BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 007697
         (592 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|4IFQ|A Chain A, Crystal Structure Of Saccharomyces Cerevisiae Nup192,
           Residues 2 To 960 [scnup192(2-960)]
          Length = 970

 Score = 30.4 bits (67), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 20/71 (28%), Positives = 38/71 (53%), Gaps = 5/71 (7%)

Query: 20  IAQLPSIISARKEYSTASQKNVSPKPGPTGKPPESGSNFSPIIFGATVVVGVGLIAYQNG 79
           I+   S +  R+++S ++  ++      T    E G N   +IF ++++  VG + YQ  
Sbjct: 571 ISNFNSSLHKRQQFSESTHNDIDS----TAVALEEGLNEEAVIFLSSLLTLVGSVTYQ-V 625

Query: 80  DEEPKTSISAV 90
           DE+ K+S+S V
Sbjct: 626 DEDVKSSLSKV 636


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.311    0.127    0.344 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 13,451,437
Number of Sequences: 62578
Number of extensions: 503082
Number of successful extensions: 1079
Number of sequences better than 100.0: 6
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 5
Number of HSP's that attempted gapping in prelim test: 1078
Number of HSP's gapped (non-prelim): 6
length of query: 592
length of database: 14,973,337
effective HSP length: 104
effective length of query: 488
effective length of database: 8,465,225
effective search space: 4131029800
effective search space used: 4131029800
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 54 (25.4 bits)