Citrus Sinensis ID: 007879


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580------
MDSGFIFEPPSDEEIEELQSEYEEDQGEEVDVEKPSKRAKQSPWDFAAYSESVSDEHFRRRTTSVDFKITKSLQQRSVPIVDNDHSDSEFDQHEDYKPEDEDDFSNAGDTKSFFAPADGASFHANSFMELNLSRPLLRACEALGYSKPTPIQAACIPLALTGRDICGSAITGSGKTAAFALPTLERLLYRPKRIPAIRVLILTPTRELAVQVHSMIEKIAQFTDIRCCLVVGGLSTKMQETALRSMPDIVVATPGRMIDHLRNSMSVDLDDLAVLILDEADRLLELGFSAEIHELVRLCPKRRQTMLFSATLTEDVDELIKLSLTKPLRLSADPSAKRPSTLTEEVVRIRRMREVNQEAVLLSLCSKTFTSKVIIFSGTKQAAHRLKILFGLAALKAAELHGNLTQAQRLEALELFRKQHVDFLIATDVAARGLDIIGVQTVINYACPRDLTSYVHRVGRTARAGREGYAVTFVTDNDRSLLKAIAKRAGSKLKSRIVAEQSITKWSKIIEQMEDQVAAILQEEREERILRKAEMEATKAENMIAHKEEIFARPKRTWFVTEKEKKLAVKADKVILIIYINVWDDY
ccccccccccccHHHHHccccccccccccccccccccccccccccccccccccccHcccccccccHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHcccccccHHHHHHHHHHHccccEEEEcccccHHHHHcHHHHHHHHHcccccccccEEEEEcccHHHHHHHHHHHHHHHccccccEEEEEccccHHHHHHHHHccccEEEEcccHHHHHHccccccccccccEEEEEccccccccccHHHHHHHHHHcccccccccEEccccHHHHHHHHHHcccccEEEEccccccccccEEEEEEEcccccccHHHHHHHHHccccccEEEEEEccccHHHHHHHHHHHccccEEcccccccHHHHHHHHHHHHcccccEEEEEcccccccccccccEEEEcccccccccccccccccccccccccEEEEEcHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHcccEEEEEEEEcccc
**SGFIFEPP*************************************************************************************************************ASFHANSFMELNLSRPLLRACEALGYSKPTPIQAACIPLALTGRDICGSAITGSGKTAAFALPTLERLLYRPKRIPAIRVLILTPTRELAVQVHSMIEKIAQFTDIRCCLVVGGLSTKMQETALRSMPDIVVATPGRMIDHLRNSMSVDLDDLAVLILDEADRLLELGFSAEIHELVRLCPKRRQTMLFSATLTEDVDELIKLSLTKPLRLSADPSAKRPSTLTEEVVRIRRMREVNQEAVLLSLCSKTFTSKVIIFSGTKQAAHRLKILFGLAALKAAELHGNLTQAQRLEALELFRKQHVDFLIATDVAARGLDIIGVQTVINYACPRDLTSYVHRVGRTARAGREGYAVTFVTDNDRSLLKAIAKRAGSKLKSRIVAEQSITKWSKIIEQMEDQVAAIL**********************IAHKEEIFARPKRTWFVTEKEKKLAVKADKVILIIYINVWDDY
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDSGFIFEPPSDEEIEELQSEYEEDQGEEVDVEKPSKRAKQSPWDFAAYSESVSDEHFRRRTTSVDFKITKSLQQRSVPIVDNDHSDSEFDQHEDYKPEDEDDFSNAGDTKSFFAPADGASFHANSFMELNLSRPLLRACEALGYSKPTPIQAACIPLALTGRDICGSAITGSGKTAAFALPTLERLLYRPKRIPAIRVLILTPTRELAVQVHSMIEKIAQFTDIRCCLVVGGLSTKMQETALRSMPDIVVATPGRMIDHLRNSMSVDLDDLAVLILDEADRLLELGFSAEIHELVRLCPKRRQTMLFSATLTEDVDELIKLSLTKPLRLSADPSAKRPSTLTEEVVRIRRMREVNQEAVLLSLCSKTFTSKVIIFSGTKQAAHRLKILFGLAALKAAELHGNLTQAQRLEALELFRKQHVDFLIATDVAARGLDIIGVQTVINYACPRDLTSYVHRVGRTARAGREGYAVTFVTDNDRSLLKAIAKRAGSKLKSRIVAEQSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxFARPKRTWFVTEKEKKLAVKADKVILIIYINVWDDY

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
DEAD-box ATP-dependent RNA helicase 28 probableQ9ZRZ8
DEAD-box ATP-dependent RNA helicase 28 probableQ0INC5
ATP-dependent RNA helicase drs1 ATP-binding RNA helicase involved in ribosome assembly.probableQ09903

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
3.-.-.-Hydrolases.probable
3.6.-.-Acting on acid anhydrides.probable
3.6.4.-Acting on acid anhydrides; involved in cellular and subcellular movement.probable
3.6.4.13RNA helicase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3BER, chain A
Confidence level:very confident
Coverage over the Query: 123-332
View the alignment between query and template
View the model in PyMOL
Template: 3EIQ, chain A
Confidence level:very confident
Coverage over the Query: 123-497
View the alignment between query and template
View the model in PyMOL
Template: 3LVG, chain D
Confidence level:probable
Coverage over the Query: 495-506,522-572
View the alignment between query and template
View the model in PyMOL