Citrus Sinensis ID: 008002

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580--

MMMSFDEMGFCGDMNFFSAPLGDADMAVQPSEPEATVEDDYTDEEMDVDELERRMWKDKMRLKRLKEQSRGKEGIDMAKQRQSQEQARRKKMSRAQDGILKYMLKMMEVCKAQGFVYGIIPEKGKPVTGASDNLREWWKDKVRFDRNGPAAIAKYQADNSVPGKNEGINAIGPTPHTLQELQDTTLGSLLSALMQHCDPPQRRFPLEKGVSPPWWPTGKEEWWPQLGLPKDQGAPPYKKPHDLKKAWKVGVLTAVIKHMSPDIAKIRKLVRQSKCLQDKMTAKESATWLAIINQEEALARELYPESCTVLSSSAGSGSLVINDCNEYDVEGAEDEPNFDVQECKPQNLISSSLGMERMRERLPNQQPPYAIKGEVVSNFDFVRKRKPSNDLSMKMDQHIYTCEYLQCPYSDPRLGYRDRTSRDNHQLTCPYKSGASEFGLGVPEDGQKMISELMSIYDNNIQGNRNVNPGNNAVVTEGQNTLQPRAQHQQEYYHGQGAVMDGNLFEGSNMHENNHLMFTREENQFDRFKIMNSPFENNSSGSNNNFSLMFESPFDLGSFDYKEDFQAAGVDTMPKHDSSVWF

cccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHcccccccHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEccccccccccccHHHHHHHHHHccccccccHHHHccccccccccccccccccccccccHHHcHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHcccccccccccccccc

***SFDEMGFCGDMNFFSAPLG*************************VDELERRMWKD***************************************GILKYMLKMMEVCKAQGFVYGIIPEKGKPVTGASDNLREWWKDKVRFDRNGPAAIAKYQ*********************LQELQDTTLGSLLSALMQHCDPPQRR*PL*KGVSPPWWPTGKEEWWPQLGL***********PHDLKKAWKVGVLTAVIKHMSPDIAKIRKLVRQSKCLQDKMTAKESATWLAIINQEEALARELYPESCTV**************CNEYDV*****************************************IKGEVVSNFDFV************MDQHIYTCEYLQCPYSDPRLGYR**TSRDNHQLTCP**********************LMSIYDN*********************************Y****AVM***L*******************************************LMFESPFDLGSFDYKEDF***************WF

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MMMSFDEMGFCGDMNFFSAPLGDADMAVQPSEPxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxSRGKEGIDMAKQRQSQEQARRKKMSRAQDGILKYMLKMMEVCKAQGFVYGIIPEKGKPVTGASDNLREWWKDKVRFDRNGPAAIAKYQADNSVPGKNEGINAIGPTPHTLQELQDTTLGSLLSALMQHCDPPQRRFPLEKGVSPPWWPTGKEEWWPQLGLPKDQGAPPYKKPHDLKKAWKVGVLTAVIKHMSPDIAKIRKLVRQSKCLQDKMTAKESATWLAIINQEEALARELYPESCTVLSSSAGSGSLVINDCNEYDVEGAEDEPNFDVQECKPQNLISSSLGMERMRERLPNQQPPYAIKGEVVSNFDFVRKRKPSNDLSMKMDQHIYTCEYLQCPYSDPRLGYRDRTSRDNHQLTCPYKSGASEFGLGVPEDGQKMISELMSIYDNNIQGNRNVNPGNNAVVTEGQNTLQPRAQHQQEYYHGQGAVMDGNLFEGSNMHENNHLMFTREENQFDRFKIMNSPFENNSSGSNNNFSLMFESPFDLGSFDYKEDFQAAGVDTMPKHDSSVWF

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Protein ETHYLENE INSENSITIVE 3	Probable transcription factor acting as a positive regulator in the ethylene response pathway. Is required for ethylene responsiveness in adult plant tissues. Binds a primary ethylene response element present in the ETHYLENE-RESPONSE-FACTOR1 promoter with consequence to activate the transcription of this gene.	probable	O24606

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1WIJ, chain A
Confidence level:very confident
Coverage over the Query: 174-301
View the alignment between query and template
View the model in PyMOL