transmembrane protease, serine 11E; type II trans- | 99.1 | |
| 1gvk_B | 240 | Elastase 1, peptide inhibitor; hydrolase, serine p | 99.1 | |
| 2f91_A | 237 | Hepatopancreas trypsin; trypsin, canonical inhibit | 99.1 | |
| 2hlc_A | 230 | Collagenase; serine protease, hydrolase, collagen | 99.09 | |
| 1eq9_A | 222 | Chymotrypsin; FIRE ANT, serine proteinase, hydrola | 99.09 | |
| 2any_A | 241 | Kininogenin, plasma kallikrein, light chain, fletc | 99.09 | |
| 3rp2_A | 224 | RAT MAST cell protease II; serine proteinase; 1.90 | 99.08 | |
| 2asu_B | 234 | Hepatocyte growth factor-like protein; serine prot | 99.07 | |
| 1euf_A | 227 | Duodenase; serine protease, dual specificity, hydr | 99.07 | |
| 3fzz_A | 227 | Granzyme C; hydrolase, cytolysis, protease, serine | 99.07 | |
| 1elt_A | 236 | Elastase; serine proteinase; 1.61A {Salmo salar} S | 99.06 | |
| 1cgh_A | 224 | Cathepsin G; inflammation, specificity, serine pro | 99.06 | |
| 3gov_B | 251 | MAsp-1; complement, serine protease, beta barrel, | 99.06 | |
| 2oua_A | 188 | Serine protease, protein NAPA; kinetic stability, | 99.05 | |
| 1bru_P | 241 | Elastase, PPE; serine protease, hydrolase; HET: 1N | 99.05 | |
| 3h7o_A | 228 | Group 3 allergen smipp-S YV6023A04; hydrolase; 1.8 | 99.03 | |
| 1zyo_A | 191 | Serine protease; beta-barrel, glutamyl endopeptida | 99.03 | |
| 3ncl_A | 241 | Suppressor of tumorigenicity 14 protein; proteinas | 99.02 | |
| 3cp7_A | 218 | Alkaline serine protease Al20; trypsin-like, hydro | 99.01 | |
| 1t8o_A | 245 | Chymotrypsin A; chymotrypsin, serine proteinase, B | 99.0 | |
| 3bg8_A | 238 | Coagulation factor XIA light chain; protease inhib | 99.0 | |
| 1arb_A | 268 | Achromobacter protease I; hydrolase(serine proteas | 99.0 | |
| 2r0l_A | 248 | Hepatocyte growth factor activator; serine proteas | 98.99 | |
| 1m9u_A | 241 | Earthworm fibrinolytic enzyme; hydrolase, serine p | 98.99 | |
| 3beu_A | 224 | Trypsin, SGT; beta sheets, serine protease, hydrol | 98.99 | |
| 1ym0_A | 238 | Fibrinotic enzyme component B; two chains, glycosy | 98.99 | |
| 1pyt_D | 251 | TC, PCPA-TC, chymotrypsinogen C; ternary complex ( | 98.98 | |
| 3mhw_U | 247 | Urokinase-type plasminogen activator; hydrolase, b | 98.98 | |
| 2ea3_A | 189 | Chymotrypsin; celloulomonas, protease, hydrolase; | 98.98 | |
| 1aut_C | 250 | Activated protein C; serine proteinase, plasma cal | 98.97 | |
| 1ddj_A | 247 | Plasminogen; catalytic domain, blood clotting; 2.0 | 98.97 | |
| 2jde_A | 276 | Urokinase-type plasminogen activator; plasminogen | 98.97 | |
| 2bz6_H | 254 | Blood coagulation factor VIIA; serine protease, en | 98.95 | |
| 3tvj_B | 242 | Mannan-binding lectin serine protease 2 B chain; i | 98.95 | |
| 2jkh_A | 241 | Activated factor XA heavy chain; plasma, calcium, | 98.94 | |
| 2pfe_A | 186 | Protease A, alkaline serine protease, TFPA; beta-b | 98.93 | |
| 1fon_A | 240 | Procarboxypeptidase A-S6; truncated zymogen E, ser | 98.93 | |
| 1yc0_A | 283 | Hepatocyte growth factor activator; hydrolase/inhi | 98.92 | |
| 1rtf_B | 252 | (TC)-T-PA, two chain tissue plasminogen activator; | 98.92 | |
| 2olg_A | 278 | Pro-phenoloxidase activating enzyme-I; prophenolox | 98.9 | |
| 2wph_S | 235 | Coagulation factor IXA heavy chain; serine proteas | 98.86 | |
| 1z8g_A | 372 | Serine protease hepsin; serine protease hepsin, pr | 98.85 | |
| 2w7s_A | 200 | Serine protease SPLA; hydrolase, family S1; 1.80A | 98.83 | |
| 2f9n_A | 245 | Alpha I tryptase; serine proteinase, trypsin-like, | 98.82 | |
| 2qy0_B | 242 | Complement C1R subcomponent; serine protease, beta | 98.81 | |
| 3rm2_H | 259 | Thrombin heavy chain; serine protease, kringle, hy | 98.81 | |
| 1fiw_A | 290 | Beta-acrosin heavy chain; anti-parallel beta-barre | 98.8 | |
| 4f4o_C | 347 | Haptoglobin; globin fold, serine protease fold, co | 98.78 | |
| 3f1s_B | 283 | Vitamin K-dependent protein Z; PZ, ZPI, complex, s | 98.77 | |
| 2vnt_A | 276 | Urokinase-type plasminogen activator; UPA, inhibit | 98.77 | |
| 2bdy_A | 289 | Thrombin; thrombin, complex structure, hydrolase, | 98.76 | |
| 3h5c_B | 317 | Vitamin K-dependent protein Z; protein Z-protein Z | 98.75 | |
| 1agj_A | 242 | Epidermolytic toxin A; hydrolase, serine protease; | 98.67 | |
| 2xxl_A | 408 | GRAM-positive specific serine protease, isoform B; | 98.66 | |
| 1zjk_A | 403 | Mannan-binding lectin serine protease 2; beta barr | 98.65 | |
| 2sga_A | 181 | Proteinase A; hydrolase (serine proteinase); 1.50A | 98.64 | |
| 4dur_A | 791 | Plasminogen, serine protease; fibrinolysis, hydrol | 98.63 | |
| 2b9l_A | 394 | Prophenoloxidase activating factor; CLIP domain, e | 98.6 | |
| 1elv_A | 333 | Complement C1S component; trypsin-like serin prote | 98.6 | |
| 2vid_A | 204 | Serine protease SPLB; hydrolase; 1.80A {Staphyloco | 98.58 | |
| 1rrk_A | 497 | Complement factor B; BB, hydrolase; 2.00A {Homo sa | 98.56 | |
| 1md8_A | 329 | C1R complement serine protease; innate immunity, a | 98.55 | |
| 2f83_A | 625 | Coagulation factor XI; protease, apple domain, hyd | 98.54 | |
| 3mmg_A | 241 | Nuclear inclusion protein A; 3C-type protease, TEV | 98.54 | |
| 3hrz_D | 741 | Complement factor B; serine protease, glycosilated | 98.53 | |
| 2xrc_A | 565 | Human complement factor I; immune system, hydrolas | 98.52 | |
| 1gpz_A | 399 | Complement C1R component; hydrolase, activation, i | 98.52 | |
| 3nxp_A | 424 | Prethrombin-1; allostery, blood coagulation, hydro | 98.43 | |
| 1yph_C | 131 | Chymotrypsin A, chain B; serine protease, hydrolas | 98.41 | |
| 2o8l_A | 274 | V8 protease, taphylococcal serine; serine protease | 98.31 | |
| 2odp_A | 509 | Complement C2; C3/C5 convertase, complement serin | 98.29 | |
| 1qtf_A | 246 | Exfoliative toxin B; serine protease, superantigen | 98.27 | |
| 2qa9_E | 185 | Streptogrisin-B; chymotrypsin-type serine peptidas | 98.23 | |
| 1wcz_A | 268 | Glutamyl endopeptidase; virulence factor, hydrolas | 98.2 | |
| 1lvm_A | 229 | Catalytic domain of the nuclear inclusion protein | 98.05 | |
| 2pka_B | 152 | Kallikrein A; serine proteinase; 2.05A {Sus scrofa | 98.01 | |
| 3fan_A | 213 | Non-structural protein; chymotrypsin-like, N-termi | 97.87 | |
| 1mbm_A | 198 | NSP4 proteinase, chymotrypsin-like serine protease | 97.81 | |
| 3qzr_A | 187 | 3C protein; chymotrypsin-fold, beta-ribbon, hydrol | 96.76 | |
| 3q3y_A | 191 | HEVB EV93 3C protease; cysteine trypsin-like prote | 96.75 | |
| 3zve_A | 190 | 3C protease; hydrolase, michael inhibitor; HET: G8 | 96.6 | |
| 2b0f_A | 182 | Picornain 3C (protease 3C) (P3C); beta barrel, hyd | 96.22 | |
| 2pka_A | 80 | Kallikrein A; serine proteinase; 2.05A {Sus scrofa | 96.13 | |
| 4dcd_A | 190 | Protease 3C, genome polyprotein; antiviral inhibit | 95.97 | |
| 1cqq_A | 180 | Type 2 rhinovirus 3C protease; viral protein, hydr | 95.7 | |
| 3mmg_A | 241 | Nuclear inclusion protein A; 3C-type protease, TEV | 95.1 | |
| 2hal_A | 212 | Hepatitis A protease 3C; 3C protease, inhibitor de | 94.64 | |
| 1p3c_A | 215 | Glutamyl-endopeptidase; serine protease, hydrolase | 94.56 | |
| 2ijd_1 | 644 | Picornain 3C, RNA-directed RNA polymerase; RNA-dep | 93.99 | |
| 1zyo_A | 191 | Serine protease; beta-barrel, glutamyl endopeptida | 93.59 | |
| 2pka_B | 152 | Kallikrein A; serine proteinase; 2.05A {Sus scrofa | 92.89 | |
| 2bhg_A | 209 | Foot-and-mouth disease virus 3C protease; chymotry | 92.72 | |
| 1pq7_A | 224 | Trypsin; ultra-high resolution, catalysis, hydrola | 92.17 | |
| 1ao5_A | 237 | Glandular kallikrein-13; serine protease, protein | 92.07 | |
| 3s9c_A | 234 | Vipera russelli proteinase RVV-V gamma; serine pro | 91.93 | |
| 1ton_A | 235 | Tonin; hydrolase(serine proteinase); 1.80A {Rattus | 91.81 | |
| 1fuj_A | 221 | PR3, myeloblastin; hydrolase, serine protease, gly | 91.67 | |
| 1mza_A | 240 | Pro-granzyme K; apoptosis, serine protease, S1 fam | 91.16 | |
| 1sgf_A | 240 | 7S NGF, nerve growth factor; growth factor (beta-N | 90.86 | |
| 3h7t_A | 235 | Group 3 allergen smipp-S YVT004A06; hydrolase; 2.0 | 90.79 | |
| 1lvm_A | 229 | Catalytic domain of the nuclear inclusion protein | 90.67 | |
| 1npm_A | 225 | Neuropsin; serine proteinase, glycoprotein; HET: N | 90.64 | |
| 1spj_A | 238 | Kallikrein 1; serine protease, KLK1, HK1, hydrolas | 90.53 | |
| 1lo6_A | 223 | Kallikrein 6, HK6; serine protease, human kallikre | 90.35 | |
| 1hj8_A | 222 | Trypsin I; hydrolase, radiation damage, disulphide | 90.26 | |
| 2zch_P | 237 | Prostate-specific antigen; human PSA, kallikrein r | 89.6 | |
| 2z7f_E | 218 | Leukocyte elastase; serine protease, serine protea | 89.34 | |
| 2bdg_A | 223 | Kallikrein-4; serine proteinase, S1 subsite, 70-80 | 89.2 | |
| 1cgh_A | 224 | Cathepsin G; inflammation, specificity, serine pro | 89.19 | |
| 4i8h_A | 223 | Cationic trypsin, beta-trypsin; serine protease, h | 89.08 | |
| 2zgc_A | 240 | Granzyme M; serine protease, cytolysis, glycoprote | 88.95 | |
| 1si5_H | 240 | Scatter factor, hepatocyte growth factor, SF, hepa | 88.9 | |
| 3mfj_A | 223 | Cationic trypsin; serine proteinase, hydrolase; 0. | 88.75 | |
| 3s69_A | 234 | Thrombin-like enzyme defibrase; beta-barrel, serin | 88.59 | |
| 2qxi_A | 224 | Kallikrein-7; S1 pocket, chloromethyl ketone, alte | 88.59 | |
| 1wxr_A | 1048 | Haemoglobin protease; hemoglobine protease, autotr | 88.43 | |
| 4e7n_A | 238 | Snake-venom thrombin-like enzyme; beta-barrel, hyd | 88.42 | |
| 3su6_A | 203 | NS3 protease, NS4A protein; drug resistance, drug | 88.35 | |
| 1gvz_A | 237 | Kallikrein-1E2; antigen, prostate specific antigen | 87.85 | |
| 1euf_A | 227 | Duodenase; serine protease, dual specificity, hydr | 87.79 | |
| 1fxy_A | 228 | Coagulation factor XA-trypsin chimera; protease, c | 87.52 | |
| 2oq5_A | 232 | Transmembrane protease, serine 11E; type II trans- | 87.34 | |
| 3su6_A | 203 | NS3 protease, NS4A protein; drug resistance, drug | 87.27 | |
| 3h7o_A | 228 | Group 3 allergen smipp-S YV6023A04; hydrolase; 1.8 | 86.92 | |
| 2psx_A | 227 | Kallikrein-5; zinc inhibition, stratum corneum, gl | 86.51 | |
| 2aiq_A | 231 | Protein C activator; snake venom serine proteinase | 86.43 | |
| 2asu_B | 234 | Hepatocyte growth factor-like protein; serine prot | 86.07 | |
| 3rp2_A | 224 | RAT MAST cell protease II; serine proteinase; 1.90 | 85.47 | |
| 1a7s_A | 225 | Heparin binding protein; serine protease homolog, | 85.45 | |
| 3gyl_B | 261 | Prostasin; ENAC, zymogen, divalent cation, channel | 85.31 | |
| 3cp7_A | 218 | Alkaline serine protease Al20; trypsin-like, hydro | 85.2 | |
| 3zve_A | 190 | 3C protease; hydrolase, michael inhibitor; HET: G8 | 85.14 | |
| 1iau_A | 227 | Granzyme B; hydrolase-hydrolase inhibitor complex; | 84.96 | |
| 2f91_A | 237 | Hepatopancreas trypsin; trypsin, canonical inhibit | 84.73 | |
| 2jde_A | 276 | Urokinase-type plasminogen activator; plasminogen | 84.67 | |
| 1orf_A | 234 | Granzyme A; hydrolase-hydrolase inhibitor complex; | 84.6 | |
| 4ag1_A | 226 | Chymase; hydrolase-de novo protein complex, inhibi | 84.51 | |
| 1arb_A | 268 | Achromobacter protease I; hydrolase(serine proteas | 84.41 | |
| 1ep5_B | 157 | Capsid protein C, coat protein C; beta barrel, hyd | 84.18 | |
| 2bhg_A | 209 | Foot-and-mouth disease virus 3C protease; chymotry | 83.87 | |
| 1bru_P | 241 | Elastase, PPE; serine protease, hydrolase; HET: 1N | 83.68 | |
| 3mhw_U | 247 | Urokinase-type plasminogen activator; hydrolase, b | 83.5 | |
| 2fp7_B | 172 | Serine protease NS3; flavivirus, NS3 protease, NS2 | 83.44 | |
| 1vcp_A | 149 | Semliki forest virus capsid protein; virus coat pr | 83.32 | |
| 1z8g_A | 372 | Serine protease hepsin; serine protease hepsin, pr | 83.26 | |
| 2xw9_A | 228 | Complement factor D; immune system, hydrolase, ser | 83.14 | |
| 4agk_A | 158 | Capsid protein, coat protein, C; hydrolase, viral | 83.13 | |
| 3e90_B | 198 | NS3 protease; trypsin-like serine protease, protea | 83.01 | |
| 3ncl_A | 241 | Suppressor of tumorigenicity 14 protein; proteinas | 82.99 | |
| 1azz_A | 226 | Collagenase; complex (serine protease/inhibitor), | 82.74 | |
| 2fom_B | 185 | Polyprotein; flavivirus, NS3 protease, NS2B cofact | 82.52 | |
| 4dcd_A | 190 | Protease 3C, genome polyprotein; antiviral inhibit | 82.48 | |
| 2ggv_B | 185 | NS3, non-structural protein 3; beta barrel, serine | 82.46 | |
| 3u1j_B | 191 | Serine protease NS3; serine protease, ER MEM hydro | 82.34 | |
| 3beu_A | 224 | Trypsin, SGT; beta sheets, serine protease, hydrol | 82.33 | |
| 1m9u_A | 241 | Earthworm fibrinolytic enzyme; hydrolase, serine p | 82.23 | |
| 3fzz_A | 227 | Granzyme C; hydrolase, cytolysis, protease, serine | 82.0 | |
| 1yc0_A | 283 | Hepatocyte growth factor activator; hydrolase/inhi | 81.86 | |
| 2yew_A | 253 | Capsid protein, coat protein; alphavirus, molecula | 81.78 | |
| 3gov_B | 251 | MAsp-1; complement, serine protease, beta barrel, | 81.65 | |
| 4dgj_A | 235 | Enteropeptidase catalytic light chain; serine prot | 81.15 | |
| 1yph_E | 97 | Chymotrypsin A, chain C; serine protease, hydrolas | 81.0 | |
| 1aut_C | 250 | Activated protein C; serine proteinase, plasma cal | 80.44 | |
| 3lkw_A | 236 | Fusion protein of nonstructural protein 2B and non | 80.38 |
| >3sti_A Protease DEGQ; serine protease, PDZ domain, chaperone, hydrolase; 2.60A {Escherichia coli} | Back alignment and structure |
|---|
Probab=99.97 E-value=1.1e-30 Score=263.89 Aligned_cols=190 Identities=30% Similarity=0.524 Sum_probs=147.4
Q ss_pred hHHHhccCceEEEEeCC----------------------------CeEEEEEEEeCC-cEEEecccccCCCCCccccccC
Q 007572 239 LPIQKALASVCLITIDD----------------------------GVWASGVLLNDQ-GLILTNAHLLEPWRFGKTTVSG 289 (597)
Q Consensus 239 ~~i~~a~~SVV~I~~~~----------------------------~~~GSGflIs~~-G~ILTnaHVV~p~~~~~t~~~g 289 (597)
.+++++.+|||.|.+.. .+.||||+|+++ ||||||+||++.
