Citrus Sinensis ID: 007849

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------
MANSIEPSSSLSFTSSSHLSNGSISHNQSSFSAPEKGVNLEVFSLNKLSSSLEQLLIDSTCEYSDAEIIVEGIPVCVHRCILAARSKFFYELFKREKGSVDKEGKPKYPMSELLPYGKVGYEAFLIFLSYTYSGKLKPFPMEVSTCVDNICVHDACRPAINFAVEMMYASSIFELPELVSLFQRRLLNFVGKAVAEDIIPILLAAFHCQLSQLLAQCVDRIVRSDLDTISIEKELPTEVAEEIRMLRLKSFPDDENTAVEVDPLREKRIKRIHKALDSDDVELVRLLLSESEITLDEANALHYAAAYCDPKVLSEVLSLGLADVNLRSSRGYTVLHIGAMRKEPSVIVSLLTKGACASDLTLDGRSAVSICRRLTRPKDYQAKTEQGKETNKDRICIDVLEGEMRRNPMAGDAFITSHTLSDDLHMKLLYLENRVAFARLLFPTEAKLAMDIANTETTSEFSGFCASKGSSGNLREVDLNETPVMRNKRLRPRMEALMKTVEMGQRYFPLCSEVLDKFMEDDLQDLFFLENGTKEEQRVKRMRFIELKDDVQKAFTRDKAEISRSGLCSSSSSSSFKDGVKYKLGKL
cccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHcccccccccccEEEEcccEEEEEEEEEEcccHHHHHHHccccccccccccccccccccccccccHHHHHHHHHHHHHccccccccccccccccccccccccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHccccHHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHHcccHHHHHHHHHccccccccccHHHHHHHcccHHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccHHHHHcHHHHcccccccHHcccccccccHHHHHHHHHHHHHHHHHccccHHHHHHHHHccccccHHHHHcccccccccccccccccccHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHccccHHHccccccHHHHHHHHHHHHHHHHHHHHHHcccHHHHccccccccccccccccccccccccc
**************************************NLEVFSLNKLSSSLEQLLIDSTCEYSDAEIIVEGIPVCVHRCILAARSKFFYELFKR**************MSELLPYGKVGYEAFLIFLSYTYSGKLKPFPMEVSTCVDNICVHDACRPAINFAVEMMYASSIFELPELVSLFQRRLLNFVGKAVAEDIIPILLAAFHCQLSQLLAQCVDRIVRSDLDTISIEKELPTEVAEEIRMLRLKSFPDDENTAVEVDPLREKRIKRIHKALDSDDVELVRLLLSESEITLDEANALHYAAAYCDPKVLSEVLSLGLADVNLRSSRGYTVLHIGAMRKEPSVIVSLLTKGACASDLTLDGRSAVSICRRLTRPKDYQAKTEQGKETNKDRICIDVLEGEMRRNPMAGDAFITSHTLSDDLHMKLLYLENRVAFARLLFPTEAKLAMDIANTETTSEFSGFCASKGSSGNLREVDLNETPVMRNKRLRPRMEALMKTVEMGQRYFPLCSEVLDKFMEDDLQDLFFLENGT******KRMRFIELKDDVQKAFTRD*****************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MANSIEPSSSLSFTSSSHLSNGSISHNQSSFSAPEKGVNLEVFSLNKLSSSLEQLLIDSTCEYSDAEIIVEGIPVCVHRCILAARSKFFYELFKREKGSVDKEGKPKYPMSELLPYGKVGYEAFLIFLSYTYSGKLKPFPMEVSTCVDNICVHDACRPAINFAVEMMYASSIFELPELVSLFQRRLLNFVGKAVAEDIIPILLAAFHCQLSQLLAQCVDRIVRSDLDTISIEKELPTEVAEEIRMLRLKSFPDDENTAVEVDPLREKRIKRIHKALDSDDVELVRLLLSESEITLDEANALHYAAAYCDPKVLSEVLSLGLADVNLRSSRGYTVLHIGAMRKEPSVIVSLLTKGACASDLTLDGRSAVSICRRLTRPKDYQAKTEQGKETNKDRICIDVLEGEMRRNPMAGDAFITSHTLSDDLHMKLLYLENRVAFARLLFPTEAKLAMDIANTETTSEFSGFCASKGSSGNLREVDLNETPVMRNKRLRPRMEALMKTVEMGQRYFPLCSEVLDKFMEDDLQDLFFLENGTKEEQRVKRMRFIELKDDVQKAFTRDKAEISRSGLCSSSSSSSFKDGVKYKLGKL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Regulatory protein NPR3 May act as a substrate-specific adapter of an E3 ubiquitin-protein ligase complex (CUL3-RBX1-BTB) which mediates the ubiquitination and subsequent proteasomal degradation of target proteins (By similarity). Involved in the regulation of basal defense responses against pathogens.probableQ8L746

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1N11, chain A
Confidence level:very confident
Coverage over the Query: 145-391
View the alignment between query and template
View the model in PyMOL
Template: 3HTM, chain A
Confidence level:very confident
Coverage over the Query: 46-140,161-225
View the alignment between query and template
View the model in PyMOL
Template: 2DVW, chain A
Confidence level:probable
Coverage over the Query: 296-364,375-471
View the alignment between query and template
View the model in PyMOL