Citrus Sinensis ID: 007668


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590----
MGMYQIKCRGQWLLFILLLCIIINKSRAINSDGEALLSFRTAVVSSDGFLNQWRPEDPDPCNWKGVKCDKNKRVITLSLTNHKLSGPISADLGKLDQLKFLNLHSNNFYGEIPSELGNCTELQGLSLQSNYLSGSIPSELGNLSNLLNLDISSNSLSDYIPPSLGKLQRLITFNVSNNFLVGAIPSDGVLTKFSESSFFGNRGLCGKQINVTCKNDSGGSTTDSQSPNSAQNQGGKKNSGRLLISASATVGALLLVALMCFWGCFLYKKLGKNESKGLARDVGGGASIVMFHGDLPYSSKDIIKKLETLDDDHIIGSGGFGTVYKLAMDDGNVFALKRIDKLNEGFDRFFERELEILGSIKHRYLVNLRGYCNSPTSKLLIYDFLPGGSLDEALHERSEQLDWDARLNIIMGAAKGLAYLHHDCSPRIIHRDIKSSNILLDGNLEARVSDFGLAKLLEDEESHITTIVAGTFGYLAPEYMQSGRATEKTDVYSFGVLVLEVLSGKRPTDASFIEKGLNIVGWLNFLISEDRQREIIDPNCEGVQSESLDALLAVATQCVSSSPDDRPTMHRVVQILESEVMTPCPSDFYDSNSD
cccccHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHccccccccccccccccccccccCEECcccccEEEEEccccccECcccccccccccccccccccccccccccccccccccccEEEcccccccccccHHHHcccccccEEcccccccccccccccccccccEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccEEEEcccccccHHHHHHHHcccccccEEECcccccEEEEEcccccEEEEEEEcccccccHHHHHHHHHHHHcccccccccccCEECcccccEEEEcccccccHHHHHHcccccccHHHHHHHHHHHHHHHHcccccccccccccccccccEEEcccccEEEcccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHccccccccccccccccHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHcccccccccccHHHHHHHHHccccccccccccccccc
***YQIKCRGQWLLFILLLCIIINKSRAINSDGEALLSFRTAVVSSDGFLNQWRPEDPDPCNWKGVKCDKNKRVITLSLTNHKLSGPISADLGKLDQLKFLNLHSNNFYGEIPSELGNCTELQGLSLQSNYLSGSIPSELGNLSNLLNLDISSNSLSDYIPPSLGKLQRLITFNVSNNFLVGAIPSDGVLTKFSESSFFGNRGLCGKQINVTC****************************LLISASATVGALLLVALMCFWGCFLYKKLG***SKGLARDVGGGASIVMFHGDLPYSSKDIIKKLETLDDDHIIGSGGFGTVYKLAMDDGNVFALKRIDKLNEGFDRFFERELEILGSIKHRYLVNLRGYCNSPTSKLLIYDFLPGGSLDEALHERSEQLDWDARLNIIMGAAKGLAYLHHDCSPRIIHRDIKSSNILLDGNLEARVSDFGLAKLLEDEESHITTIVAGTFGYLAPEYMQSGRATEKTDVYSFGVLVLEVLSGKRPTDASFIEKGLNIVGWLNFLISEDRQREIIDPNCEGVQSESLDALLAVATQCVSSSPDDRPTMHRVVQI*******************
xxxxxxxxHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGMYQIKCRGQWLLFILLLCIIINKSRAINSDGEALLSFRTAVVSSDGFLNQWRPEDPDPCNWKGVKCDKNKRVITLSLTNHKLSGPISADLGKLDQLKFLNLHSNNFYGEIPSELGNCTELQGLSLQSNYLSGSIPSELGNLSNLLNLDISSNSLSDYIPPSLGKLQRLITFNVSNNFLVGAIPSDGVLTKFSESSFFGNRGLCGKQINVTCKNDSGGSTTDSQSPNSAQNQGGKKNSGRLLISASATVGALLLVALMCFWGCFLYKKLGKNESKGLARDVGGGASIVMFHGDLPYSSKDIIKKLETLDDDHIIGSGGFGTVYKLAMDDGNVFALKRIDKLNEGFDRFFERELEILGSIKHRYLVNLRGYCNSPTSKLLIYDFLPGGSLDEALHERSEQLDWDARLNIIMGAAKGLAYLHHDCSPRIIHRDIKSSNILLDGNLEARVSDFGLAKLLEDEESHITTIVAGTFGYLAPEYMQSGRATEKTDVYSFGVLVLEVLSGKRPTDASFIEKGLNIVGWLNFLISEDRQREIIDPNCEGVQSESLDALLAVATQCVSSSPDDRPTMHRVVQILESEVMTPCPSDFYDSNSD

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
LRR receptor-like serine/threonine-protein kinase FEI 1 Involved in the signaling pathway that regulates cell wall function, including cellulose biosynthesis, likely via an 1-aminocyclopropane-1-carboxylic acid (ACC)-mediated signal (a precursor of ethylene).confidentC0LGF4
LRR receptor-like serine/threonine-protein kinase FEI 2 Involved in the signaling pathway that regulates cell wall function, including cellulose biosynthesis, likely via an 1-aminocyclopropane-1-carboxylic acid (ACC)-mediated signal (a precursor of ethylene).probableC0LGL9

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
2.-.-.-Transferases.probable
2.7.-.-Transferring phosphorous-containing groups.probable
2.7.11.-Protein-serine/threonine kinases.probable
2.7.11.1Transferred entry: 2.7.11.19.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1ZIW, chain A
Confidence level:very confident
Coverage over the Query: 71-204
View the alignment between query and template
View the model in PyMOL
Template: 3RGZ, chain A
Confidence level:very confident
Coverage over the Query: 27-202
View the alignment between query and template
View the model in PyMOL
Template: 3QD2, chain B
Confidence level:very confident
Coverage over the Query: 306-574
View the alignment between query and template
View the model in PyMOL
Template: 3UIM, chain A
Confidence level:very confident
Coverage over the Query: 295-583
View the alignment between query and template
View the model in PyMOL
Template: 3SAY, chain A
Confidence level:probable
Coverage over the Query: 285-594
View the alignment between query and template
View the model in PyMOL
Template: 3FXI, chain A
Confidence level:probable
Coverage over the Query: 76-187
View the alignment between query and template
View the model in PyMOL
Template: 2KS1, chain B
Confidence level:probable
Coverage over the Query: 244-271
View the alignment between query and template
View the model in PyMOL