T Consensus 17 ~~~~~~~paVV~I~~~~~~~~~~~~~~~~~~~f~~~~~~~~~~~~~~~GSGfiI~~~~G~IlTnaHvv~~---------- 86 (245)
T 3sti_A 17 PMLEKVLPAVVSVRVEGTASQGQKIPEEFKKFFGDDLPDQPAQPFEGLGSGVIINASKGYVLTNNHVINQ---------- 86 (245)
T ss_dssp HHHHHHGGGEEEC----------------------------------CCEEEEEETTTTEEEECGGGC------------
T ss_pred HHHHHhCCceEEEEEEEeeccccccchhhhhhccccccccccccccceEEEEEEeCCCCEEEEcHHHhCC----------
Confidence 57999999999997631 357999999998 999999999961
Q ss_pred CcccccccCCCCCCCCCCCccccccccCCCCCCCcccccccccccccccccccCCceEEEEEEcCCCCceeEeeEEEEee
Q 007572 290 WRNGVSFQPEDSASSGHTGVDQYQKSQTLPPKMPKIVDSSVDEHRAYKLSSFSRGHRKIRVRLDHLDPWIWCDAKIVYVC 369 (597)
Q Consensus 290 ~~~~~~f~~~~~~~~~~~~~~~~q~~qtl~~k~i~i~~~~~~~~~~~~~~~~~~~~~~i~V~l~~~~~~~w~~A~Vv~~~ 369 (597)
...+.|++.++.. ++|++++ .
T Consensus 87 -------------------------------------------------------a~~i~V~~~dg~~---~~a~vv~-~ 107 (245)
T 3sti_A 87 -------------------------------------------------------AQKISIQLNDGRE---FDAKLIG-S 107 (245)
T ss_dssp ---------------------------------------------------------CEEEECTTSCE---EEEEEEE-E
T ss_pred -------------------------------------------------------CCEEEEEECCCCE---EEEEEEE-e
Confidence 1136677766654 8899988 5
Q ss_pred cCCCcEEEEEEccCCCCccceecCCC-CCCCCCeEEEEccCCCCCCCCCCCeeEeeEEeeeeeccCCCCCCcccccCCCc
Q 007572 370 KGPLDVSLLQLGYIPDQLCPIDADFG-QPSLGSAAYVIGHGLFGPRCGLSPSVSSGVVAKVVKANLPSYGQSTLQRNSAY 448 (597)
Q Consensus 370 ~~~~DLALLkl~~~~~~l~pi~l~~s-~~~~Ge~V~vIGyPlf~~~~g~~~svt~GiVS~v~~~~~~~~~~~~~~~~~~~ 448 (597)
++.+||||||++. +..++++.+.++ .+++|+.|+++||| .++..+++.|+|++..+... ....+
T Consensus 108 d~~~DlAlLkv~~-~~~~~~~~l~~s~~~~~G~~v~aiG~P-----~g~~~~vt~G~vs~~~~~~~---------~~~~~ 172 (245)
T 3sti_A 108 DDQSDIALLQIQN-PSKLTQIAIADSDKLRVGDFAVAVGNP-----FGLGQTATSGIVSALGRSGL---------NLEGL 172 (245)
T ss_dssp ETTTTEEEEEESS-CCSCCCCCBCCGGGCCTTBEEEEEECG-----GGSCCEEEEEEEEECSSCSS---------CCTTC
T ss_pred cCCCCEEEEEecc-CCCCceeeecCcCCCCCCCEEEEEECC-----CCCCCcEEeeEEeeeccccc---------CCCCc
Confidence 6789999999975 457888888764 58999999999995 56778999999998765310 01234
Q ss_pred CeEEEEcccccCCCCCCceecCCceEEEEEeeeecCCCCcccCceEEEEehhHHHHHHHHHHhcCC
Q 007572 449 PVMLETTAAVHPGGSGGAVVNLDGHMIGLVTSNARHGGGTVIPHLNFSIPCAVLRPIFEFARDMQE 514 (597)
Q Consensus 449 ~~~iqtdAav~~GnSGGPL~n~~G~VIGIvss~~~~~~g~~~p~lnFaIPi~~l~~~l~~~~~~gd 514 (597)
..++|+|+++++|||||||||.+|+||||+++.....++.. +++||||++.++++++++.+.|+
T Consensus 173 ~~~i~tda~i~~G~SGGPLvn~~G~vVGI~s~~~~~~~~~~--g~~faIP~~~~~~~~~~l~~~g~ 236 (245)
T 3sti_A 173 ENFIQTDASINRGNSGGALLNLNGELIGINTAILAPGGGSV--GIGFAIPSNMARTLAQQLIDFGE 236 (245)
T ss_dssp SSCEEESSCCCTTTTTSEEECTTSCEEEEEECCC------C--CCEEEEEHHHHHHHHHHHHHHHH
T ss_pred cCEEEEcCCcCCCcchhHeecCCCeEEEEEEeEECCCCCcc--eEEEEEeHHHHHHHHHHHHHcCC
Confidence 55799999999999999999999999999999876544433 89999999999999999987665
|
| >3stj_A Protease DEGQ; serine protease, PDZ domain, protease, chaperone, DEGP, DEGQ hydrolase; 2.60A {Escherichia coli} | Back alignment and structure |
|---|
| >3lgi_A Protease DEGS; stress-sensor, HTRA, PDZ OMP, hydrolase, serine PR; 1.65A {Escherichia coli} PDB: 2qf3_A 2qf0_A 2rce_A* 3lh3_A* 3b8j_A 2qgr_A 3lh1_A 3lgy_A 3lgu_A 3lgv_A 3lgw_A 3lgt_A 2r3u_A | Back alignment and structure |
|---|
| >4a8c_A Periplasmic PH-dependent serine endoprotease DEGQ; chaperone, hydrolase; 7.50A {Escherichia coli} PDB: 4a8a_A 4a8b_A 4a9g_A | Back alignment and structure |
|---|
| >1l1j_A Heat shock protease HTRA; hydrolase, serine proteinase; 2.80A {Thermotoga maritima} SCOP: b.47.1.1 | Back alignment and structure |
|---|
| >3tjo_A Serine protease HTRA1; peptidase, hydrolase; HET: BOG; 2.30A {Homo sapiens} PDB: 3tjn_A 3nwu_A | Back alignment and structure |
|---|
| >4fln_A Protease DO-like 2, chloroplastic; protease, DEG, PDZ, hydrolase; 2.80A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3qo6_A Protease DO-like 1, chloroplastic; protease, HTRA, PH-sensor, hydrolase, photosynthesis; 2.50A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1te0_A Protease DEGS; two domains, serine protease, PDZ, alpha-beta protein, hydro; 2.20A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3gdv_A* 3gcn_A* 3gds_A* 3gdu_A* 3gco_A* 1sot_A 1soz_A 1vcw_A 2r3y_A | Back alignment and structure |
|---|
| >3pv2_A DEGQ; trypsin fold, PDZ domain, chaperone protease, hydrolase; 2.15A {Legionella fallonii} PDB: 3pv3_A 3pv5_A 3pv4_A | Back alignment and structure |
|---|
| >1ky9_A Protease DO, DEGP, HTRA; protein quality control, serine protease, trypsin, chaperone, PDZ, ATP-independent, temperature-regulated, periplasm; 2.80A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3ou0_A 4a8d_A 3otp_A 3mh7_A 3mh4_A 3mh5_A* 3mh6_A* 3cs0_A 2zle_A | Back alignment and structure |
|---|
| >1y8t_A Hypothetical protein RV0983; serine protease, structural genomics, PSI, protein structure initiative; 2.00A {Mycobacterium tuberculosis} SCOP: b.36.1.4 b.47.1.1 PDB: 2z9i_A | Back alignment and structure |
|---|
| >3num_A Serine protease HTRA1; DEGP, hydrolase; 2.75A {Homo sapiens} PDB: 3nzi_A 2ytw_A 2joa_A | Back alignment and structure |
|---|
| >1lcy_A HTRA2 serine protease; apoptosis, PDZ domain, caspase activation, binding, hydrolase; 2.00A {Homo sapiens} SCOP: b.36.1.4 b.47.1.1 | Back alignment and structure |
|---|
| >3k6y_A Serine protease, possible membrane-associated serine protease; oxidative stress, disulfide, BENT helix, HY protease; 1.30A {Mycobacterium tuberculosis} PDB: 3k6z_A 3lt3_A | Back alignment and structure |
|---|
| >2w5e_A Putative serine protease; coiled coil, transmembrane, thiol protease, RNA replication, ribosomal frameshifting, catalytic triad, membrane; 2.00A {Human astrovirus 1} | Back alignment and structure |
|---|
| >4fln_A Protease DO-like 2, chloroplastic; protease, DEG, PDZ, hydrolase; 2.80A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2as9_A Serine protease; trypsin-like fold, hydrolase; 1.70A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >1agj_A Epidermolytic toxin A; hydrolase, serine protease; 1.70A {Staphylococcus aureus} SCOP: b.47.1.1 PDB: 1dua_A 1exf_A 1due_A | Back alignment and structure |
|---|
| >3sti_A Protease DEGQ; serine protease, PDZ domain, chaperone, hydrolase; 2.60A {Escherichia coli} | Back alignment and structure |
|---|
| >1ky9_A Protease DO, DEGP, HTRA; protein quality control, serine protease, trypsin, chaperone, PDZ, ATP-independent, temperature-regulated, periplasm; 2.80A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3ou0_A 4a8d_A 3otp_A 3mh7_A 3mh4_A 3mh5_A* 3mh6_A* 3cs0_A 2zle_A | Back alignment and structure |
|---|
| >4a8c_A Periplasmic PH-dependent serine endoprotease DEGQ; chaperone, hydrolase; 7.50A {Escherichia coli} PDB: 4a8a_A 4a8b_A 4a9g_A | Back alignment and structure |
|---|
| >3pv2_A DEGQ; trypsin fold, PDZ domain, chaperone protease, hydrolase; 2.15A {Legionella fallonii} PDB: 3pv3_A 3pv5_A 3pv4_A | Back alignment and structure |
|---|
| >3stj_A Protease DEGQ; serine protease, PDZ domain, protease, chaperone, DEGP, DEGQ hydrolase; 2.60A {Escherichia coli} | Back alignment and structure |
|---|
| >1l1j_A Heat shock protease HTRA; hydrolase, serine proteinase; 2.80A {Thermotoga maritima} SCOP: b.47.1.1 | Back alignment and structure |
|---|
| >2h5c_A Alpha-lytic protease; serine protease, acylation transition STAT catalysis, protein folding, protein stability, packing DIST hydrolase; HET: SO4; 0.82A {Lysobacter enzymogenes} SCOP: b.47.1.1 PDB: 1p02_A 1p03_A 1p04_A 1p05_A 1p06_A* 1p01_A 1p11_E 1p12_E 1qrx_A* 1tal_A 2alp_A 1ssx_A* 2h5d_A* 2ull_A 3qgj_A* 9lpr_A 1boq_A 1gbj_A 1gbk_A 1gbl_A ... | Back alignment and structure |
|---|
| >2w7s_A Serine protease SPLA; hydrolase, family S1; 1.80A {Staphylococcus aureus} PDB: 2w7u_A | Back alignment and structure |
|---|
| >2o8l_A V8 protease, taphylococcal serine; serine protease, enzyme, hydrolase; 1.50A {Staphylococcus aureus} SCOP: b.47.1.1 PDB: 1qy6_A | Back alignment and structure |
|---|
| >1wcz_A Glutamyl endopeptidase; virulence factor, hydrolase; 2.00A {Staphylococcus aureus} SCOP: b.47.1.1 | Back alignment and structure |
|---|
| >2vid_A Serine protease SPLB; hydrolase; 1.80A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >3lgi_A Protease DEGS; stress-sensor, HTRA, PDZ OMP, hydrolase, serine PR; 1.65A {Escherichia coli} PDB: 2qf3_A 2qf0_A 2rce_A* 3lh3_A* 3b8j_A 2qgr_A 3lh1_A 3lgy_A 3lgu_A 3lgv_A 3lgw_A 3lgt_A 2r3u_A | Back alignment and structure |
|---|
| >3qo6_A Protease DO-like 1, chloroplastic; protease, HTRA, PH-sensor, hydrolase, photosynthesis; 2.50A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1qtf_A Exfoliative toxin B; serine protease, superantigen, hydrolase; 2.40A {Staphylococcus aureus} SCOP: b.47.1.1 PDB: 1dt2_A | Back alignment and structure |
|---|
| >1te0_A Protease DEGS; two domains, serine protease, PDZ, alpha-beta protein, hydro; 2.20A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3gdv_A* 3gcn_A* 3gds_A* 3gdu_A* 3gco_A* 1sot_A 1soz_A 1vcw_A 2r3y_A | Back alignment and structure |
|---|
| >1hpg_A Glutamic acid specific protease; serine protease, hydrolase-hydrolase inhibitor complex; 1.50A {Streptomyces griseus} SCOP: b.47.1.1 | Back alignment and structure |
|---|
| >3tjo_A Serine protease HTRA1; peptidase, hydrolase; HET: BOG; 2.30A {Homo sapiens} PDB: 3tjn_A 3nwu_A | Back alignment and structure |
|---|
| >1y8t_A Hypothetical protein RV0983; serine protease, structural genomics, PSI, protein structure initiative; 2.00A {Mycobacterium tuberculosis} SCOP: b.36.1.4 b.47.1.1 PDB: 2z9i_A | Back alignment and structure |
|---|
| >3num_A Serine protease HTRA1; DEGP, hydrolase; 2.75A {Homo sapiens} PDB: 3nzi_A 2ytw_A 2joa_A | Back alignment and structure |
|---|
| >1lcy_A HTRA2 serine protease; apoptosis, PDZ domain, caspase activation, binding, hydrolase; 2.00A {Homo sapiens} SCOP: b.36.1.4 b.47.1.1 | Back alignment and structure |
|---|
| >2oua_A Serine protease, protein NAPA; kinetic stability, acid stability, electros hydrolase; HET: 2AB; 1.85A {Nocardiopsis alba} | Back alignment and structure |
|---|
| >2qa9_E Streptogrisin-B; chymotrypsin-type serine peptidase, second tetrahedral inter tetrapeptide, beta barrels, alpha helix, hydrolase; HET: GOL; 1.18A {Streptomyces griseus} SCOP: b.47.1.1 PDB: 1sge_E 1sgn_E 1sgy_E 1sgd_E 2nu0_E 2nu1_E 2gkv_E 2nu3_E 2nu4_E 2nu2_E* 2qaa_A* 2sgd_E 2sge_E 2sgf_E 2sgp_E 2sgq_E 3sgq_E 1sgp_E 1cso_E 1ct0_E ... | Back alignment and structure |
|---|
| >1mbm_A NSP4 proteinase, chymotrypsin-like serine protease; serine proteinase, chymotrypsin-like proteinase, collapsed O HOLE, transferase; 2.00A {Equine arteritis virus} SCOP: b.47.1.3 | Back alignment and structure |
|---|
| >2pfe_A Protease A, alkaline serine protease, TFPA; beta-barrels, thermophIle, kinetic stabilit thermostability, protein folding; HET: 2AB; 1.44A {Thermobifida fusca} | Back alignment and structure |
|---|
| >2ea3_A Chymotrypsin; celloulomonas, protease, hydrolase; 1.78A {Cellulomonas bogoriensis} | Back alignment and structure |
|---|
| >2sga_A Proteinase A; hydrolase (serine proteinase); 1.50A {Streptomyces griseus} SCOP: b.47.1.1 PDB: 1sgc_A 3sga_E* 4sga_E 5sga_E 2sfa_A | Back alignment and structure |
|---|
| >2h5c_A Alpha-lytic protease; serine protease, acylation transition STAT catalysis, protein folding, protein stability, packing DIST hydrolase; HET: SO4; 0.82A {Lysobacter enzymogenes} SCOP: b.47.1.1 PDB: 1p02_A 1p03_A 1p04_A 1p05_A 1p06_A* 1p01_A 1p11_E 1p12_E 1qrx_A* 1tal_A 2alp_A 1ssx_A* 2h5d_A* 2ull_A 3qgj_A* 9lpr_A 1boq_A 1gbj_A 1gbk_A 1gbl_A ... | Back alignment and structure |
