Citrus Sinensis ID: 007763


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590
MESEDEFDMQDANASAEEDDFYSGGDDDAAPAYAFDSDDADVADYEFIDNDSDDSDDLVSNRHQLNYTVLTEADIRQRQEEDITRISTVLSISKVAASILLRFYNWSVSKVHDEWFADEERVRKAVGLLEKPAVQFPDGEEMTCGICFENYPSDRLLAAACGHPFCSSCWTAINDGPGCLMLRCPDPSCGAAVGQDMIYLLSSDEDKVKYNRYFIRSYVEDNRKTKWCPAPGCDYAVDFVVGSGNYDVTCRCSYSFCWNCTEEAHRPVDCDTVAKWVLKNSAESENMNWILANSKPCPRCKRPIEKNQGCMHMTCTPPCKFEFCWLCLGQWSDHGERTGGFYACNRYETAKQEGVYDESEKRREMAKNSLERYTHYYERWATNQSSRQKALADLQQMQTVHLEKLSDVQCQPESQLKFITEAWLQIVECRRVLKWTYAYGYYLPDHEHAKRQFFEYLQGEAESGLERLHQCAEKELQIYLNADGPSKDFNEFRTKLAGLTSVTRNYFENLVRALENGLSDVDTHATCSRTGSSKSLGGTSRGRSGKNKGSTSRSSGSNKNIDDSSHWYCDQCTYANVNSATACAMCQHSR
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHcccccccccEECcHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHccccHHHHHHHHHccHHHHHHHHcccccccccccccccCEcccccccccccccccccccccccHHHHHHHHccccccccccccccccccccHHHHHHcccHHHHHHHHHHHHHHHHcccccccccccccccccEEEcccccccccccccccEEEccccccccccccccHHHHHHHHHHHHHHcHHHHHccccccccccccEECccccccEEEcccccccccccccccccccccccccccccccccHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHcccccccc
***********************************DSDDADVADYEFIDND***********HQLNYTVLTEADIRQRQEEDITRISTVLSISKVAASILLRFYNWSVSKVHDEWFADEERVRKAVGLLEKPAVQFPDGEEMTCGICFENYPSDRLLAAACGHPFCSSCWTAINDGPGCLMLRCPDPSCGAAVGQDMIYLLSSDEDKVKYNRYFIRSYVEDNRKTKWCPAPGCDYAVDFVVGSGNYDVTCRCSYSFCWNCTEEAHRPVDCDTVAKWVLKNSAESENMNWILANSKPCPRCKRPIEKNQGCMHMTCTPPCKFEFCWLCLGQWSDHGERTGGFYACNRYETAK******************LERYTHYYERWATNQSSRQKALADL****TVHLEKLSDVQCQPESQLKFITEAWLQIVECRRVLKWTYAYGYYLPDHEHAKRQFFEYLQGEAESGLERLHQCAEKELQIYLNADGPSKDFNEFRTKLAGLTSVTRNYFENLVRALENGLSD*********************************************HWYCDQCTYANVNSATACAMCQH**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MESEDEFDMQDANASAEEDDFYSGGDDDAAPAYAFDSDDADVADYEFIDNDSDDSDDLVSNRHQLNYTVLTEADIRQRQEEDITRISTVLSISKVAASILLRFYNWSVSKVHDEWFADEERVRKAVGLLEKPAVQFPDGEEMTCGICFENYPSDRLLAAACGHPFCSSCWTAINDGPGCLMLRCPDPSCGAAVGQDMIYLLSSDEDKVKYNRYFIRSYVEDNRKTKWCPAPGCDYAVDFVVGSGNYDVTCRCSYSFCWNCTEEAHRPVDCDTVAKWVLKNSAESENMNWILANSKPCPRCKRPIEKNQGCMHMTCTPPCKFEFCWLCLGQWSDHGERTGGFYACNRYETAKQEGVYDESEKRREMAKNSLERYTHYYERWATNQSSRQKALADLQQMQTVHLEKLSDVQCQPESQLKFITEAWLQIVECRRVLKWTYAYGYYLPDHEHAKRQFFEYLQGEAESGLERLHQCAEKELQIYLNADGPSKDFNEFRTKLAGLTSVTRNYFENLVRALENGLSDVDTHATCSRTGSSKSLGGTSRGRSGKNKGSTSRSSGSNKNIDDSSHWYCDQCTYANVNSATACAMCQHSR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable E3 ubiquitin-protein ligase ARI8 Might act as an E3 ubiquitin-protein ligase, or as part of E3 complex, which accepts ubiquitin from specific E2 ubiquitin-conjugating enzymes and then transfers it to substrates.confidentQ8W468
Probable E3 ubiquitin-protein ligase ARI7 Might act as an E3 ubiquitin-protein ligase, or as part of E3 complex, which accepts ubiquitin from specific E2 ubiquitin-conjugating enzymes and then transfers it to substrates.probableQ84RR0
Probable E3 ubiquitin-protein ligase rbrA Might act as an E3 ubiquitin-protein ligase. Appears to be required for normal cell-type proportioning and cell sorting during multicellular development. In addition to being necessary for a normal percentage of prestalk cells and the organization of the slug, rbrA is also necessary for spore cell viability.probableQ6T486

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1WD2, chain A
Confidence level:very confident
Coverage over the Query: 289-349
View the alignment between query and template
View the model in PyMOL
Template: 4AP4, chain A
Confidence level:confident
Coverage over the Query: 139-203,222-263,276-279,294-307
View the alignment between query and template
View the model in PyMOL
Template: 1WIM, chain A
Confidence level:confident
Coverage over the Query: 139-222
View the alignment between query and template
View the model in PyMOL
Template: 3K1L, chain B
Confidence level:probable
Coverage over the Query: 66-86,103-197
View the alignment between query and template
View the model in PyMOL
Template: 2DAL, chain A
Confidence level:probable
Coverage over the Query: 78-119
View the alignment between query and template
View the model in PyMOL
Template: 2D9G, chain A
Confidence level:probable
Coverage over the Query: 561-590
View the alignment between query and template
View the model in PyMOL
Template: 3GJ8, chain B
Confidence level:probable
Coverage over the Query: 566-590
View the alignment between query and template
View the model in PyMOL