Citrus Sinensis ID: 007919


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-----
MSSQVKGKTVSNALTTEYEENLPLSSSYENAMQALSSLITRQKRGEQSHIAGRYGKLQRMSMYLKILGLEDRIAELKVIHVSGTKGKGSTCTFCEAILRECGFRTGLFTSPHLIDVRERFRINGLDITEDKFLFYFWECWHLLRENVTEDLPMPPLFQFLTVLAFKIFVCEQVDVAIIEVGLGGEKDSTNVIKEPVVCGVTSLGMDHMELLGNTLNDIAFHKAGIFKPQIPAFTVPQLSEAMSVLQDRALELMVPLEVAAPLDIEKLKRLELSLSGDHQLVNAGLAVSLSECWLRRTGNWEKVSHNDGQGADLPDAFVRGLSTAHLLGRAQIVYDISLVPNSSGLFENSSGELIFYLDGAHTAESMEACAKWFSSVVKGSGNSSLSSMSSTTKTNNMEEVVQRNGYIGHKMEKTKHANKISKQILLFNCMEARHPQVLLPRLVSTCASSGTHFSKALFVPSVSTYSKVTSGSSFIPLAISGKDLSWQFSLQRLWERIIHGADPVLEKSSMKESTEILPPCKFLYEDAPLCSPAEECFACSAVIPSLPLTIKWLRDSVQENPSIRVQVLVTGSLHLVGDVLKLLKR
cccccccccccccccccccccccccccHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHccccccccccEEEEcccccccHHHHHHHHHHHHccccEEEccccccccccEEEEEccccccHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHccccEEEEEEcccccccccccccccEEEEEccccHHHHHHHcccHHHHHHcccccccccccEEECcccHHHHHHHHHHHHHHcccEEEEcccccccccccccccccHHHHHcHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHcccccEEEEEccccccccccccccccccccEEEEEccccHHHHHHHHHHHHHHcccccccEEEEEcccccccHHHHHHHHccccEEEEccccccccccccHHcccccccccHHHHHHHHHHHHHcccccccEEEEccccccccccccccccccccccHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHcccccccEEEEEEccHHHHHHHHHHHcc
*****************************NAMQALSSLITRQK******IAGRYGKLQRMSMYLKILGLEDRIAELKVIHVSGTKGKGSTCTFCEAILRECGFRTGLFTSPHLIDVRERFRINGLDITEDKFLFYFWECWHLLRENVTEDLPMPPLFQFLTVLAFKIFVCEQVDVAIIEVGLGGEKDSTNVIKEPVVCGVTSLGMDHMELLGNTLNDIAFHKAGIFKPQIPAFTVPQLSEAMSVLQDRALELMVPLEVAAPLDIEKLKRLELSLSGDHQLVNAGLAVSLSECWLRRTGNWEKVSHNDGQGADLPDAFVRGLSTAHLLGRAQIVYDISLVPNSSGLFENSSGELIFYLDGAHTAESMEACAKWFSSVVKGSGNSSLSSMSSTTKTNNMEEVVQRNGYIGHKMEKTKHANKISKQILLFNCMEARHPQVLLPRLVSTCASSGTHFSKALFVPSVSTYSKVTSGSSFIPLAISGKDLSWQFSLQRLWERIIHGADP************************************SAVIPSLPLTIKWLRDSVQENPSIRVQVLVTGSLHLVGDVLKLLKR
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSSQVKGKTVSNALTTEYEENLPLSSSYENAMQALSSLITRQKRGEQSHIAGRYGKLQRMSMYLKILGLEDRIAELKVIHVSGTKGKGSTCTFCEAILRECGFRTGLFTSPHLIDVRERFRINGLDITEDKFLFYFWECWHLLRENVTEDLPMPPLFQFLTVLAFKIFVCEQVDVAIIEVGLGGEKDSTNVIKEPVVCGVTSLGMDHMELLGNTLNDIAFHKAGIFKPQIPAFTVPQLSEAMSVLQDRALELMVPLEVAAPLDIEKLKRLELSLSGDHQLVNAGLAVSLSECWLRRTGNWEKVSHNDGQGADLPDAFVRGLSTAHLLGRAQIVYDISLVPNSSGLFENSSGELIFYLDGAHTAESMEACAKWFSSVVKGSGNSSLSSMSSTTKTNNMEEVVQRNGYIGHKMEKTKHANKISKQILLFNCMEARHPQVLLPRLVSTCASSGTHFSKALFVPSVSTYSKVTSGSSFIPLAISGKDLSWQFSLQRLWERIIHGADPVLEKSSMKESTEILPPCKFLYEDAPLCSPAEECFACSAVIPSLPLTIKWLRDSVQENPSIRVQVLVTGSLHLVGDVLKLLKR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Folylpolyglutamate synthase Catalyzes conversion of folates to polyglutamate derivatives allowing concentration of folate compounds in the cell and the intracellular retention of these cofactors, which are important substrates for most of the folate-dependent enzymes that are involved in one-carbon transfer reactions involved in purine, pyrimidine and amino acid synthesis. Essential for organellar and whole-plant folate homeostasis.probableF4J2K2
Folylpolyglutamate synthase, mitochondrial Catalyzes conversion of folates to polyglutamate derivatives allowing concentration of folate compounds in the cell and the intracellular retention of these cofactors, which are important substrates for most of the folate-dependent enzymes that are involved in one-carbon transfer reactions involved in purine, pyrimidine and amino acid synthesis. Unsubstitued reduced folates are the preferred substrates. Metabolizes methotrexate (MTX) to polyglutamates.probableQ05932
Folylpolyglutamate synthase, mitochondrial Catalyzes conversion of folates to polyglutamate derivatives allowing concentration of folate compounds in the cell and the intracellular retention of these cofactors, which are important substrates for most of the folate-dependent enzymes that are involved in one-carbon transfer reactions involved in purine, pyrimidine and amino acid synthesis. Dihydrofolate, tetrahydrofolate, 5,10-methylenetetrahydrofolate, 10-formyltetrahydrofolate and 5-formyltetrahydrofolate are the best substrates. Folic acid and 5-methyltetrahydrofolate can also act as substrates.probableP48760

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
6.-.-.-Ligases.probable
6.3.-.-Forming carbon-nitrogen bonds.probable
6.3.2.-Acid--D-amino-acid ligases (peptide synthases).probable
6.3.2.17Tetrahydrofolate synthase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2VOS, chain A
Confidence level:very confident
Coverage over the Query: 27-39,52-298,312-336,353-377,419-503,538-585
View the alignment between query and template
View the model in PyMOL
Template: 2F00, chain A
Confidence level:confident
Coverage over the Query: 76-131,154,168-298,312-377,419-493,539-582
View the alignment between query and template
View the model in PyMOL
Template: 1QZV, chain F
Confidence level:probable
Coverage over the Query: 524-543
View the alignment between query and template
View the model in PyMOL