|---|
| >3k6y_A Serine protease, possible membrane-associated serine protease; oxidative stress, disulfide, BENT helix, HY protease; 1.30A {Mycobacterium tuberculosis} PDB: 3k6z_A 3lt3_A | Back alignment and structure |
|---|
| >3s9c_A Vipera russelli proteinase RVV-V gamma; serine proteinase, double six-stranded beta-barrels, hydrola glycosylation; HET: NAG BMA BGC GLC; 1.80A {Daboia russellii siamensis} PDB: 3s9b_A* 3s9a_A* 3sbk_A* | Back alignment and structure |
|---|
| >3fan_A Non-structural protein; chymotrypsin-like, N-terminal beta-barrels, C-terminal alpha-beta extra domain; 1.90A {Porcine respiratory and reproductivesyndrome virus} PDB: 3fao_A | Back alignment and structure |
|---|
| >3s69_A Thrombin-like enzyme defibrase; beta-barrel, serine enzymes, fibrinogen binding, glycosylati hydrolase; 1.43A {Gloydius saxatilis} PDB: 1op2_A* 1op0_A* 4gso_A 1bqy_A* | Back alignment and structure |
|---|
| >1pq7_A Trypsin; ultra-high resolution, catalysis, hydrolase; HET: ARG; 0.80A {Fusarium oxysporum} SCOP: b.47.1.2 PDB: 1fy4_A 1fy5_A 1gdn_A 1gdq_A 1gdu_A 1ppz_A* 1pq5_A* 1fn8_A* 1pq8_A* 1try_A 1xvm_A 1xvo_A* 2g51_A 2g52_A 2vu8_E 1pqa_A* | Back alignment and structure |
|---|
| >1a7s_A Heparin binding protein; serine protease homolog, endotoxin binding; HET: NAG; 1.12A {Homo sapiens} SCOP: b.47.1.2 PDB: 1ae5_A* 1fy3_A* 1fy1_A* | Back alignment and structure |
|---|
| >1lo6_A Kallikrein 6, HK6; serine protease, human kallikrein 6, benzamidine, protease, brain serine protease, myelencephalon specific protease, MSP, ZYME; 1.56A {Homo sapiens} SCOP: b.47.1.2 PDB: 1l2e_A 1gvl_A 4d8n_A* | Back alignment and structure |
|---|
| >1ao5_A Glandular kallikrein-13; serine protease, protein maturation; HET: NAG; 2.60A {Mus musculus} SCOP: b.47.1.2 PDB: 1sgf_G* | Back alignment and structure |
|---|
| >2zch_P Prostate-specific antigen; human PSA, kallikrein related peptidases, antibodies, prostate cancer, glycoprotein, hydrolase, polymorphism; HET: NDG; 2.83A {Homo sapiens} PDB: 2zck_P* 2zcl_P* 3qum_P* | Back alignment and structure |
|---|
| >1npm_A Neuropsin; serine proteinase, glycoprotein; HET: NAG; 2.10A {Mus musculus} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >1orf_A Granzyme A; hydrolase-hydrolase inhibitor complex; HET: 0G6; 2.40A {Homo sapiens} SCOP: b.47.1.2 PDB: 1op8_A | Back alignment and structure |
|---|
| >1gvz_A Kallikrein-1E2; antigen, prostate specific antigen, hydrolase; 1.42A {Equus caballus} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >4e7n_A Snake-venom thrombin-like enzyme; beta-barrel, hydrolase, arginine esterase, glycosylation, extracellular; HET: NAG; 1.75A {Agkistrodon halys} | Back alignment and structure |
|---|
| >2w5e_A Putative serine protease; coiled coil, transmembrane, thiol protease, RNA replication, ribosomal frameshifting, catalytic triad, membrane; 2.00A {Human astrovirus 1} | Back alignment and structure |
|---|
| >2bdg_A Kallikrein-4; serine proteinase, S1 subsite, 70-80 loop, structural proteo europe, spine, structural genomics, hydrolase; HET: PBZ; 1.95A {Homo sapiens} PDB: 2bdh_A* 2bdi_A* | Back alignment and structure |
|---|
| >1hj8_A Trypsin I; hydrolase, radiation damage, disulphide bond breakage, salmon, atomic resolution; HET: BAM; 1.00A {Salmo salar} SCOP: b.47.1.2 PDB: 1utm_A 1utj_A 1utl_M* 1utk_A 1bit_A 2sta_E 1bzx_E 2stb_E 2zpq_A 2zps_A 2tbs_A 2zpr_A 1mbq_A 2eek_A | Back alignment and structure |
|---|
| >2xw9_A Complement factor D; immune system, hydrolase, serine protease, alternative pathw; HET: GOL; 1.20A {Homo sapiens} PDB: 2xwb_I* 1bio_A 1dfp_A* 1dic_A* 1dsu_A 1hfd_A 4d9r_A 1fdp_A 2xwa_A 1dst_A 4d9q_A | Back alignment and structure |
|---|
| >2z7f_E Leukocyte elastase; serine protease, serine protease inhibitor, disease mutation glycoprotein, hydrolase, zymogen, secreted; HET: NAG FUC; 1.70A {Homo sapiens} SCOP: b.47.1.2 PDB: 1h1b_A* 1ppg_E* 1ppf_E* 3q76_A* 3q77_A* 1hne_E 2rg3_A* 1b0f_A* | Back alignment and structure |
|---|
| >2as9_A Serine protease; trypsin-like fold, hydrolase; 1.70A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >1mza_A Pro-granzyme K; apoptosis, serine protease, S1 family, hydrolase; 2.23A {Homo sapiens} SCOP: b.47.1.2 PDB: 1mzd_A | Back alignment and structure |
|---|
| >3h7t_A Group 3 allergen smipp-S YVT004A06; hydrolase; 2.00A {Sarcoptes scabiei type hominis} | Back alignment and structure |
|---|
| >2psx_A Kallikrein-5; zinc inhibition, stratum corneum, glcosylation, hydrolase, H hydrolase inhibitor complex; HET: AR7 NAG; 2.30A {Homo sapiens} PDB: 2psy_A* | Back alignment and structure |
|---|
| >1ton_A Tonin; hydrolase(serine proteinase); 1.80A {Rattus rattus} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >3mfj_A Cationic trypsin; serine proteinase, hydrolase; 0.80A {Bos taurus} PDB: 1aq7_A* 1auj_A* 1bju_A* 1bjv_A* 1az8_A* 1c1o_A 1c1n_A* 1c1q_A* 1c1r_A* 1c1s_A* 1c1t_A* 1c2d_A* 1c2e_A* 1c2f_A* 1c2g_A* 1c2h_A* 1c2i_A* 1c2j_A* 1c2k_A* 1c2l_A ... | Back alignment and structure |
|---|
| >1spj_A Kallikrein 1; serine protease, KLK1, HK1, hydrolase; HET: NAG; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >4i8h_A Cationic trypsin, beta-trypsin; serine protease, hydrolase; HET: BEN; 0.75A {Bos taurus} PDB: 1aq7_A* 1auj_A* 1bju_A* 1bjv_A* 1az8_A* 1c1o_A 1c1n_A* 1c1q_A* 1c1r_A* 1c1s_A* 1c1t_A* 1c2d_A* 1c2e_A* 1c2f_A* 1c2g_A* 1c2h_A* 1c2i_A* 1c2j_A* 1c2k_A* 1c2l_A ... | Back alignment and structure |
|---|
| >1fuj_A PR3, myeloblastin; hydrolase, serine protease, glycoprotein, zymogen, hydrolase protease); HET: NAG FUC; 2.20A {Homo sapiens} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >1hpg_A Glutamic acid specific protease; serine protease, hydrolase-hydrolase inhibitor complex; 1.50A {Streptomyces griseus} SCOP: b.47.1.1 | Back alignment and structure |
|---|
| >1azz_A Collagenase; complex (serine protease/inhibitor), serine protease, inhibitor, complex, protease-substrate interactions, collagen; 2.30A {Celuca pugilator} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >1sgf_A 7S NGF, nerve growth factor; growth factor (beta-NGF), hydrolase - serine proteinase (GAM inactive serine proteinase (alpha-NGF); HET: NAG NDG; 3.15A {Mus musculus} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >2qxi_A Kallikrein-7; S1 pocket, chloromethyl ketone, alternate conformations, alternative splicing, glycoprotein, hydrolase, protease, secreted; HET: K7J; 1.00A {Homo sapiens} PDB: 2qxg_A* 2qxh_A* 2qxj_A* 3bsq_A | Back alignment and structure |
|---|
| >1p3c_A Glutamyl-endopeptidase; serine protease, hydrolase; 1.50A {Bacillus intermedius} SCOP: b.47.1.1 PDB: 1p3e_A | Back alignment and structure |
|---|
| >1fxy_A Coagulation factor XA-trypsin chimera; protease, chloromethylketone, hydrolase-hydrolase I complex; HET: 0G6; 2.15A {Homo sapiens} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >2aiq_A Protein C activator; snake venom serine proteinase, hydrolas; HET: NAG NDG; 1.54A {Agkistrodon contortrix contortrix} PDB: 2aip_A* | Back alignment and structure |
|---|
| >1iau_A Granzyme B; hydrolase-hydrolase inhibitor complex; HET: ASJ NAG FUC MAN BMA; 2.00A {Homo sapiens} SCOP: b.47.1.2 PDB: 1fq3_A* 1fi8_A 3tk9_A 3tju_A 3tjv_A | Back alignment and structure |
|---|
| >4dgj_A Enteropeptidase catalytic light chain; serine protease, hydrolase; 1.90A {Homo sapiens} PDB: 1ekb_B | Back alignment and structure |
|---|
| >2zgc_A Granzyme M; serine protease, cytolysis, glycoprotein, hydrolase, secrete zymogen; 1.96A {Homo sapiens} PDB: 2zgh_A 2zks_A 2zgj_A | Back alignment and structure |
|---|
| >4ag1_A Chymase; hydrolase-de novo protein complex, inhibitor, serine proteas; 1.40A {Homo sapiens} PDB: 4afs_A 4afu_A 4afz_A* 4afq_A 4ag2_A* 1nn6_A* 1klt_A* 3n7o_A* 1t31_A* 1pjp_A* 2hvx_A* 3s0n_A* 2rdl_A | Back alignment and structure |
|---|
| >3gyl_B Prostasin; ENAC, zymogen, divalent cation, channel activatin membrane, disulfide bond, glycoprotein, hydrolase, membrane protease, secreted; 1.30A {Homo sapiens} PDB: 3gym_A 3e16_B* 3e0p_B* 3e0n_B* 3e1x_B 3fvf_B* 3dfj_A 3dfl_A* | Back alignment and structure |
|---|
| >1si5_H Scatter factor, hepatocyte growth factor, SF, hepatopoeitin A, LUNG; chymotrypsin homology, hormone/growth factor complex; 2.53A {Homo sapiens} SCOP: b.47.1.2 PDB: 1shy_A | Back alignment and structure |
|---|
| >2oq5_A Transmembrane protease, serine 11E; type II trans-membrane serine proteinases, trypsin-like serine protease, tumor marker, hydrolase; 1.61A {Homo sapiens} | Back alignment and structure |
|---|
| >1gvk_B Elastase 1, peptide inhibitor; hydrolase, serine protease, catalytic intermediate, atomic resolution, hydrolase-hydrolase inhibitor complex; 0.94A {Sus scrofa} SCOP: b.47.1.2 PDB: 1bma_A* 1b0e_A* 1e34_B* 1e35_B* 1e36_B* 1e37_B* 1e38_B* 1eas_A* 1eat_A* 1eau_A* 1ela_A* 1elb_A* 1elc_A* 1eld_E* 1ele_E* 1elf_A* 1elg_A* 1esa_A 1esb_A* 1est_A* ... | Back alignment and structure |
|---|
| >2f91_A Hepatopancreas trypsin; trypsin, canonical inhibitor, atomic resolution, hydrolase/hydrolase inhibitor complex; 1.20A {Pontastacus leptodactylus} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >2hlc_A Collagenase; serine protease, hydrolase, collagen degradation; 1.70A {Hypoderma lineatum} SCOP: b.47.1.2 PDB: 1hyl_A | Back alignment and structure |
|---|
| >1eq9_A Chymotrypsin; FIRE ANT, serine proteinase, hydrolase; HET: PMS; 1.70A {Solenopsis invicta} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >2any_A Kininogenin, plasma kallikrein, light chain, fletcher factor; mutagenically deglycosyalted human plasma kallikrein protease domain; HET: BAM; 1.40A {Homo sapiens} PDB: 2anw_A* | Back alignment and structure |
|---|
| >3rp2_A RAT MAST cell protease II; serine proteinase; 1.90A {Rattus rattus} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >2asu_B Hepatocyte growth factor-like protein; serine proteinase, beta-chain, MSP, HGFL, hydrolase; 1.85A {Homo sapiens} | Back alignment and structure |
|---|
| >1euf_A Duodenase; serine protease, dual specificity, hydrola; HET: NAG; 2.40A {Bos taurus} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >3fzz_A Granzyme C; hydrolase, cytolysis, protease, serine protease, zymogen; 2.50A {Mus musculus} SCOP: b.47.1.2 PDB: 3g01_A | Back alignment and structure |
|---|
| >1elt_A Elastase; serine proteinase; 1.61A {Salmo salar} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >1cgh_A Cathepsin G; inflammation, specificity, serine protease, hydrolase-hydrol inhibitor complex; HET: 1ZG; 1.80A {Homo sapiens} SCOP: b.47.1.2 PDB: 1au8_A* 1t32_A* 1kyn_A* | Back alignment and structure |
|---|
| >3gov_B MAsp-1; complement, serine protease, beta barrel, hydrolase, hydroxy immune response, innate immunity, sushi, coagulation, compl pathway; 2.55A {Homo sapiens} SCOP: b.47.1.0 PDB: 4djz_B | Back alignment and structure |
|---|
| >2oua_A Serine protease, protein NAPA; kinetic stability, acid stability, electros hydrolase; HET: 2AB; 1.85A {Nocardiopsis alba} | Back alignment and structure |
|---|
| >1bru_P Elastase, PPE; serine protease, hydrolase; HET: 1NB; 2.30A {Sus scrofa} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >3h7o_A Group 3 allergen smipp-S YV6023A04; hydrolase; 1.85A {Sarcoptes scabiei type hominis} SCOP: b.47.1.0 | Back alignment and structure |
|---|
