BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 007852
         (587 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1H3O|B Chain B, Crystal Structure Of The Human Taf4-Taf12
           (Tafii135-Tafii20) Complex
 pdb|1H3O|D Chain D, Crystal Structure Of The Human Taf4-Taf12
           (Tafii135-Tafii20) Complex
          Length = 76

 Score = 91.7 bits (226), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 41/73 (56%), Positives = 58/73 (79%)

Query: 427 ATNQLLGKRKIQDLVSQVDSQGKVDPEVEDLLLEIADDFIDSVTSFACNLAKHRKSSTLE 486
            ++ +L K+K+QDLV +VD   ++D +VE+ LL+IADDFI+SV + AC LA+HRKSSTLE
Sbjct: 1   GSHXVLTKKKLQDLVREVDPNEQLDEDVEEXLLQIADDFIESVVTAACQLARHRKSSTLE 60

Query: 487 SKDILLHLEKNWH 499
            KD+ LHLE+ W+
Sbjct: 61  VKDVQLHLERQWN 73


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.311    0.125    0.349 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 11,481,473
Number of Sequences: 62578
Number of extensions: 349307
Number of successful extensions: 668
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 665
Number of HSP's gapped (non-prelim): 3
length of query: 587
length of database: 14,973,337
effective HSP length: 104
effective length of query: 483
effective length of database: 8,465,225
effective search space: 4088703675
effective search space used: 4088703675
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 54 (25.4 bits)