Citrus Sinensis ID: 007591

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------

MSSIEFLRSTIHNRFLYANSSYNLHGGSFCHSRCRVYYHNTYRFASHAILFPSVIISNSQQKLSLKRGLLYSNQNLREIKILASSKDGESSETSESDGQSQSQTQSPTSTDSPTSQRREKRNKSNGFWWSKGKKFKWQPIIQAQEIGVLLLQLGIVMFVMRLLRPGIPLPGSEPRTSTTFVSVPYSDFLSKINSNQVAKVEVDGVHIMFKLKNDGSIQESEVITNKFQESESLLKSVTPTKRIVYTTTRPSDIKTPYEKMLENQVEFGSPDKRSGGFLNSALIALFYVAVLAGLLHRFPVSFSQTAGQVGHRKTRGPGGAKVSEQGDTITFADVAGVDEAKEELEEIVEFLRSPDKYIRLGARPPRGVLLVGLPGTGKTLLAKAVAGEAEVPFISCSASEFVELYVGMGASRVRDLFARAKKEAPSIIFIDEIDAVAKSRDGRFRIVSNDEREQTLNQLLTEMDGFDSNSAVIVLGATNRSDVLDPALRRPGRFDRVVMVETPDKIGREAILKVHVSKKELPLAKDIDLGDIASMTTGFTGADLANLVNEAALLAGRLNKVVVEKIDFIHAVERSIAGIEKKTAKLKGSEKAVVARQ

cccccccccccccccccccccccccccccccccccEECcccccccccccccccEEEEcccHHHHHHHcccccccHHHHHHHHHcccccccccccccccccccccccccccccccccHHcccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHHcccEEEEEEEccEEEEEEEcccccccHHHHHccccccHHHHccccccccEEEEECcccccccHHHHHHHcccEEECcccccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccEEEccccccHHHHHHHHHHHHHccccHHHHHccccccccEEEEcccccHHHHHHHHHHccccccEEEcccccEEEEcccccHHHHHHHHHHHHHcccEEEEEEcccccccccccccccccccHHHHHHHHHHHHHccccccccEEEEEEccccccccccccccccccccccccccccHHHHHHHHHHcccccccccccccHHHHHcccccccHHHHHHHHHHHHHHHHHcccccccHHcHHHHHHHHHccccccccccccccccccccc

****EFLRSTIHNRFLYANSSYNLHGGSFCHSRCRVYYHNTYRFASHAILFPSVIISNSQQKLSLKRGLLYSNQNLREIKI********************************************GFWWSKGKKFKWQPIIQAQEIGVLLLQLGIVMFVMRLLRPGIPLP*********FVSVPYSDFLSKINSNQVAKVEVDGVHIMFKLKNDGSI*****I*********L*KSVTPTKRIVYTTTRPSDIKTPYEKMLENQVEFGSPDKRSGGFLNSALIALFYVAVLAGLLHRFPVSFSQ********************QGDTITFADVAGVDEAKEELEEIVEFLRSPDKYIRLGARPPRGVLLVGLPGTGKTLLAKAVAGEAEVPFISCSASEFVELYVGMGASRVRDLFARAKKEAPSIIFIDEIDAVAKSRDGR***VSNDEREQTLNQLLTEMDGFDSNSAVIVLGATNRSDVLDPALRRPGRFDRVVMVETPDKIGREAILKVHVSKKELPLAKDIDLGDIASMTTGFTGADLANLVNEAALLAGRLNKVVVEKIDFIHAVERSIAGIEKKTA**KGSEKAV****

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
ATP-dependent zinc metalloprotease FTSH 7, chloroplastic	Probable ATP-dependent zinc metallopeptidase.	probable	Q9SD67
ATP-dependent zinc metalloprotease FTSH 7, chloroplastic	Probable ATP-dependent zinc metallopeptidase.	probable	Q6H6R9
ATP-dependent zinc metalloprotease FTSH, chloroplastic (Fragment)	Probable ATP-dependent zinc metallopeptidase.	probable	P85190

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2R62, chain A
Confidence level:very confident
Coverage over the Query: 324-438,449-581
View the alignment between query and template
View the model in PyMOL

Template: 3CF2, chain A
Confidence level:very confident
Coverage over the Query: 242-436,452-526,543-572
View the alignment between query and template
View the model in PyMOL