Citrus Sinensis ID: 007615

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590------
MAQIPNLDNAPLNLKSIREQSQRDLVNILKNIRGKKCLVIDPKLSGSLSLIVPTSTLKEYGIELRLLSAEPVQTDCAKVVYFVGPQFISMRFISSHVHDDASKGLQREYFLYFVPRRSVACEKILEEEKVHNLMTIGEYPLYMVPLDEDVLSFELDLAHKEWQVDGDASSLWHIAKAIHKLEFTFGLIPNVRAKGKASVRVAEILNRMQTEEPVSLSDMNIPEINTLVLIDREVDMVTPMCSQLTYEGLVDEFLRINNGSVELDASIMGAQQQDGKKMKVPLNSSDKLFKEIRDLNFEVVVQVLRQKATSMKQDYTEVTTMSQTVSELKDFVKKLNSLPEMTRHINLAQHLSTFTSKPSFLGQLDMEHTIIEAQSYDICFEYIEEMIHKQEPLNKVLRLLILFSVTNSGLPKKQFDYLRRELLHSYGFEHMATLNNLEKAGLFKKQETKSNWQLVKRALQLVEDTDTANPNDISYVFSGYAPLSIRLVQNAIRSGWRPMEEILKLLPGPHYETKRGGFSSSPSFDMSQGLSSSIDKVGDGRRSLVLVVFVGGVTFAEISALRFLSAQEGMAYDVIVGTTKIISGNSLAETFSENLG
cccccccccccccHHHHHHHHHHHHHHHHHcccccEEEEEcccccccccccccccccccccEEEEEEccccccccccEEEEEEcccHHHHHHHHHHHHccccccccccEEEEEcccccHHHHHHHHHcccccEEEEEEEEccEECccccEEEEccccccHHHcccccccHHHHHHHHHHHHHHHcccccCEcccccHHHHHHHHHHHHHHHccccccccccccccEEEEEEccccccccccHHHHHHHHHHHHHcccccEEEEcccccccccccccEEEEccccccHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHcHHHHHHHHHHHHcccccccccccHHHHHHHHHccccccccccccccccccccccHHHHHHHHHHHHcccccHHHHHccccccccccccccccccccccccccccccccccccccccEEEEEEEccccHHHHHHHHHHHHHcccccEEEEEccccccHHHHHHHHHHHcc
***********LNLKSIREQSQRDLVNILKNIRGKKCLVIDPKLSGSLSLIVPTSTLKEYGIELRLLSAEPVQTDCAKVVYFVGPQFISMRFISSHVHDDASKGLQREYFLYFVPRRSVACEKILEEEKVHNLMTIGEYPLYMVPLDEDVLSFELDLAHKEWQVDGDASSLWHIAKAIHKLEFTFGLIPNVRAKGKASVRVAEILNRMQT********MNIPEINTLVLIDREVDMVTPMCSQLTYEGLVDEFLRINNGSVELDA*****************NSSDKLFKEIRDLNFEVVVQVLRQKATS***DYTEVTT***TVSELKDFVKKLNSLPEMTRHINLAQHLSTFTSKPSFLGQLDMEHTIIEAQSYDICFEYIEEMIHKQEPLNKVLRLLILFSVTNSGLPKKQFDYLRRELLHSYGFEHMATLNNLEKAGLFKKQETKSNWQLVKRALQLVEDTDTANPNDISYVFSGYAPLSIRLVQNAIRSGWRPMEEILKLLPG********************************RRSLVLVVFVGGVTFAEISALRFLSAQEGMAYDVIVGTTKIISGNSLAETFSE***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAQIPNLDNAPLNLKSIREQSQRDLVNILKNIRGKKCLVIDPKLSGSLSLIVPTSTLKEYGIELRLLSAEPVQTDCAKVVYFVGPQFISMRFISSHVHDDASKGLQREYFLYFVPRRSVACEKILEEEKVHNLMTIGEYPLYMVPLDEDVLSFELDLAHKEWQVDGDASSLWHIAKAIHKLEFTFGLIPNVRAKGKASVRVAEILNRMQTEEPVSLSDMNIPEINTLVLIDREVDMVTPMCSQLTYEGLVDEFLRINNGSVELDASIMGAQQQDGKKMKVPLNSSDKLFKEIRDLNFEVVVQVLRQKATSMKQDYTEVTTMSQTVSELKDFVKKLNSLPEMTRHINLAQHLSTFTSKPSFLGQLDMEHTIIEAQSYDICFEYIEEMIHKQEPLNKVLRLLILFSVTNSGLPKKQFDYLRRELLHSYGFEHMATLNNLEKAGLFKKQETKSNWQLVKRALQLVEDTDTANPNDISYVFSGYAPLSIRLVQNAIRSGWRPMEEILKLLPGPHYETKRGGFSSSPSFDMSQGLSSSIDKVGDGRRSLVLVVFVGGVTFAEISALRFLSAQEGMAYDVIVGTTKIISGNSLAETFSENLG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Vacuolar protein sorting-associated protein 33 homolog Involved in the vesicle trafficking. Binds syntaxins.confidentQ94KJ7
Vacuolar protein sorting-associated protein 33A May play a role in vesicle-mediated protein trafficking to lysosomal compartments and in membrane docking/fusion reactions of late endosomes/lysosomes.probableQ9D2N9
Vacuolar protein sorting-associated protein 33 Essential for vacuolar biogenesis, maturation and function. Involved in the sorting of vacuolar proteins from the Golgi apparatus and their targeting to the vacuole.probableQ9P7V6

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2XHE, chain A
Confidence level:very confident
Coverage over the Query: 16-511,543-594
View the alignment between query and template
View the model in PyMOL
Template: 1MQS, chain A
Confidence level:very confident
Coverage over the Query: 14-263,274-443,457-466,485-593
View the alignment between query and template
View the model in PyMOL