| >1zyo_A Serine protease; beta-barrel, glutamyl endopeptidase, hydrolase; 2.40A {Sesbania mosaic virus} | Back alignment and structure |
|---|
| >3ncl_A Suppressor of tumorigenicity 14 protein; proteinase-inhibitor complex, serine proteinase, benzamidine phosphonate, serine endopeptidases; HET: CCZ; 1.19A {Homo sapiens} SCOP: b.47.1.2 PDB: 3bn9_B* 3nps_A 3so3_A* 1eax_A 1eaw_A 2gv6_A* 2gv7_A* 3p8g_A* 3p8f_A* | Back alignment and structure |
|---|
| >3cp7_A Alkaline serine protease Al20; trypsin-like, hydrolase; 1.39A {Nesterenkonia abyssinica} | Back alignment and structure |
|---|
| >1t8o_A Chymotrypsin A; chymotrypsin, serine proteinase, BPTI, protein-protein interaction, non-cognate binding, S1 pocket, primary specificity; 1.70A {Bos taurus} SCOP: b.47.1.2 PDB: 1cgi_E 1cgj_E 1chg_A 1ex3_A 1acb_E 1gl0_E 1gl1_A 1gcd_A* 1oxg_A 1k2i_1 1p2n_A 1p2o_A 1p2q_A 1t7c_A 1t8l_A 1t8m_A 1t8n_A 1p2m_A 2cga_A 2y6t_A ... | Back alignment and structure |
|---|
| >3bg8_A Coagulation factor XIA light chain; protease inhibitor, factor XIA inhibitor complex, covalent inhibitor, alternative splicing, blood coagulation; HET: INH; 1.60A {Homo sapiens} PDB: 3sor_A* 3sos_A* 1zsl_A* 1zpz_A* 1zrk_A* 1xx9_A* 1zjd_A 1zhr_A 1zmj_A* 1zml_A* 1zmn_A* 1zom_A* 1zpb_A* 1zpc_A* 1zsj_A* 1zsk_A* 1ztj_A* 1ztk_A* 1ztl_A* 2fda_A* ... | Back alignment and structure |
|---|
| >1arb_A Achromobacter protease I; hydrolase(serine protease); 1.20A {Achromobacter lyticus} SCOP: b.47.1.1 PDB: 1arc_A* | Back alignment and structure |
|---|
| >2r0l_A Hepatocyte growth factor activator; serine protease, antibody, allosteric inhibitor, EGF-like DO glycoprotein, hydrolase, kringle, secreted; HET: NAG BMA; 2.20A {Homo sapiens} PDB: 3k2u_A* 2wub_A* 2wuc_A* | Back alignment and structure |
|---|
| >1m9u_A Earthworm fibrinolytic enzyme; hydrolase, serine protease (elastase-like); 2.30A {Eisenia fetida} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >3beu_A Trypsin, SGT; beta sheets, serine protease, hydrolase, zymogen; HET: BEN; 1.05A {Streptomyces griseus} PDB: 3i78_A 3i77_A 2fmj_A 1os8_A 1oss_A 1sgt_A | Back alignment and structure |
|---|
| >1ym0_A Fibrinotic enzyme component B; two chains, glycosylation, pyroglutamation, eight-membered R peptide bond, hydrolase; HET: NAG MAN FUC; 2.06A {Eisenia fetida} | Back alignment and structure |
|---|
| >1pyt_D TC, PCPA-TC, chymotrypsinogen C; ternary complex (zymogen), serine proteinase, C-terminal peptidase; 2.35A {Bos taurus} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >3mhw_U Urokinase-type plasminogen activator; hydrolase, blood coagulation, fibrinolysis, plasminogen activation; HET: ABV; 1.45A {Homo sapiens} SCOP: b.47.1.2 PDB: 1w10_U* 1w11_U* 1w12_U* 1w13_U* 1w14_U* 1w0z_U* 2vip_A* 1f5k_U 1f5l_A* 1f92_A* 2r2w_U* 2vin_A* 2vio_A* 1ejn_A* 2viq_A* 2viv_A* 2viw_A* 1vja_U* 1vj9_U* 1sc8_U* ... | Back alignment and structure |
|---|
| >2ea3_A Chymotrypsin; celloulomonas, protease, hydrolase; 1.78A {Cellulomonas bogoriensis} | Back alignment and structure |
|---|
| >1aut_C Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: b.47.1.2 PDB: 3f6u_H* | Back alignment and structure |
|---|
| >1ddj_A Plasminogen; catalytic domain, blood clotting; 2.00A {Homo sapiens} SCOP: b.47.1.2 PDB: 1bml_A 1l4d_A 1l4z_A 1bui_A* 1rjx_B 1qrz_A | Back alignment and structure |
|---|
| >2bz6_H Blood coagulation factor VIIA; serine protease, enzyme complex, hydrolase; HET: 346; 1.6A {Homo sapiens} SCOP: b.47.1.2 PDB: 1cvw_H* 1dva_H* 1fak_H* 1j9c_H* 1jbu_H 1dan_H 1klj_H 1o5d_H* 1qfk_H* 1w0y_H* 1w2k_H* 1w7x_H* 1w8b_H* 1wqv_H* 1wss_H* 1wtg_H* 1wun_H* 1wv7_H* 1ygc_H* 1z6j_H* ... | Back alignment and structure |
|---|
| >3tvj_B Mannan-binding lectin serine protease 2 B chain; in vitro evolution, specific inhibitor, allostery, hydrolase; 1.28A {Homo sapiens} PDB: 4fxg_H* | Back alignment and structure |
|---|
| >2jkh_A Activated factor XA heavy chain; plasma, calcium, zymogen, secreted, protease, hydrolase, polymorphism, glycoprotein, gamma-carboxyglutamic acid; HET: BI7; 1.25A {Homo sapiens} PDB: 2bok_A* 2vvc_A* 2vvu_A* 2vvv_A* 2vwl_A* 2vwm_A* 2vwn_A* 2vwo_A* 2xbv_A* 1c5m_D 2vh0_A* 1ezq_A* 1f0s_A* 1ksn_A* 1f0r_A* 1lpk_B* 1lpz_B* 1lqd_B* 1nfu_A* 1nfw_A* ... | Back alignment and structure |
|---|
| >2pfe_A Protease A, alkaline serine protease, TFPA; beta-barrels, thermophIle, kinetic stabilit thermostability, protein folding; HET: 2AB; 1.44A {Thermobifida fusca} | Back alignment and structure |
|---|
| >1fon_A Procarboxypeptidase A-S6; truncated zymogen E, serine protease; 1.70A {Bos taurus} SCOP: b.47.1.2 PDB: 1pyt_C | Back alignment and structure |
|---|
| >1yc0_A Hepatocyte growth factor activator; hydrolase/inhibitor, hydrolase-inhibitor complex; 2.60A {Homo sapiens} PDB: 1ybw_A 2r0k_A | Back alignment and structure |
|---|
| >1rtf_B (TC)-T-PA, two chain tissue plasminogen activator; serine protease, fibrinolytic enzymes; HET: BEN; 2.30A {Homo sapiens} SCOP: b.47.1.2 PDB: 1a5h_A* 1bda_A* 1a5i_A* | Back alignment and structure |
|---|
| >2olg_A Pro-phenoloxidase activating enzyme-I; prophenoloxidase activating factor-I, PPAF-I, serine proteas hydrolase; HET: NAG; 1.70A {Holotrichia diomphalia} | Back alignment and structure |
|---|
| >2wph_S Coagulation factor IXA heavy chain; serine protease, zymogen, hydrolase, glycoprotein, hydroxylation, phosphoprotein, sulfation, hemostasis; HET: DPN 1PE; 1.50A {Homo sapiens} PDB: 2wpj_S* 2wpk_S* 2wpl_S* 2wpi_S* 2wpm_S 3lc3_A* 1rfn_A* 3lc5_A* 3kcg_H* 1x7a_C* 1pfx_C* | Back alignment and structure |
|---|
| >1z8g_A Serine protease hepsin; serine protease hepsin, protease, hydrolase-hydrolase inhibi complex; HET: AR7; 1.55A {Homo sapiens} SCOP: b.47.1.2 d.170.1.2 PDB: 3t2n_A 1o5e_H* 1o5f_H* 1p57_B* 1o5e_L* 1o5f_L* 1p57_A* | Back alignment and structure |
|---|
| >2w7s_A Serine protease SPLA; hydrolase, family S1; 1.80A {Staphylococcus aureus} PDB: 2w7u_A | Back alignment and structure |
|---|
| >2f9n_A Alpha I tryptase; serine proteinase, trypsin-like, difucosylation, hydrolase-hydrolase inhibitor complex; HET: AR7 NAG FUC; 1.60A {Homo sapiens} PDB: 2f9o_A* 2f9p_A* 1lto_A 2fpz_A* 2bm2_A* 2fs8_A* 2fs9_A* 2fww_A* 2fxr_A* 2gdd_A* 2za5_A* 3v7t_A* 4a6l_A* 1a0l_A* 2zec_A* 2zeb_A* | Back alignment and structure |
|---|
| >2qy0_B Complement C1R subcomponent; serine protease, beta barrel, complement pathway like domain, glycoprotein, hydrolase, hydroxylation, immune response; 2.60A {Homo sapiens} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >3rm2_H Thrombin heavy chain; serine protease, kringle, hydrolase, blood coagulation, BLOO clotting, convertion of fibrinogen to fibrin; HET: TYS NAG S00; 1.23A {Homo sapiens} PDB: 1a2c_H* 1a3e_H* 1a46_H* 1a4w_H* 1a5g_H* 1a61_H* 1abi_H* 1abj_H* 1ad8_H* 1ae8_H* 1afe_H* 1a3b_H* 1ai8_H* 1aix_H* 1awf_H* 1awh_B* 1ay6_H* 1b5g_H* 1ba8_B* 1bb0_B* ... | Back alignment and structure |
|---|
| >1fiw_A Beta-acrosin heavy chain; anti-parallel beta-barrel, hydrolase; HET: NAG FUL BMA MAN PBZ; 2.10A {Ovis aries} SCOP: b.47.1.2 PDB: 1fiz_A* | Back alignment and structure |
|---|
| >4f4o_C Haptoglobin; globin fold, serine protease fold, complement control protei haemoglobin scavenging, oxygen storage-transport complex; HET: HEM NAG FUC; 2.90A {Sus scrofa} | Back alignment and structure |
|---|
| >3f1s_B Vitamin K-dependent protein Z; PZ, ZPI, complex, serpin, protease inhibitor, protease, GLYC secreted, serine protease inhibitor, blood coagulation; HET: FLC NAG; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2vnt_A Urokinase-type plasminogen activator; UPA, inhibitor complex, hydrolase; HET: QGG; 2.2A {Homo sapiens} | Back alignment and structure |
|---|
| >2bdy_A Thrombin; thrombin, complex structure, hydrolase, hydrolase-hydrolase complex; HET: TYS UNB; 1.61A {Homo sapiens} SCOP: b.47.1.2 PDB: 3k65_B 1doj_A* 1hag_E* 1xm1_A* 1nu9_A* 3sqe_E 3sqh_E 1jwt_A* 1d9i_A* 1d6w_A* 1g37_A* 1nm6_A* 1nt1_A* 1sl3_A* 1ta2_A* 1ta6_A* 1z71_A* 1zgi_A* 1zgv_A* 1zrb_A* ... | Back alignment and structure |
|---|
| >3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} | Back alignment and structure |
|---|
| >1agj_A Epidermolytic toxin A; hydrolase, serine protease; 1.70A {Staphylococcus aureus} SCOP: b.47.1.1 PDB: 1dua_A 1exf_A 1due_A | Back alignment and structure |
|---|
| >2xxl_A GRAM-positive specific serine protease, isoform B; hydrolase, innate immunity; HET: NAG FUC BMA; 1.80A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1zjk_A Mannan-binding lectin serine protease 2; beta barrel, modular protein, hydrolase; 2.18A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 g.18.1.1 PDB: 1q3x_A | Back alignment and structure |
|---|
| >2sga_A Proteinase A; hydrolase (serine proteinase); 1.50A {Streptomyces griseus} SCOP: b.47.1.1 PDB: 1sgc_A 3sga_E* 4sga_E 5sga_E 2sfa_A | Back alignment and structure |
|---|
| >4dur_A Plasminogen, serine protease; fibrinolysis, hydrolase; HET: NAG GAL SIA; 2.45A {Homo sapiens} PDB: 4a5t_S* 4duu_A 2feb_A | Back alignment and structure |
|---|
| >2b9l_A Prophenoloxidase activating factor; CLIP domain, easter, innate immunity, melanin, immune system binding complex; HET: NAG FUC; 2.00A {Holotrichia diomphalia} | Back alignment and structure |
|---|
| >1elv_A Complement C1S component; trypsin-like serin protease, CCP (OR sushi or SCR)module, HY; HET: NAG FUC NES; 1.70A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 | Back alignment and structure |
|---|
| >2vid_A Serine protease SPLB; hydrolase; 1.80A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >1rrk_A Complement factor B; BB, hydrolase; 2.00A {Homo sapiens} SCOP: b.47.1.2 c.62.1.1 PDB: 1rs0_A* 1rtk_A* 2win_I* 1dle_A | Back alignment and structure |
|---|
| >1md8_A C1R complement serine protease; innate immunity, activation, substrate specificity, hydrolase; 2.80A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 PDB: 1md7_A* | Back alignment and structure |
|---|
| >2f83_A Coagulation factor XI; protease, apple domain, hydrolase; HET: NAG; 2.87A {Homo sapiens} PDB: 2j8j_A 2j8l_A | Back alignment and structure |
|---|
| >3mmg_A Nuclear inclusion protein A; 3C-type protease, TEV, TVMV, viral protein, hydrolase; 1.70A {Tobacco vein mottling virus} SCOP: b.47.1.0 | Back alignment and structure |
|---|
| >3hrz_D Complement factor B; serine protease, glycosilated, multi-domain, complement SYST convertase, complement alternate pathway; HET: NAG P6G; 2.20A {Homo sapiens} PDB: 2xwj_I* 3hs0_D* 2ok5_A* 2xwb_F* | Back alignment and structure |
|---|
| >2xrc_A Human complement factor I; immune system, hydrolase, conglutinogen activating factor, S protease, complement system; HET: NAG; 2.69A {Homo sapiens} | Back alignment and structure |
|---|
| >1gpz_A Complement C1R component; hydrolase, activation, innate immunity, modular structure, serine protease; HET: NAG FUC MAN; 2.9A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 g.18.1.1 | Back alignment and structure |
|---|
| >3nxp_A Prethrombin-1; allostery, blood coagulation, hydro kringle, serine protease, zymogen; HET: NAG; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >1yph_C Chymotrypsin A, chain B; serine protease, hydrolase; 1.34A {Bos taurus} PDB: 1afq_B* 1ca0_B 1cbw_B 1cho_F 1gct_B 1ab9_B* 1ggd_B* 1gha_F 1ghb_F* 1gmc_F 1gmd_F 1gmh_F 1hja_B 1mtn_B 1n8o_B 1vgc_B* 1gg6_B 2cha_B* 2gch_F 2gct_B ... | Back alignment and structure |
|---|
