Citrus Sinensis ID: 007728


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-
MTSDFALSSPLVPRVSEKDAKALQYIEEITRNAATFQETVLAEILSRNANSEYLQRYKLGGATDRETFKLKLPVITYEDIKPDIQRMADGDRSAVLLASPISEFLKSSGTSSGEQKLFPSTQEELDRRHFQISLLRAVMNRCVPDLDKGKGLYFLFVRPETRTPGGLLVRPASNSMYKSDHFKTRLHDYTSPIEAILCADSFQSMYTHMLCGLLEREQVLRLGALFASGLLRAMRFLQIHWQALANDIETGTLNQKITDPSIRDCMARILKPRPELAELIRMECSEENWEGIIARIWPNTKYLDAVATGSMAQYIHLLDYYSGSLPIASMLYSSSECFFGLNLNPMCKTSEASYTIMPNMAYFEFLLHDPGSPASTSDFQPPKLVDLVDVEVGKEYEPIITNYTGVYRYKVGDILRVAGFHNASPHFHFVRRKDALLSIDYDKTDEADLQKAVENASRLLREFDTRILEYTSYAEKKTNPGHHVIYWEILVKDPANSPTDDVLKQCCLAMEESLDSAYREARVVDKTIGPLEIRLVKTGTFEELMDYAISRGASINQYKVARCVGSTSILKLLDSRVISKHFSPSLPHWTT
ccccccccccccHccccHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHccccHHHHHccccccccHHHHHcccccccccccHHHHHHHHccccccccccccccEEEccccccccccccccccHHHHHHHHHHHHHHHHHHHccccccccccEEEEEEccccccccccCECcccccccccccHHHccccccccccHHHHccccHHHHHHHHHHcccccccEEEEEEEcHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHccccHHHHHHHHHHHHHccccccccccccccEEEEEEccccHHHHHHHHHHHcccccEEccccccccCEEEEEccccccccccEEEEcccccEEEEEEccccccccccccccccCEEccccccccEEEEEEEccccccccccccEEEEcCECccccEEEEEEEcccccccECccccHHHHHHHHHHHHHHHHHcccEEEEEEEECcccccccCEEEEEEEECccccccccHHHHHHHHHHHHHHccHHHHHHHHcccccccEEEEEccccHHHHHHHHHHHcccccccccccEEEccHHHHHHHHHcccccccccccccccc
*********PLVPRVSEKDAKALQYIEEITRNAATFQETVLAEILSRNANSEYLQRYKLGGATDRETFKLKLPVITYEDIKPDIQRMADGDRSAVLLASPIS***************FPSTQEELDRRHFQISLLRAVMNRCVPDLDKGKGLYFLFVRPETRTPGGLLVRPASNSMYKSDHFKTRLHDYTSPIEAILCADSFQSMYTHMLCGLLEREQVLRLGALFASGLLRAMRFLQIHWQALANDIETGTLNQKITDPSIRDCMARILKPRPELAELIRMECSEENWEGIIARIWPNTKYLDAVATGSMAQYIHLLDYYSGSLPIASMLYSSSECFFGLNLNPMCKTSEASYTIMPNMAYFEFLLHDPGSPASTSDFQPPKLVDLVDVEVGKEYEPIITNYTGVYRYKVGDILRVAGFHNASPHFHFVRRKDALLSIDYDKTDEADLQKAVENASRLLREFDTRILEYTSYAEKKTNPGHHVIYWEILVKDPANSPTDDVLKQCCLAMEESLDSAYREARVVDKTIGPLEIRLVKTGTFEELMDYAISRGASINQYKVARCVGSTSILKLLDSRVISKHFSPSLPH***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTSDFALSSPLVPRVSEKDAKALQYIEEITRNAATFQETVLAEILSRNANSEYLQRYKLGGATDRETFKLKLPVITYEDIKPDIQRMADGDRSAVLLASPISEFLKSSGTSSGEQKLFPSTQEELDRRHFQISLLRAVMNRCVPDLDKGKGLYFLFVRPETRTPGGLLVRPASNSMYKSDHFKTRLHDYTSPIEAILCADSFQSMYTHMLCGLLEREQVLRLGALFASGLLRAMRFLQIHWQALANDIETGTLNQKITDPSIRDCMARILKPRPELAELIRMECSEENWEGIIARIWPNTKYLDAVATGSMAQYIHLLDYYSGSLPIASMLYSSSECFFGLNLNPMCKTSEASYTIMPNMAYFEFLLHDPGSPASTSDFQPPKLVDLVDVEVGKEYEPIITNYTGVYRYKVGDILRVAGFHNASPHFHFVRRKDALLSIDYDKTDEADLQKAVENASRLLREFDTRILEYTSYAEKKTNPGHHVIYWEILVKDPANSPTDDVLKQCCLAMEESLDSAYREARVVDKTIGPLEIRLVKTGTFEELMDYAISRGASINQYKVARCVGSTSILKLLDSRVISKHFSPSLPHWTT

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable indole-3-acetic acid-amido synthetase GH3.1 Catalyzes the synthesis of indole-3-acetic acid (IAA)-amino acid conjugates, providing a mechanism for the plant to cope with the presence of excess auxin.probableO82333
Probable indole-3-acetic acid-amido synthetase GH3.8 May catalyze the synthesis of indole-3-acetic acid (IAA)-amino acid conjugates, providing a mechanism for the plant to cope with the presence of excess auxin.probableQ0D4Z6
Probable indole-3-acetic acid-amido synthetase GH3.8 May catalyze the synthesis of indole-3-acetic acid (IAA)-amino acid conjugates, providing a mechanism for the plant to cope with the presence of excess auxin.probableA3BLS0

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 4B2G, chain A
Confidence level:very confident
Coverage over the Query: 16-543,560-590
View the alignment between query and template
View the model in PyMOL