Citrus Sinensis ID: 007815


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------59
MRLTLGSLKMLEKMETVDVDELIEEFETITKDAERIQRETLRKILEENASAEYLQNLGLNGRTDPESFKSCVPLVTHEDLQPYIQRIIDGDISPILTGKPITTISRSSGTTQGKPKFLPFNDELMETTLQIFRTSYAFRNREFPIGKGKALQFIYGSKQSKTKGGLNAGTATTNVYRSSTFKAEMKAMQSQCCSPDEVIFGPDFHQSLYCHLLCGLIFREEIQLVFSTFAHSLVHAFRTFELVWEELCDDIREGVLSSRITVPSIRAAMSKILKPNPELADLIHKKCSGLSNWYGLIPELFPNAKYLSGIMTGSMEHYLKKLRHYAGDLPLMSADYGSSEGWIGANVNPSLPPELATFAVLPNIGYFEFIPQRLGNLESQVLCIEPKPVGLTEVKVGEEYEIIVTNVAGLYRYRLGDVVKVMGFHNSTPELKFICRRNLLLTINIDKNTEKDLQLSVDEAAQLLAEEKQEVVDFTSHVDLSTDPGHYVIFWEVSGEVNDEVLKECCNCLDRSFVDAGYVSARKVNAIGPLELRVVLKGTFQQILDHYLGLGAALSQFKTPRCVGPTNKTVLQILCNNIGKSYFSTAYG
cccccccHHccHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHcccccHHHHccccccccHHHHHHccccccccccHHHHHHHHccccccccccccccEEEccccccccccccccccHHHHHHHHHHHHHHHHHHHcccccccccEEEEEEccccccccccccccccccccccccHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHccccccEEEEEcHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHccccHHHHHHHHHHHcccccccccccccccccEEEEEEEcccHHHHHHHHHHHccccccccccccccccEEEEEccccccccccccccccccEEEEEEEccccccccccccccccCEcccccccccEEEEEEEccccEEEcccccEEEEEEECccccEEEEEEEcccEEEEEcccccHHHHHHHHHHHHHHHHHcccEEEEEEEEECcccccccEEEEEEEcccccHHHHHHHHHHHHHHcccccHHHHHccccccccEEEEEcccHHHHHHHHHHccccccccccccCECccccHHHHHHHHccccccccccccc
********KMLEKMETVDVDELIEEFETITKDAERIQRETLRKILEENASAEYLQNLGLNGRTDPESFKSCVPLVTHEDLQPYIQRIIDGDISPILTGKPITTISR*********KFLPFNDELMETTLQIFRTSYAFRNREFPIGKGKALQFIYGSKQSKTKGGLNAGTATTNVYRSSTFKAEMKAMQSQCCSPDEVIFGPDFHQSLYCHLLCGLIFREEIQLVFSTFAHSLVHAFRTFELVWEELCDDIREGVLSSRITVPSIRAAMSKILKPNPELADLIHKKCSGLSNWYGLIPELFPNAKYLSGIMTGSMEHYLKKLRHYAGDLPLMSADYGSSEGWIGANVNPSLPPELATFAVLPNIGYFEFIPQRLGNLESQVLCIEPKPVGLTEVKVGEEYEIIVTNVAGLYRYRLGDVVKVMGFHNSTPELKFICRRNLLLTINIDKNTEKDLQLSVDEAAQLLAEEKQEVVDFTSHVDLSTDPGHYVIFWEVSGEVNDEVLKECCNCLDRSFVDAGYVSARKVNAIGPLELRVVLKGTFQQILDHYLGLGAALSQFKTPRCVGPTNKTVLQILCNNIGKSYFS*A**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRLTLGSLKMLEKMETVDxxxxxxxxxxxxxxxxxxxxxTLRKILEENASAEYLQNLGLNGRTDPESFKSCVPLVTHEDLQPYIQRIIDGDISPILTGKPITTISRSSGTTQGKPKFLPFNDELMETTLQIFRTSYAFRNREFPIGKGKALQFIYGSKQSKTKGGLNAGTATTNVYRSSTFKAEMKAMQSQCCSPDEVIFGPDFHQSLYCHLLCGLIFREEIQLVFSTFAHSLVHAFRTFELVWEELCDDIREGVLSSRITVPSIRAAMSKILKPNPELADLIHKKCSGLSNWYGLIPELFPNAKYLSGIMTGSMEHYLKKLRHYAGDLPLMSADYGSSEGWIGANVNPSLPPELATFAVLPNIGYFEFIPQRLGNLESQVLCIEPKPVGLTEVKVGEEYEIIVTNVAGLYRYRLGDVVKVMGFHNSTPELKFICRRNLLLTINIDKNTxxxxxxxxxxxxxxxxxxxxxVVDFTSHVDLSTDPGHYVIFWEVSGEVNDEVLKECCNCLDRSFVDAGYVSARKVNAIGPLELRVVLKGTFQQILDHYLGLGAALSQFKTPRCVGPTNKTVLQILCNNIGKSYFSTAYG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable indole-3-acetic acid-amido synthetase GH3.5 May catalyze the synthesis of indole-3-acetic acid (IAA)-amino acid conjugates, providing a mechanism for the plant to cope with the presence of excess auxin.probableQ6I581
Jasmonic acid-amido synthetase JAR1 Catalyzes the synthesis of jasmonates-amino acid conjugates by adenylation; can use Ile and, in vitro at least, Val, Leu and Phe as conjugating amino acids on jasmonic acid (JA) and 9,10-dihydro-JA substrates, and to a lower extent, on 3-oxo-2-(2Z-pentenyl)-cyclopentane-1-butyric acid (OPC-4) and 12-hydroxy-JA (12-OH-JA). Can synthesize adenosine 5-tetraphosphate in vitro. Required for the JA-mediated signaling pathway that regulates many developmental and defense mechanisms, including growth root inhibition, vegetative storage proteins (VSPs) accumulation, induced systemic resistance (ISR), response to wounding and herbivores, tolerance to ozone O(3) (probably having a role in lesion containment). Plays an important role in the accumulation of JA-Ile in response to wounding, both locally and systemically; promotes JA responding genes especially in distal part of wounded plants, via the JA-Ile-stimulated degradation of JAZ repressor proteins by the SCF(COI)E3 ubiquitin-protein ligase pathway. Involved in the apoptosis-like programmed cell death (PCD) induced by fungal toxin fumonisin B1-mediated (FB1). Required for volatile compounds (C6-aldehydes and allo-ocimene)-mediated defense activation. Involved in the non-pathogenic rhizobacterium-mediated ISR (defense priming) by P.fluorescens (strains CHAOr and WCS417r) and P.putida LSW17S against infection leaf pathogens such as P.syringae pv. tomato and H.parasitica. Required for the JA-dependent resistance to fungi such as P.irregulare, U.vignae and U.appendiculatus. Necessary to induce systemic resistance against R.solanaceraum and P.syringae pv. tomato with P.oligandrum (a non-pathogenic biocontrol agent) cell wall protein fraction (CWP). Mediates PGIP2 accumulation in response to B.cinerea infection and thus contributes to resistance against this pathogen. Modulates the UV-B alteration of leaves attractiveness to diamondback moths P.xylostella leading to insect oviposition. Involved in the regulation of far-red light influence on development. Seems necessary for the salicylic acid (SA)-mediated, NPR1-independent resistance pathway. May contribute to the chitin-elicited pathway. Contributes to the sensitivity toward F.graminearum.probableQ9SKE2

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 4EPL, chain A
Confidence level:very confident
Coverage over the Query: 16-372,386-587
View the alignment between query and template
View the model in PyMOL