BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 007697
(592 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|4IFQ|A Chain A, Crystal Structure Of Saccharomyces Cerevisiae Nup192,
Residues 2 To 960 [scnup192(2-960)]
Length = 970
Score = 30.4 bits (67), Expect = 3.0, Method: Compositional matrix adjust.
Identities = 20/71 (28%), Positives = 38/71 (53%), Gaps = 5/71 (7%)
Query: 20 IAQLPSIISARKEYSTASQKNVSPKPGPTGKPPESGSNFSPIIFGATVVVGVGLIAYQNG 79
I+ S + R+++S ++ ++ T E G N +IF ++++ VG + YQ
Sbjct: 571 ISNFNSSLHKRQQFSESTHNDIDS----TAVALEEGLNEEAVIFLSSLLTLVGSVTYQ-V 625
Query: 80 DEEPKTSISAV 90
DE+ K+S+S V
Sbjct: 626 DEDVKSSLSKV 636
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.311 0.127 0.344
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 13,451,437
Number of Sequences: 62578
Number of extensions: 503082
Number of successful extensions: 1079
Number of sequences better than 100.0: 6
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 5
Number of HSP's that attempted gapping in prelim test: 1078
Number of HSP's gapped (non-prelim): 6
length of query: 592
length of database: 14,973,337
effective HSP length: 104
effective length of query: 488
effective length of database: 8,465,225
effective search space: 4131029800
effective search space used: 4131029800
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 54 (25.4 bits)