| >2o8l_A V8 protease, taphylococcal serine; serine protease, enzyme, hydrolase; 1.50A {Staphylococcus aureus} SCOP: b.47.1.1 PDB: 1qy6_A | Back alignment and structure |
|---|
| >2odp_A Complement C2; C3/C5 convertase, complement serin protease, human complement system, glycoprotein, SP, VWFA,; HET: NAG; 1.90A {Homo sapiens} PDB: 2odq_A* 2i6q_A* 2i6s_A* | Back alignment and structure |
|---|
| >1qtf_A Exfoliative toxin B; serine protease, superantigen, hydrolase; 2.40A {Staphylococcus aureus} SCOP: b.47.1.1 PDB: 1dt2_A | Back alignment and structure |
|---|
| >2qa9_E Streptogrisin-B; chymotrypsin-type serine peptidase, second tetrahedral inter tetrapeptide, beta barrels, alpha helix, hydrolase; HET: GOL; 1.18A {Streptomyces griseus} SCOP: b.47.1.1 PDB: 1sge_E 1sgn_E 1sgy_E 1sgd_E 2nu0_E 2nu1_E 2gkv_E 2nu3_E 2nu4_E 2nu2_E* 2qaa_A* 2sgd_E 2sge_E 2sgf_E 2sgp_E 2sgq_E 3sgq_E 1sgp_E 1cso_E 1ct0_E ... | Back alignment and structure |
|---|
| >1wcz_A Glutamyl endopeptidase; virulence factor, hydrolase; 2.00A {Staphylococcus aureus} SCOP: b.47.1.1 | Back alignment and structure |
|---|
| >1lvm_A Catalytic domain of the nuclear inclusion protein A (NIA); beta barrel, chymotrypsin-type cystein protease, enzyme- peptide complex; 1.80A {Tobacco etch virus} SCOP: b.47.1.3 PDB: 1lvb_A 1q31_A | Back alignment and structure |
|---|
| >2pka_B Kallikrein A; serine proteinase; 2.05A {Sus scrofa} SCOP: b.47.1.2 PDB: 2kai_B 1hia_B | Back alignment and structure |
|---|
| >3fan_A Non-structural protein; chymotrypsin-like, N-terminal beta-barrels, C-terminal alpha-beta extra domain; 1.90A {Porcine respiratory and reproductivesyndrome virus} PDB: 3fao_A | Back alignment and structure |
|---|
| >1mbm_A NSP4 proteinase, chymotrypsin-like serine protease; serine proteinase, chymotrypsin-like proteinase, collapsed O HOLE, transferase; 2.00A {Equine arteritis virus} SCOP: b.47.1.3 | Back alignment and structure |
|---|
| >3qzr_A 3C protein; chymotrypsin-fold, beta-ribbon, hydrolysis, nucleus, hydrola hydrolase inhibitor complex; HET: AG7; 1.04A {Human enterovirus 71} SCOP: b.47.1.0 PDB: 3osy_A 3qzq_A* 3r0f_A* 3sjo_A* 3sjk_A 3sji_A* 3sj8_A* 3sj9_A | Back alignment and structure |
|---|
| >3q3y_A HEVB EV93 3C protease; cysteine trypsin-like protease, 3C cysteine protease (picorn antiviral compound 1 (AG7404); HET: XNV; 1.32A {Human enterovirus B} SCOP: b.47.1.4 PDB: 3q3x_A* 3ruo_A* 3zyd_A 3zz5_A* 3zz6_A* 3zz7_A* 3zz8_A* 3zz9_A* 3zza_A* 3zzb_A* 2ztx_A 2vb0_A 2zty_A 2ztz_A 2zu3_A* 3zye_A 3zz3_A 2zu1_A 3zz4_A 3zzc_A* ... | Back alignment and structure |
|---|
| >3zve_A 3C protease; hydrolase, michael inhibitor; HET: G84; 1.80A {Human enterovirus} PDB: 3zv8_A* 3zva_A* 3zvb_A* 3zv9_A* 3zvd_A* 3zvc_A* 3zvf_A* 3zvg_A* | Back alignment and structure |
|---|
| >2b0f_A Picornain 3C (protease 3C) (P3C); beta barrel, hydrolase-hydrolase inhibitor complex; HET: CA1; NMR {Human rhinovirus 14} PDB: 2in2_A | Back alignment and structure |
|---|
| >2pka_A Kallikrein A; serine proteinase; 2.05A {Sus scrofa} SCOP: b.47.1.2 PDB: 2kai_A 1hia_A | Back alignment and structure |
|---|
| >4dcd_A Protease 3C, genome polyprotein; antiviral inhibitors, dipeptidyl inhib hydrolase-hydrolase inhibitor complex; HET: K36; 1.69A {Human poliovirus 1} PDB: 1l1n_A | Back alignment and structure |
|---|
| >1cqq_A Type 2 rhinovirus 3C protease; viral protein, hydrolase; HET: AG7; 1.85A {Human rhinovirus 2} SCOP: b.47.1.4 PDB: 2xya_A* | Back alignment and structure |
|---|
| >3mmg_A Nuclear inclusion protein A; 3C-type protease, TEV, TVMV, viral protein, hydrolase; 1.70A {Tobacco vein mottling virus} SCOP: b.47.1.0 | Back alignment and structure |
|---|
| >2hal_A Hepatitis A protease 3C; 3C protease, inhibitor design; HET: BBL; 1.35A {Hepatitis a virus} SCOP: b.47.1.4 PDB: 2h6m_A* 2h9h_A* 2cxv_A* 2a4o_A* 1hav_A 1qa7_A* | Back alignment and structure |
|---|
| >1p3c_A Glutamyl-endopeptidase; serine protease, hydrolase; 1.50A {Bacillus intermedius} SCOP: b.47.1.1 PDB: 1p3e_A | Back alignment and structure |
|---|
| >2ijd_1 Picornain 3C, RNA-directed RNA polymerase; RNA-dependent RNA polymerase, picornavirus, protease, hydrolase, transferase; 3.40A {Human poliovirus 1} SCOP: b.47.1.4 e.8.1.4 | Back alignment and structure |
|---|
| >1zyo_A Serine protease; beta-barrel, glutamyl endopeptidase, hydrolase; 2.40A {Sesbania mosaic virus} | Back alignment and structure |
|---|
| >2pka_B Kallikrein A; serine proteinase; 2.05A {Sus scrofa} SCOP: b.47.1.2 PDB: 2kai_B 1hia_B | Back alignment and structure |
|---|
| >2bhg_A Foot-and-mouth disease virus 3C protease; chymotrypsin-like cysteine protease, capsid protein, core protein; 1.9A {Foot-and-mouth disease virus} SCOP: b.47.1.4 PDB: 2j92_A 2wv4_A 2wv5_A | Back alignment and structure |
|---|
| >1pq7_A Trypsin; ultra-high resolution, catalysis, hydrolase; HET: ARG; 0.80A {Fusarium oxysporum} SCOP: b.47.1.2 PDB: 1fy4_A 1fy5_A 1gdn_A 1gdq_A 1gdu_A 1ppz_A* 1pq5_A* 1fn8_A* 1pq8_A* 1try_A 1xvm_A 1xvo_A* 2g51_A 2g52_A 2vu8_E 1pqa_A* | Back alignment and structure |
|---|
| >1ao5_A Glandular kallikrein-13; serine protease, protein maturation; HET: NAG; 2.60A {Mus musculus} SCOP: b.47.1.2 PDB: 1sgf_G* | Back alignment and structure |
|---|
| >3s9c_A Vipera russelli proteinase RVV-V gamma; serine proteinase, double six-stranded beta-barrels, hydrola glycosylation; HET: NAG BMA BGC GLC; 1.80A {Daboia russellii siamensis} PDB: 3s9b_A* 3s9a_A* 3sbk_A* | Back alignment and structure |
|---|
| >1ton_A Tonin; hydrolase(serine proteinase); 1.80A {Rattus rattus} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >1fuj_A PR3, myeloblastin; hydrolase, serine protease, glycoprotein, zymogen, hydrolase protease); HET: NAG FUC; 2.20A {Homo sapiens} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >1mza_A Pro-granzyme K; apoptosis, serine protease, S1 family, hydrolase; 2.23A {Homo sapiens} SCOP: b.47.1.2 PDB: 1mzd_A | Back alignment and structure |
|---|
| >1sgf_A 7S NGF, nerve growth factor; growth factor (beta-NGF), hydrolase - serine proteinase (GAM inactive serine proteinase (alpha-NGF); HET: NAG NDG; 3.15A {Mus musculus} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >3h7t_A Group 3 allergen smipp-S YVT004A06; hydrolase; 2.00A {Sarcoptes scabiei type hominis} | Back alignment and structure |
|---|
| >1lvm_A Catalytic domain of the nuclear inclusion protein A (NIA); beta barrel, chymotrypsin-type cystein protease, enzyme- peptide complex; 1.80A {Tobacco etch virus} SCOP: b.47.1.3 PDB: 1lvb_A 1q31_A | Back alignment and structure |
|---|
| >1npm_A Neuropsin; serine proteinase, glycoprotein; HET: NAG; 2.10A {Mus musculus} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >1spj_A Kallikrein 1; serine protease, KLK1, HK1, hydrolase; HET: NAG; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1lo6_A Kallikrein 6, HK6; serine protease, human kallikrein 6, benzamidine, protease, brain serine protease, myelencephalon specific protease, MSP, ZYME; 1.56A {Homo sapiens} SCOP: b.47.1.2 PDB: 1l2e_A 1gvl_A 4d8n_A* | Back alignment and structure |
|---|
| >1hj8_A Trypsin I; hydrolase, radiation damage, disulphide bond breakage, salmon, atomic resolution; HET: BAM; 1.00A {Salmo salar} SCOP: b.47.1.2 PDB: 1utm_A 1utj_A 1utl_M* 1utk_A 1bit_A 2sta_E 1bzx_E 2stb_E 2zpq_A 2zps_A 2tbs_A 2zpr_A 1mbq_A 2eek_A | Back alignment and structure |
|---|
| >2zch_P Prostate-specific antigen; human PSA, kallikrein related peptidases, antibodies, prostate cancer, glycoprotein, hydrolase, polymorphism; HET: NDG; 2.83A {Homo sapiens} PDB: 2zck_P* 2zcl_P* 3qum_P* | Back alignment and structure |
|---|
| >2z7f_E Leukocyte elastase; serine protease, serine protease inhibitor, disease mutation glycoprotein, hydrolase, zymogen, secreted; HET: NAG FUC; 1.70A {Homo sapiens} SCOP: b.47.1.2 PDB: 1h1b_A* 1ppg_E* 1ppf_E* 3q76_A* 3q77_A* 1hne_E 2rg3_A* 1b0f_A* | Back alignment and structure |
|---|
| >2bdg_A Kallikrein-4; serine proteinase, S1 subsite, 70-80 loop, structural proteo europe, spine, structural genomics, hydrolase; HET: PBZ; 1.95A {Homo sapiens} PDB: 2bdh_A* 2bdi_A* | Back alignment and structure |
|---|
| >1cgh_A Cathepsin G; inflammation, specificity, serine protease, hydrolase-hydrol inhibitor complex; HET: 1ZG; 1.80A {Homo sapiens} SCOP: b.47.1.2 PDB: 1au8_A* 1t32_A* 1kyn_A* | Back alignment and structure |
|---|
| >4i8h_A Cationic trypsin, beta-trypsin; serine protease, hydrolase; HET: BEN; 0.75A {Bos taurus} PDB: 1aq7_A* 1auj_A* 1bju_A* 1bjv_A* 1az8_A* 1c1o_A 1c1n_A* 1c1q_A* 1c1r_A* 1c1s_A* 1c1t_A* 1c2d_A* 1c2e_A* 1c2f_A* 1c2g_A* 1c2h_A* 1c2i_A* 1c2j_A* 1c2k_A* 1c2l_A ... | Back alignment and structure |
|---|
| >2zgc_A Granzyme M; serine protease, cytolysis, glycoprotein, hydrolase, secrete zymogen; 1.96A {Homo sapiens} PDB: 2zgh_A 2zks_A 2zgj_A | Back alignment and structure |
|---|
| >1si5_H Scatter factor, hepatocyte growth factor, SF, hepatopoeitin A, LUNG; chymotrypsin homology, hormone/growth factor complex; 2.53A {Homo sapiens} SCOP: b.47.1.2 PDB: 1shy_A | Back alignment and structure |
|---|
| >3mfj_A Cationic trypsin; serine proteinase, hydrolase; 0.80A {Bos taurus} PDB: 1aq7_A* 1auj_A* 1bju_A* 1bjv_A* 1az8_A* 1c1o_A 1c1n_A* 1c1q_A* 1c1r_A* 1c1s_A* 1c1t_A* 1c2d_A* 1c2e_A* 1c2f_A* 1c2g_A* 1c2h_A* 1c2i_A* 1c2j_A* 1c2k_A* 1c2l_A ... | Back alignment and structure |
|---|
| >3s69_A Thrombin-like enzyme defibrase; beta-barrel, serine enzymes, fibrinogen binding, glycosylati hydrolase; 1.43A {Gloydius saxatilis} PDB: 1op2_A* 1op0_A* 4gso_A 1bqy_A* | Back alignment and structure |
|---|
| >2qxi_A Kallikrein-7; S1 pocket, chloromethyl ketone, alternate conformations, alternative splicing, glycoprotein, hydrolase, protease, secreted; HET: K7J; 1.00A {Homo sapiens} PDB: 2qxg_A* 2qxh_A* 2qxj_A* 3bsq_A | Back alignment and structure |
|---|
| >1wxr_A Haemoglobin protease; hemoglobine protease, autotransporter, beta helix, heme uptake, spate, hydrolase; 2.20A {Escherichia coli} PDB: 3ak5_A | Back alignment and structure |
|---|
| >4e7n_A Snake-venom thrombin-like enzyme; beta-barrel, hydrolase, arginine esterase, glycosylation, extracellular; HET: NAG; 1.75A {Agkistrodon halys} | Back alignment and structure |
|---|
| >3su6_A NS3 protease, NS4A protein; drug resistance, drug design, protease inhibitors, serine PR viral protein, hydrolase-inhibitor complex; HET: SU3; 1.10A {Hepatitis c virus} PDB: 3su2_A* 3sv9_A* 3m5l_A* 3m5m_A* 3m5n_A 3m5o_A 3rc4_A 3rc5_A 3rc6_A 3su3_A* 3su4_A* 3sv6_A* 3sv7_A* 3su1_A* 3su5_A* 3sv8_A* 3su0_A* 2p59_A* 2qv1_A 1a1q_A ... | Back alignment and structure |
|---|
| >1gvz_A Kallikrein-1E2; antigen, prostate specific antigen, hydrolase; 1.42A {Equus caballus} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >1euf_A Duodenase; serine protease, dual specificity, hydrola; HET: NAG; 2.40A {Bos taurus} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >1fxy_A Coagulation factor XA-trypsin chimera; protease, chloromethylketone, hydrolase-hydrolase I complex; HET: 0G6; 2.15A {Homo sapiens} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >2oq5_A Transmembrane protease, serine 11E; type II trans-membrane serine proteinases, trypsin-like serine protease, tumor marker, hydrolase; 1.61A {Homo sapiens} | Back alignment and structure |
|---|
| >3su6_A NS3 protease, NS4A protein; drug resistance, drug design, protease inhibitors, serine PR viral protein, hydrolase-inhibitor complex; HET: SU3; 1.10A {Hepatitis c virus} PDB: 3su2_A* 3sv9_A* 3m5l_A* 3m5m_A* 3m5n_A 3m5o_A 3rc4_A 3rc5_A 3rc6_A 3su3_A* 3su4_A* 3sv6_A* 3sv7_A* 3su1_A* 3su5_A* 3sv8_A* 3su0_A* 2p59_A* 2qv1_A 1a1q_A ... | Back alignment and structure |
