BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 007864
         (587 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3L1M|A Chain A, Crystal Structure Of A Ni-Directed Dimer Of Cytochrome
          Cb562 Quinolate-Histidine Hybrid Coordination Motif
          Length = 106

 Score = 30.4 bits (67), Expect = 2.7,   Method: Composition-based stats.
 Identities = 20/50 (40%), Positives = 25/50 (50%), Gaps = 4/50 (8%)

Query: 26 SAATIKDEYCSTRTAKAIALKFTPPAPIDEQPLMGLHGYDFRH---ILLC 72
          +AA +KD     R A   A K TPP   D+ P      +DFRH   IL+C
Sbjct: 22 NAAQVKDALTKMRAAALDAQKATPPKLEDKSP-DSPEMWDFRHGFDILVC 70


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.324    0.137    0.426 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 16,630,967
Number of Sequences: 62578
Number of extensions: 659493
Number of successful extensions: 1538
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 1538
Number of HSP's gapped (non-prelim): 2
length of query: 587
length of database: 14,973,337
effective HSP length: 104
effective length of query: 483
effective length of database: 8,465,225
effective search space: 4088703675
effective search space used: 4088703675
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.5 bits)
S2: 54 (25.4 bits)