|---|
| >3h7o_A Group 3 allergen smipp-S YV6023A04; hydrolase; 1.85A {Sarcoptes scabiei type hominis} SCOP: b.47.1.0 | Back alignment and structure |
|---|
| >2psx_A Kallikrein-5; zinc inhibition, stratum corneum, glcosylation, hydrolase, H hydrolase inhibitor complex; HET: AR7 NAG; 2.30A {Homo sapiens} PDB: 2psy_A* | Back alignment and structure |
|---|
| >2aiq_A Protein C activator; snake venom serine proteinase, hydrolas; HET: NAG NDG; 1.54A {Agkistrodon contortrix contortrix} PDB: 2aip_A* | Back alignment and structure |
|---|
| >2asu_B Hepatocyte growth factor-like protein; serine proteinase, beta-chain, MSP, HGFL, hydrolase; 1.85A {Homo sapiens} | Back alignment and structure |
|---|
| >3rp2_A RAT MAST cell protease II; serine proteinase; 1.90A {Rattus rattus} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >1a7s_A Heparin binding protein; serine protease homolog, endotoxin binding; HET: NAG; 1.12A {Homo sapiens} SCOP: b.47.1.2 PDB: 1ae5_A* 1fy3_A* 1fy1_A* | Back alignment and structure |
|---|
| >3gyl_B Prostasin; ENAC, zymogen, divalent cation, channel activatin membrane, disulfide bond, glycoprotein, hydrolase, membrane protease, secreted; 1.30A {Homo sapiens} PDB: 3gym_A 3e16_B* 3e0p_B* 3e0n_B* 3e1x_B 3fvf_B* 3dfj_A 3dfl_A* | Back alignment and structure |
|---|
| >3cp7_A Alkaline serine protease Al20; trypsin-like, hydrolase; 1.39A {Nesterenkonia abyssinica} | Back alignment and structure |
|---|
| >3zve_A 3C protease; hydrolase, michael inhibitor; HET: G84; 1.80A {Human enterovirus} PDB: 3zv8_A* 3zva_A* 3zvb_A* 3zv9_A* 3zvd_A* 3zvc_A* 3zvf_A* 3zvg_A* | Back alignment and structure |
|---|
| >1iau_A Granzyme B; hydrolase-hydrolase inhibitor complex; HET: ASJ NAG FUC MAN BMA; 2.00A {Homo sapiens} SCOP: b.47.1.2 PDB: 1fq3_A* 1fi8_A 3tk9_A 3tju_A 3tjv_A | Back alignment and structure |
|---|
| >2f91_A Hepatopancreas trypsin; trypsin, canonical inhibitor, atomic resolution, hydrolase/hydrolase inhibitor complex; 1.20A {Pontastacus leptodactylus} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >1orf_A Granzyme A; hydrolase-hydrolase inhibitor complex; HET: 0G6; 2.40A {Homo sapiens} SCOP: b.47.1.2 PDB: 1op8_A | Back alignment and structure |
|---|
| >4ag1_A Chymase; hydrolase-de novo protein complex, inhibitor, serine proteas; 1.40A {Homo sapiens} PDB: 4afs_A 4afu_A 4afz_A* 4afq_A 4ag2_A* 1nn6_A* 1klt_A* 3n7o_A* 1t31_A* 1pjp_A* 2hvx_A* 3s0n_A* 2rdl_A | Back alignment and structure |
|---|
| >1arb_A Achromobacter protease I; hydrolase(serine protease); 1.20A {Achromobacter lyticus} SCOP: b.47.1.1 PDB: 1arc_A* | Back alignment and structure |
|---|
| >1ep5_B Capsid protein C, coat protein C; beta barrel, hydrolase; 2.30A {Venezuelan equine encephalitis virus} SCOP: b.47.1.3 PDB: 1ep6_A 3j0c_C | Back alignment and structure |
|---|
| >2bhg_A Foot-and-mouth disease virus 3C protease; chymotrypsin-like cysteine protease, capsid protein, core protein; 1.9A {Foot-and-mouth disease virus} SCOP: b.47.1.4 PDB: 2j92_A 2wv4_A 2wv5_A | Back alignment and structure |
|---|
| >1bru_P Elastase, PPE; serine protease, hydrolase; HET: 1NB; 2.30A {Sus scrofa} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >3mhw_U Urokinase-type plasminogen activator; hydrolase, blood coagulation, fibrinolysis, plasminogen activation; HET: ABV; 1.45A {Homo sapiens} SCOP: b.47.1.2 PDB: 1w10_U* 1w11_U* 1w12_U* 1w13_U* 1w14_U* 1w0z_U* 2vip_A* 1f5k_U 1f5l_A* 1f92_A* 2r2w_U* 2vin_A* 2vio_A* 1ejn_A* 2viq_A* 2viv_A* 2viw_A* 1vja_U* 1vj9_U* 1sc8_U* ... | Back alignment and structure |
|---|
| >2fp7_B Serine protease NS3; flavivirus, NS3 protease, NS2B cofactor; HET: OAR; 1.68A {West nile virus} SCOP: b.47.1.3 | Back alignment and structure |
|---|
| >1vcp_A Semliki forest virus capsid protein; virus coat protein, polyprotein, transmembrane, glycoprotein, nucleocapsid protein, viral protein; 3.00A {Semliki forest virus} SCOP: b.47.1.3 PDB: 1dyl_A 1vcq_A | Back alignment and structure |
|---|
| >1z8g_A Serine protease hepsin; serine protease hepsin, protease, hydrolase-hydrolase inhibi complex; HET: AR7; 1.55A {Homo sapiens} SCOP: b.47.1.2 d.170.1.2 PDB: 3t2n_A 1o5e_H* 1o5f_H* 1p57_B* 1o5e_L* 1o5f_L* 1p57_A* | Back alignment and structure |
|---|
| >2xw9_A Complement factor D; immune system, hydrolase, serine protease, alternative pathw; HET: GOL; 1.20A {Homo sapiens} PDB: 2xwb_I* 1bio_A 1dfp_A* 1dic_A* 1dsu_A 1hfd_A 4d9r_A 1fdp_A 2xwa_A 1dst_A 4d9q_A | Back alignment and structure |
|---|
| >4agk_A Capsid protein, coat protein, C; hydrolase, viral protein; 1.81A {Aura virus} PDB: 4agj_A 1kxa_A 2snw_A 1svp_A 1kxb_A 1kxc_A 1kxd_A 1kxe_A 2snv_A 1z8y_Q 1wyk_A | Back alignment and structure |
|---|
| >3e90_B NS3 protease; trypsin-like serine protease, protease inhibitor, catalytic histidine, induced FIT, ATP-binding, capsid protein, helicase; HET: NKK; 2.45A {West nile virus} SCOP: b.47.1.3 | Back alignment and structure |
|---|
| >3ncl_A Suppressor of tumorigenicity 14 protein; proteinase-inhibitor complex, serine proteinase, benzamidine phosphonate, serine endopeptidases; HET: CCZ; 1.19A {Homo sapiens} SCOP: b.47.1.2 PDB: 3bn9_B* 3nps_A 3so3_A* 1eax_A 1eaw_A 2gv6_A* 2gv7_A* 3p8g_A* 3p8f_A* | Back alignment and structure |
|---|
| >1azz_A Collagenase; complex (serine protease/inhibitor), serine protease, inhibitor, complex, protease-substrate interactions, collagen; 2.30A {Celuca pugilator} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >2fom_B Polyprotein; flavivirus, NS3 protease, NS2B cofactor, viral protein-prote complex; 1.50A {Dengue virus 2} SCOP: b.47.1.3 PDB: 1df9_A 2qid_A 1bef_A | Back alignment and structure |
|---|
| >4dcd_A Protease 3C, genome polyprotein; antiviral inhibitors, dipeptidyl inhib hydrolase-hydrolase inhibitor complex; HET: K36; 1.69A {Human poliovirus 1} PDB: 1l1n_A | Back alignment and structure |
|---|
| >2ggv_B NS3, non-structural protein 3; beta barrel, serine protease, viral protease, flavivirus, hydrolase; 1.80A {West nile virus} PDB: 2ijo_B | Back alignment and structure |
|---|
| >3u1j_B Serine protease NS3; serine protease, ER MEM hydrolase-hydrolase inhibitor complex; 1.80A {Dengue virus 3} SCOP: b.47.1.3 PDB: 3u1i_B | Back alignment and structure |
|---|
| >3beu_A Trypsin, SGT; beta sheets, serine protease, hydrolase, zymogen; HET: BEN; 1.05A {Streptomyces griseus} PDB: 3i78_A 3i77_A 2fmj_A 1os8_A 1oss_A 1sgt_A | Back alignment and structure |
|---|
| >1m9u_A Earthworm fibrinolytic enzyme; hydrolase, serine protease (elastase-like); 2.30A {Eisenia fetida} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >3fzz_A Granzyme C; hydrolase, cytolysis, protease, serine protease, zymogen; 2.50A {Mus musculus} SCOP: b.47.1.2 PDB: 3g01_A | Back alignment and structure |
|---|
| >1yc0_A Hepatocyte growth factor activator; hydrolase/inhibitor, hydrolase-inhibitor complex; 2.60A {Homo sapiens} PDB: 1ybw_A 2r0k_A | Back alignment and structure |
|---|
| >2yew_A Capsid protein, coat protein; alphavirus, molecular dynamics; 5.00A {Barmah forest virus} | Back alignment and structure |
|---|
| >3gov_B MAsp-1; complement, serine protease, beta barrel, hydrolase, hydroxy immune response, innate immunity, sushi, coagulation, compl pathway; 2.55A {Homo sapiens} SCOP: b.47.1.0 PDB: 4djz_B | Back alignment and structure |
|---|
| >4dgj_A Enteropeptidase catalytic light chain; serine protease, hydrolase; 1.90A {Homo sapiens} PDB: 1ekb_B | Back alignment and structure |
|---|
| >1yph_E Chymotrypsin A, chain C; serine protease, hydrolase; 1.34A {Bos taurus} PDB: 1ca0_C 1cbw_C 1cho_G 1gct_C 1ab9_C* 1ggd_C* 1gha_G 1ghb_G* 1gmc_G 1gmd_G 1gmh_G 1hja_C 1mtn_C 1n8o_C 1vgc_C* 1gg6_C 2cha_C* 2gch_G 2gct_C 2gmt_C* ... | Back alignment and structure |
|---|
| >1aut_C Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: b.47.1.2 PDB: 3f6u_H* | Back alignment and structure |
|---|
| >3lkw_A Fusion protein of nonstructural protein 2B and nonstructural protein 3; viral protease, serine protease, NS3 protease, NS2B cofactor; 2.00A {Dengue virus 1} PDB: 3l6p_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 597 | ||||
| d1ky9a2 | 249 | b.47.1.1 (A:11-259) Protease Do (DegP, HtrA), cata | 2e-11 | |
| d1ky9a2 | 249 | b.47.1.1 (A:11-259) Protease Do (DegP, HtrA), cata | 0.003 | |
| d1l1ja_ | 228 | b.47.1.1 (A:) Protease Do (DegP, HtrA), catalytic | 2e-10 | |
| d1l1ja_ | 228 | b.47.1.1 (A:) Protease Do (DegP, HtrA), catalytic | 5e-06 | |
| d2z9ia2 | 221 | b.47.1.1 (A:6-226) Protease PepD {Mycobacterium tu | 4e-08 | |
| d2z9ia2 | 221 | b.47.1.1 (A:6-226) Protease PepD {Mycobacterium tu | 4e-04 | |
| d1lcya2 | 205 | b.47.1.1 (A:6-210) Mitochondrial serine protease H | 1e-07 | |
| d2qf3a1 | 210 | b.47.1.1 (A:43-252) Stress sensor protease DegS, c | 1e-05 | |
| d1agja_ | 242 | b.47.1.1 (A:) Epidermolytic (exfoliative) toxin A | 5e-05 | |
| d1qtfa_ | 246 | b.47.1.1 (A:) Exfoliative toxin B {Staphylococcus | 7e-05 | |
| d2o8la1 | 216 | b.47.1.1 (A:1-216) V8 protease {Staphylococcus aur | 0.003 |
| >d1ky9a2 b.47.1.1 (A:11-259) Protease Do (DegP, HtrA), catalytic domain {Escherichia coli [TaxId: 562]} Length = 249 | Back information, alignment and structure |
|---|
class: All beta proteins fold: Trypsin-like serine proteases superfamily: Trypsin-like serine proteases family: Prokaryotic proteases domain: Protease Do (DegP, HtrA), catalytic domain species: Escherichia coli [TaxId: 562]
Score = 61.9 bits (149), Expect = 2e-11
Identities = 37/153 (24%), Positives = 64/153 (41%), Gaps = 17/153 (11%)
Query: 356 DPWIWCDAKIVYVCKGPLDVSLLQLGYIPDQLCPID-ADFGQPSLGSAAYVIGHGLFGPR 414
V K P L P L I AD +G IG+
Sbjct: 106 QLSDGRKFDAKMVGKDPRSDIALIQIQNPKNLTAIKMADSDALRVGDYTVAIGNPFG--- 162
Query: 415 CGLSPSVSSGVVAKVVKANLPSYGQSTLQRNSAYPVMLETTAAVHPGGSGGAVVNLDGHM 474
L +V+SG+V+ + ++ L + ++T AA++ G +GGA+VNL+G +
Sbjct: 163 --LGETVTSGIVSALGRSGLNAENYENF---------IQTDAAINRGNAGGALVNLNGEL 211
Query: 475 IGLVTSNARHGGGTVIPHLNFSIPCAVLRPIFE 507
IG+ T+ GG + + F+IP +++ +
Sbjct: 212 IGINTAILAPDGGNI--GIGFAIPSNMVKNLTS 242
|
| >d1ky9a2 b.47.1.1 (A:11-259) Protease Do (DegP, HtrA), catalytic domain {Escherichia coli [TaxId: 562]} Length = 249 | Back information, alignment and structure |
|---|
| >d1l1ja_ b.47.1.1 (A:) Protease Do (DegP, HtrA), catalytic domain {Thermotoga maritima [TaxId: 2336]} Length = 228 | Back information, alignment and structure |
|---|
| >d1l1ja_ b.47.1.1 (A:) Protease Do (DegP, HtrA), catalytic domain {Thermotoga maritima [TaxId: 2336]} Length = 228 | Back information, alignment and structure |
|---|
| >d2z9ia2 b.47.1.1 (A:6-226) Protease PepD {Mycobacterium tuberculosis [TaxId: 1773]} Length = 221 | Back information, alignment and structure |
|---|
| >d2z9ia2 b.47.1.1 (A:6-226) Protease PepD {Mycobacterium tuberculosis [TaxId: 1773]} Length = 221 | Back information, alignment and structure |
|---|
| >d1lcya2 b.47.1.1 (A:6-210) Mitochondrial serine protease HtrA2, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Length = 205 | Back information, alignment and structure |
|---|
| >d2qf3a1 b.47.1.1 (A:43-252) Stress sensor protease DegS, catalytic domain {Escherichia coli [TaxId: 562]} Length = 210 | Back information, alignment and structure |
|---|
| >d1agja_ b.47.1.1 (A:) Epidermolytic (exfoliative) toxin A {Staphylococcus aureus [TaxId: 1280]} Length = 242 | Back information, alignment and structure |
|---|
| >d1qtfa_ b.47.1.1 (A:) Exfoliative toxin B {Staphylococcus aureus [TaxId: 1280]} Length = 246 | Back information, alignment and structure |
|---|
| >d2o8la1 b.47.1.1 (A:1-216) V8 protease {Staphylococcus aureus [TaxId: 1280]} Length = 216 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 597 | |||
| d1ky9a2 | 249 | Protease Do (DegP, HtrA), catalytic domain {Escher | 99.97 | |
| d1l1ja_ | 228 | Protease Do (DegP, HtrA), catalytic domain {Thermo | 99.96 | |
| d2qf3a1 | 210 | Stress sensor protease DegS, catalytic domain {Esc | 99.96 | |
| d2z9ia2 | 221 | Protease PepD {Mycobacterium tuberculosis [TaxId: | 99.96 | |
| d1lcya2 | 205 | Mitochondrial serine protease HtrA2, catalytic dom | 99.95 | |
| d1ky9a2 | 249 | Protease Do (DegP, HtrA), catalytic domain {Escher | 99.84 | |
| d1agja_ | 242 | Epidermolytic (exfoliative) toxin A {Staphylococcu | 99.84 | |
| d1lvmb_ | 219 | TEV protease (nucleat inclusion protein A, NIA) {T | 99.82 | |
| d1l1ja_ | 228 | Protease Do (DegP, HtrA), catalytic domain {Thermo | 99.76 | |
| d2qaaa1 | 185 | Protease B {Streptomyces griseus, strain k1 [TaxId | 99.7 | |
| d1qtfa_ | 246 | Exfoliative toxin B {Staphylococcus aureus [TaxId: | 99.67 | |
| d2o8la1 | 216 | V8 protease {Staphylococcus aureus [TaxId: 1280]} | 99.63 | |
| d2qf3a1 | 210 | Stress sensor protease DegS, catalytic domain {Esc | 99.63 | |
| d2z9ia2 | 221 | Protease PepD {Mycobacterium tuberculosis [TaxId: | 99.59 | |
| d2bhga1 | 199 | 3C cysteine protease (picornain 3C) {Foot-and-mout | 99.51 | |
| d1p3ca_ | 215 | Glutamyl endopeptidase {Bacillus intermedius [TaxI | 99.5 | |
| d1lcya2 | 205 | Mitochondrial serine protease HtrA2, catalytic dom | 99.49 | |
| d2h5ca1 | 198 | alpha-Lytic protease {Lysobacter enzymogenes, 495 | 99.48 | |
| d2sgaa_ | 181 | Protease A {Streptomyces griseus, strain k1 [TaxId | 99.48 | |
| d1lvmb_ | 219 | TEV protease (nucleat inclusion protein A, NIA) {T | 99.31 | |
| d1hpga_ | 187 | Glutamic acid-specific protease {Streptomyces gris | 99.25 | |
| d1agja_ | 242 | Epidermolytic (exfoliative) toxin A {Staphylococcu | 99.18 | |
| d2qaaa1 | 185 | Protease B {Streptomyces griseus, strain k1 [TaxId | 99.15 | |
| d1bioa_ | 228 | Factor D {Human (Homo sapiens) [TaxId: 9606]} | 99.03 | |
| d2bhga1 | 199 | 3C cysteine protease (picornain 3C) {Foot-and-mout | 99.02 | |
| d1lo6a_ | 221 | Kallikrein 6 {Human (Homo sapiens) [TaxId: 9606]} | 98.97 | |
| d1j16a_ | 223 | Trypsin(ogen) {Rat (Rattus norvegicus) [TaxId: 101 | 98.96 | |
| d1a7sa_ | 225 | Heparin binding protein, HBP {Human (Homo sapiens) | 98.93 | |
| d2z7fe1 | 218 | Elastase {Human (Homo sapiens) [TaxId: 9606]} | 98.93 | |
| d1hj8a_ | 222 | Trypsin(ogen) {North atlantic salmon (Salmo salar) | 98.92 | |
| d1npma_ | 225 | Neuropsin {Mouse (Mus musculus) [TaxId: 10090]} | 98.9 | |
| d1arba_ | 263 | Achromobacter protease {Achromobacter lyticus, str | 98.9 | |
| d1gdna_ | 224 | Trypsin(ogen) {Mold (Fusarium oxysporum) [TaxId: 5 | 98.9 | |
| d1orfa_ | 232 | Granzyme A {Human (Homo sapiens) [TaxId: 9606]} | 98.89 | |
| d1ao5a_ | 237 | Kallikrein-13 {Mouse (Mus musculus) [TaxId: 10090] | 98.89 | |
| d1op0a_ | 234 | Venom serine protease {Hundred-pace snake (Agkistr | 98.85 | |
| d1azza_ | 226 | Crab collagenase {Atlantic sand fiddler crab (Uca | 98.84 | |
| d1mzaa_ | 240 | Granzyme K {Human (Homo sapiens) [TaxId: 9606]} | 98.84 | |
| g2pka.1 | 232 | Kallikrein A {Pig (Sus scrofa) [TaxId: 9823]} | 98.83 | |
| d1eq9a_ | 222 | (alpha,gamma)-chymotrypsin(ogen) {Red fire ant (So | 98.81 | |
| d1si5h_ | 234 | Hepatocyte growth factor, HGF {Human (Homo sapiens | 98.81 | |
| d1gvza_ | 237 | Prostate specific antigen (PSA kallikrein) {Horse | 98.8 | |
| d1ekbb_ | 235 | Enteropeptidase (enterokinase light chain) {Cow (B | 98.8 | |
| d1cqqa_ | 180 | 3C cysteine protease (picornain 3C) {Human rhinovi | 98.78 | |
| d1tona_ | 235 | Tonin {Rat (Rattus rattus) [TaxId: 10117]} | 98.78 | |
| d1xx9a_ | 237 | Coagulation factor XI {Human (Homo sapiens) [TaxId | 98.76 | |
| d1eufa_ | 224 | Duodenase {Cow (Bos taurus) [TaxId: 9913]} | 98.76 | |
| d1nn6a_ | 224 | Chymase (mast cell protease I) {Human (Homo sapien | 98.75 | |
| d1fuja_ | 221 | Myeloblastin, PR3 {Human (Homo sapiens) [TaxId: 96 | 98.72 | |
| d1fi8a_ | 227 | Granzyme B {Rat (Rattus norvegicus) [TaxId: 10116] | 98.72 | |
| d2sgaa_ | 181 | Protease A {Streptomyces griseus, strain k1 [TaxId | 98.69 | |
| d2f91a1 | 237 | Trypsin(ogen) {Narrow-clawed crayfish (Pontastacus | 98.67 | |
| d2hlca_ | 230 | HL collagenase {Common cattle grub (Hypoderma line | 98.66 | |
| d1hj9a_ | 223 | Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]} | 98.66 | |
| d1fxya_ | 228 | Coagulation factor Xa-trypsin chimera {Synthetic, | 98.65 | |
| d1sgfa_ | 228 | 7S NGF protease subunits {Mouse (Mus musculus) [Ta | 98.65 | |
| d1elta_ | 236 | Elastase {Salmon (Salmo salar) [TaxId: 8030]} | 98.63 | |
| d1rjxb_ | 247 | Plasmin(ogen), catalytic domain {Human (Homo sapie | 98.63 | |
| d1z8ga1 | 255 | Hepsin, catalytic domain {Human (Homo sapiens) [Ta | 98.6 | |
| g1gg6.1 | 238 | (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus) | 98.59 | |
| d2bz6h1 | 254 | Coagulation factor VIIa {Human (Homo sapiens) [Tax | 98.59 | |
| d1fq3a_ | 227 | Granzyme B {Human (Homo sapiens) [TaxId: 9606]} | 98.58 | |
| d1autc_ | 240 | Activated protein c (autoprothrombin IIa) {Human ( | 98.58 | |
| d1rfna_ | 235 | Coagulation factor IXa, protease domain {Human (Ho | 98.56 | |
| d1t32a1 | 224 | Cathepsin G {Human (Homo sapiens) [TaxId: 9606]} | 98.56 | |
| d1rrka1 | 287 | Factor B {Human (Homo sapiens) [TaxId: 9606]} | 98.51 | |
| d2h5ca1 | 198 | alpha-Lytic protease {Lysobacter enzymogenes, 495 | 98.51 | |
| d1eaxa_ | 241 | Matriptase MTSP1 {Human (Homo sapiens) [TaxId: 960 | 98.51 | |
| g1fiw.1 | 274 | Beta-acrosin {Sheep (Ovis aries) [TaxId: 9940]} | 98.5 | |
| d1fona_ | 232 | Procarboxypeptidase A-S6 subunit III (zymogen E) { | 98.5 | |
| d3rp2a_ | 224 | Chymase II (mast cell proteinase II) {Rat (Rattus | 98.5 | |
| d2fpza1 | 243 | beta-Tryptase {Human (Homo sapiens) [TaxId: 9606]} | 98.45 | |
| d1brup_ | 241 | Elastase {Pig (Sus scrofa) [TaxId: 9823]} | 98.44 | |
| d2qy0b1 | 240 | Complement C1R protease, catalytic domain {Human ( | 98.44 | |
| d1gvkb_ | 240 | Elastase {Pig (Sus scrofa) [TaxId: 9823]} | 98.4 | |
| d1elva1 | 259 | Complement C1S protease, catalytic domain {Human ( | 98.39 | |
| d2p3ub1 | 233 | Coagulation factor Xa, protease domain {Human (Hom | 98.38 | |
| d1qtfa_ | 246 | Exfoliative toxin B {Staphylococcus aureus [TaxId: | 98.37 | |
| d1os8a_ | 223 | Trypsin {Streptomyces griseus, strain k1 [TaxId: 1 | 98.37 | |
| g1gj7.1 | 256 | Urokinase-type plasminogen activator (LMW U-PA), c | 98.36 | |
| g1rtf.1 | 260 | Two-chain tissue plasminogen activator (TC)-T-PA { | 98.36 | |
| d1pytd_ | 251 | (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus) | 98.36 | |
| d1m9ua_ | 241 | Elastase {Worm (Eisenia fetida) [TaxId: 6396]} | 98.35 | |
| d1q3xa1 | 242 | Mannan-binding lectin serine protease 2 (MASP-2), | 98.2 | |
| g1h8d.1 | 289 | Thrombin {Human (Homo sapiens) [TaxId: 9606]} | 98.16 | |
| d2o8la1 | 216 | V8 protease {Staphylococcus aureus [TaxId: 1280]} | 98.01 | |
| d1hpga_ | 187 | Glutamic acid-specific protease {Streptomyces gris | 97.68 | |
| d1p3ca_ | 215 | Glutamyl endopeptidase {Bacillus intermedius [TaxI | 97.37 | |
| d1l1na_ | 180 | 3C cysteine protease (picornain 3C) {Human poliovi | 97.26 | |
| d1cqqa_ | 180 | 3C cysteine protease (picornain 3C) {Human rhinovi | 96.76 | |
| d2h6ma1 | 212 | 3C cysteine protease (picornain 3C) {Human hepatit | 95.49 | |
| d1mbma_ | 198 | NSP4 proteinase {Equine arteritis virus, EAV [TaxI | 95.03 | |
| d1gdna_ | 224 | Trypsin(ogen) {Mold (Fusarium oxysporum) [TaxId: 5 | 90.01 | |
| d1ep5a_ | 156 | Viral capsid protein {Venezuelan equine encephalit | 86.67 | |
| d1wyka_ | 152 | Viral capsid protein {Sindbis virus [TaxId: 11034] | 86.38 | |
| g1dy9.1 | 187 | NS3 protease {Human hepatitis C virus (HCV), diffe | 85.07 | |
| d2fp7b1 | 152 | NS3 protease {West nile virus [TaxId: 11082]} | 84.69 | |
| d2fomb1 | 150 | NS3 protease {Dengue virus type 2 [TaxId: 11060]} | 83.46 | |
| d1vcpa_ | 149 | Viral capsid protein {Semliki forest virus [TaxId: | 82.95 | |
| d1npma_ | 225 | Neuropsin {Mouse (Mus musculus) [TaxId: 10090]} | 82.93 | |
| d1l1na_ | 180 | 3C cysteine protease (picornain 3C) {Human poliovi | 82.83 | |
| g1dy9.1 | 187 | NS3 protease {Human hepatitis C virus (HCV), diffe | 81.08 |
| >d1ky9a2 b.47.1.1 (A:11-259) Protease Do (DegP, HtrA), catalytic domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: Trypsin-like serine proteases superfamily: Trypsin-like serine proteases family: Prokaryotic proteases domain: Protease Do (DegP, HtrA), catalytic domain species: Escherichia coli [TaxId: 562]
Probab=99.97 E-value=5.2e-31 Score=264.26 Aligned_cols=171 Identities=29% Similarity=0.519 Sum_probs=140.3
Q ss_pred eEEEEEEEeCC-cEEEecccccCCCCCccccccCCcccccccCCCCCCCCCCCccccccccCCCCCCCcccccccccccc
Q 007572 257 VWASGVLLNDQ-GLILTNAHLLEPWRFGKTTVSGWRNGVSFQPEDSASSGHTGVDQYQKSQTLPPKMPKIVDSSVDEHRA 335 (597)
Q Consensus 257 ~~GSGflIs~~-G~ILTnaHVV~p~~~~~t~~~g~~~~~~f~~~~~~~~~~~~~~~~q~~qtl~~k~i~i~~~~~~~~~~ 335 (597)
+.||||+|+++ ||||||+||++
T Consensus 76 ~~GSG~iI~~~~g~IlTn~HVv~--------------------------------------------------------- 98 (249)
T d1ky9a2 76 ALGSGVIIDADKGYVVTNNHVVD--------------------------------------------------------- 98 (249)
T ss_dssp EEEEEEEEETTTTEEEEEHHHHT---------------------------------------------------------
T ss_pred ccccEEEEeccCceEEeeccccc---------------------------------------------------------
Confidence 46999999875 99999999997
Q ss_pred cccccccCCceEEEEEEcCCCCceeEeeEEEEeecCCCcEEEEEEccCCCCccceecCCC-CCCCCCeEEEEccCCCCCC
Q 007572 336 YKLSSFSRGHRKIRVRLDHLDPWIWCDAKIVYVCKGPLDVSLLQLGYIPDQLCPIDADFG-QPSLGSAAYVIGHGLFGPR 414 (597)
Q Consensus 336 ~~~~~~~~~~~~i~V~l~~~~~~~w~~A~Vv~~~~~~~DLALLkl~~~~~~l~pi~l~~s-~~~~Ge~V~vIGyPlf~~~ 414 (597)
+...+.+++.+++. +.|+++. .|...|+|||+++. +..+++++++++ .+++||.|+++|||
T Consensus 99 --------~~~~~~v~~~~~~~---~~a~~~~-~d~~~dlavl~i~~-~~~~~~~~l~~~~~~~~G~~v~aiG~P----- 160 (249)
T d1ky9a2 99 --------NATVIKVQLSDGRK---FDAKMVG-KDPRSDIALIQIQN-PKNLTAIKMADSDALRVGDYTVAIGNP----- 160 (249)
T ss_dssp --------TEEEEEEEETTSCE---EEEEEEE-EETTTTEEEEEESS-CCSCCCCCBCCGGGCCTTCEEEEEECT-----
T ss_pred --------cceeeeeeeccccc---ccceeeE-eccchhhceeeecc-cccceEEEcCCcCcCCcCCEEEEEecc-----
Confidence 12346777777765 8999998 56779999999986 567899999775 59999999999995
Q ss_pred CCCCCeeEeeEEeeeeeccCCCCCCcccccCCCcCeEEEEcccccCCCCCCceecCCceEEEEEeeeecCCCCcccCceE
Q 007572 415 CGLSPSVSSGVVAKVVKANLPSYGQSTLQRNSAYPVMLETTAAVHPGGSGGAVVNLDGHMIGLVTSNARHGGGTVIPHLN 494 (597)
Q Consensus 415 ~g~~~svt~GiVS~v~~~~~~~~~~~~~~~~~~~~~~iqtdAav~~GnSGGPL~n~~G~VIGIvss~~~~~~g~~~p~ln 494 (597)
+++..+++.|+++...+.... ......+|||||++++|||||||||.+|+||||+++.....++.. +++
T Consensus 161 ~g~~~tvt~~~~~~~~~~~~~---------~~~~~~~iqtda~i~~GnSGGPl~n~~G~vIGI~t~~~~~~~~~~--gi~ 229 (249)
T d1ky9a2 161 FGLGETVTSGIVSALGRSGLN---------AENYENFIQTDAAINRGNAGGALVNLNGELIGINTAILAPDGGNI--GIG 229 (249)
T ss_dssp TSSSCEEEEEEEEEESSCC--------------CCCCEEESCCCTTSCCCSEEECTTSCEEEEEECSSTTSCCCS--SSE
T ss_pred cccCCceeecceeeccccccc---------CccccceEEEeeeecCCCCCceEECCCCEEEEEEEEEeccCCCcc--cEE
Confidence 578899999999887653210 123445899999999999999999999999999999877655443 899
Q ss_pred EEEehhHHHHHHHHHHhcC
Q 007572 495 FSIPCAVLRPIFEFARDMQ 513 (597)
Q Consensus 495 FaIPi~~l~~~l~~~~~~g 513 (597)
||||++.++++++++.+.|
T Consensus 230 faIP~~~~~~~~~~l~~~G 248 (249)
T d1ky9a2 230 FAIPSNMVKNLTSQMVEYG 248 (249)
T ss_dssp EEEEHHHHHHHHHHHHHHS
T ss_pred EEEEHHHHHHHHHHHHHhC
Confidence 9999999999999997755
|
| >d1l1ja_ b.47.1.1 (A:) Protease Do (DegP, HtrA), catalytic domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2qf3a1 b.47.1.1 (A:43-252) Stress sensor protease DegS, catalytic domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2z9ia2 b.47.1.1 (A:6-226) Protease PepD {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1lcya2 b.47.1.1 (A:6-210) Mitochondrial serine protease HtrA2, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ky9a2 b.47.1.1 (A:11-259) Protease Do (DegP, HtrA), catalytic domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1agja_ b.47.1.1 (A:) Epidermolytic (exfoliative) toxin A {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1lvmb_ b.47.1.3 (B:) TEV protease (nucleat inclusion protein A, NIA) {Tobacco etch virus, TEV [TaxId: 12227]} | Back information, alignment and structure |
|---|
| >d1l1ja_ b.47.1.1 (A:) Protease Do (DegP, HtrA), catalytic domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2qaaa1 b.47.1.1 (A:16-242) Protease B {Streptomyces griseus, strain k1 [TaxId: 1911]} | Back information, alignment and structure |
|---|
| >d1qtfa_ b.47.1.1 (A:) Exfoliative toxin B {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d2o8la1 b.47.1.1 (A:1-216) V8 protease {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d2qf3a1 b.47.1.1 (A:43-252) Stress sensor protease DegS, catalytic domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2z9ia2 b.47.1.1 (A:6-226) Protease PepD {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2bhga1 b.47.1.4 (A:7-205) 3C cysteine protease (picornain 3C) {Foot-and-mouth disease virus FMDV [TaxId: 12110]} | Back information, alignment and structure |
|---|
| >d1p3ca_ b.47.1.1 (A:) Glutamyl endopeptidase {Bacillus intermedius [TaxId: 1400]} | Back information, alignment and structure |
|---|
| >d1lcya2 b.47.1.1 (A:6-210) Mitochondrial serine protease HtrA2, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2h5ca1 b.47.1.1 (A:15A-245) alpha-Lytic protease {Lysobacter enzymogenes, 495 [TaxId: 69]} | Back information, alignment and structure |
|---|
| >d2sgaa_ b.47.1.1 (A:) Protease A {Streptomyces griseus, strain k1 [TaxId: 1911]} | Back information, alignment and structure |
|---|
| >d1lvmb_ b.47.1.3 (B:) TEV protease (nucleat inclusion protein A, NIA) {Tobacco etch virus, TEV [TaxId: 12227]} | Back information, alignment and structure |
|---|
| >d1hpga_ b.47.1.1 (A:) Glutamic acid-specific protease {Streptomyces griseus [TaxId: 1911]} | Back information, alignment and structure |
|---|
| >d1agja_ b.47.1.1 (A:) Epidermolytic (exfoliative) toxin A {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d2qaaa1 b.47.1.1 (A:16-242) Protease B {Streptomyces griseus, strain k1 [TaxId: 1911]} | Back information, alignment and structure |
|---|
| >d1bioa_ b.47.1.2 (A:) Factor D {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bhga1 b.47.1.4 (A:7-205) 3C cysteine protease (picornain 3C) {Foot-and-mouth disease virus FMDV [TaxId: 12110]} | Back information, alignment and structure |
|---|
| >d1lo6a_ b.47.1.2 (A:) Kallikrein 6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1j16a_ b.47.1.2 (A:) Trypsin(ogen) {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1a7sa_ b.47.1.2 (A:) Heparin binding protein, HBP {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2z7fe1 b.47.1.2 (E:16-243) Elastase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hj8a_ b.47.1.2 (A:) Trypsin(ogen) {North atlantic salmon (Salmo salar) [TaxId: 8030]} | Back information, alignment and structure |
|---|
| >d1npma_ b.47.1.2 (A:) Neuropsin {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1arba_ b.47.1.1 (A:) Achromobacter protease {Achromobacter lyticus, strain m497-1 [TaxId: 224]} | Back information, alignment and structure |
|---|
| >d1gdna_ b.47.1.2 (A:) Trypsin(ogen) {Mold (Fusarium oxysporum) [TaxId: 5507]} | Back information, alignment and structure |
|---|
| >d1orfa_ b.47.1.2 (A:) Granzyme A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ao5a_ b.47.1.2 (A:) Kallikrein-13 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1op0a_ b.47.1.2 (A:) Venom serine protease {Hundred-pace snake (Agkistrodon acutus) [TaxId: 36307]} | Back information, alignment and structure |
|---|
| >d1azza_ b.47.1.2 (A:) Crab collagenase {Atlantic sand fiddler crab (Uca pugilator) [TaxId: 6772]} | Back information, alignment and structure |
|---|
| >d1mzaa_ b.47.1.2 (A:) Granzyme K {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1eq9a_ b.47.1.2 (A:) (alpha,gamma)-chymotrypsin(ogen) {Red fire ant (Solenopsis invicta) [TaxId: 13686]} | Back information, alignment and structure |
|---|
| >d1si5h_ b.47.1.2 (H:) Hepatocyte growth factor, HGF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gvza_ b.47.1.2 (A:) Prostate specific antigen (PSA kallikrein) {Horse (Equus caballus) [TaxId: 9796]} | Back information, alignment and structure |
|---|
| >d1ekbb_ b.47.1.2 (B:) Enteropeptidase (enterokinase light chain) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1cqqa_ b.47.1.4 (A:) 3C cysteine protease (picornain 3C) {Human rhinovirus 2 [TaxId: 12130]} | Back information, alignment and structure |
|---|
| >d1tona_ b.47.1.2 (A:) Tonin {Rat (Rattus rattus) [TaxId: 10117]} | Back information, alignment and structure |
|---|
| >d1xx9a_ b.47.1.2 (A:) Coagulation factor XI {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1eufa_ b.47.1.2 (A:) Duodenase {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1nn6a_ b.47.1.2 (A:) Chymase (mast cell protease I) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fuja_ b.47.1.2 (A:) Myeloblastin, PR3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fi8a_ b.47.1.2 (A:) Granzyme B {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2sgaa_ b.47.1.1 (A:) Protease A {Streptomyces griseus, strain k1 [TaxId: 1911]} | Back information, alignment and structure |
|---|
| >d2f91a1 b.47.1.2 (A:16-244) Trypsin(ogen) {Narrow-clawed crayfish (Pontastacus leptodactylus) [TaxId: 6717]} | Back information, alignment and structure |
|---|
| >d2hlca_ b.47.1.2 (A:) HL collagenase {Common cattle grub (Hypoderma lineatum) [TaxId: 7389]} | Back information, alignment and structure |
|---|
| >d1hj9a_ b.47.1.2 (A:) Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1fxya_ b.47.1.2 (A:) Coagulation factor Xa-trypsin chimera {Synthetic, based on Homo sapiens sequence} | Back information, alignment and structure |
|---|
| >d1sgfa_ b.47.1.2 (A:) 7S NGF protease subunits {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1elta_ b.47.1.2 (A:) Elastase {Salmon (Salmo salar) [TaxId: 8030]} | Back information, alignment and structure |
|---|
| >d1rjxb_ b.47.1.2 (B:) Plasmin(ogen), catalytic domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z8ga1 b.47.1.2 (A:163-417) Hepsin, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bz6h1 b.47.1.2 (H:16-257) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fq3a_ b.47.1.2 (A:) Granzyme B {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1autc_ b.47.1.2 (C:) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rfna_ b.47.1.2 (A:) Coagulation factor IXa, protease domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1t32a1 b.47.1.2 (A:16-244) Cathepsin G {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rrka1 b.47.1.2 (A:453-739) Factor B {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2h5ca1 b.47.1.1 (A:15A-245) alpha-Lytic protease {Lysobacter enzymogenes, 495 [TaxId: 69]} | Back information, alignment and structure |
|---|
| >d1eaxa_ b.47.1.2 (A:) Matriptase MTSP1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fona_ b.47.1.2 (A:) Procarboxypeptidase A-S6 subunit III (zymogen E) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d3rp2a_ b.47.1.2 (A:) Chymase II (mast cell proteinase II) {Rat (Rattus rattus) [TaxId: 10117]} | Back information, alignment and structure |
|---|
| >d2fpza1 b.47.1.2 (A:16-244) beta-Tryptase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1brup_ b.47.1.2 (P:) Elastase {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d2qy0b1 b.47.1.2 (B:447-686) Complement C1R protease, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gvkb_ b.47.1.2 (B:) Elastase {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1elva1 b.47.1.2 (A:410-668) Complement C1S protease, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2p3ub1 b.47.1.2 (B:16-243) Coagulation factor Xa, protease domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qtfa_ b.47.1.1 (A:) Exfoliative toxin B {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1os8a_ b.47.1.1 (A:) Trypsin {Streptomyces griseus, strain k1 [TaxId: 1911]} | Back information, alignment and structure |
|---|
| >d1pytd_ b.47.1.2 (D:) (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1m9ua_ b.47.1.2 (A:) Elastase {Worm (Eisenia fetida) [TaxId: 6396]} | Back information, alignment and structure |
|---|
| >d1q3xa1 b.47.1.2 (A:445-686) Mannan-binding lectin serine protease 2 (MASP-2), catalytic domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2o8la1 b.47.1.1 (A:1-216) V8 protease {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1hpga_ b.47.1.1 (A:) Glutamic acid-specific protease {Streptomyces griseus [TaxId: 1911]} | Back information, alignment and structure |
|---|
| >d1p3ca_ b.47.1.1 (A:) Glutamyl endopeptidase {Bacillus intermedius [TaxId: 1400]} | Back information, alignment and structure |
|---|
| >d1l1na_ b.47.1.4 (A:) 3C cysteine protease (picornain 3C) {Human poliovirus 1 Mahoney [TaxId: 12081]} | Back information, alignment and structure |
|---|
| >d1cqqa_ b.47.1.4 (A:) 3C cysteine protease (picornain 3C) {Human rhinovirus 2 [TaxId: 12130]} | Back information, alignment and structure |
|---|
| >d2h6ma1 b.47.1.4 (A:1-212) 3C cysteine protease (picornain 3C) {Human hepatitis A virus [TaxId: 208726]} | Back information, alignment and structure |
|---|
| >d1mbma_ b.47.1.3 (A:) NSP4 proteinase {Equine arteritis virus, EAV [TaxId: 11047]} | Back information, alignment and structure |
|---|
| >d1gdna_ b.47.1.2 (A:) Trypsin(ogen) {Mold (Fusarium oxysporum) [TaxId: 5507]} | Back information, alignment and structure |
|---|
| >d1ep5a_ b.47.1.3 (A:) Viral capsid protein {Venezuelan equine encephalitis virus [TaxId: 11036]} | Back information, alignment and structure |
|---|
| >d1wyka_ b.47.1.3 (A:) Viral capsid protein {Sindbis virus [TaxId: 11034]} | Back information, alignment and structure |
|---|
| >d2fp7b1 b.47.1.3 (B:19-170) NS3 protease {West nile virus [TaxId: 11082]} | Back information, alignment and structure |
|---|
| >d2fomb1 b.47.1.3 (B:18-167) NS3 protease {Dengue virus type 2 [TaxId: 11060]} | Back information, alignment and structure |
|---|
| >d1vcpa_ b.47.1.3 (A:) Viral capsid protein {Semliki forest virus [TaxId: 11033]} | Back information, alignment and structure |
|---|
| >d1npma_ b.47.1.2 (A:) Neuropsin {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1l1na_ b.47.1.4 (A:) 3C cysteine protease (picornain 3C) {Human poliovirus 1 Mahoney [TaxId: 12081]} | Back information, alignment and structure |
|---|