Citrus Sinensis ID: 008036


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580
MASIIISIIFHTLLYSELHPAKAKPWIRVGYLNLSEVSTISGINYDLFTHLICSSADINSTTYQLSLSLPSDENQIAKFADTVKKKNPSITTILSIGQGKDTNYSIYSSMVRNSSHRKSFIDSSIRIARLYGFRGLDFAWTAPNTSTDMFNIGLLFDEWRIAATKLDAKNSTRQQSLLILTARFRYSPPANSYLLNSIQRNLNWIHAVTASYYEPVSTNFTAPPAALYGSISGRFARSTDQVLKAWIERGLSADKLVMCLPFYGYAWTLVKPEDNGIGAAAAGPALYDSGLVTYKKIKNHIKTYGPDVQVMYNSTYEVNYFSTGTVWFGFDDVEAVRAKIAYAKEKRLLGYYAWQVSFDDHDWLLSQAAAQKDSITSASVDKDEHSSNRRLSIALISTAAAALTLLLGCCAYKYNQMKRLNLIEEDSAKASNTRANNETEAGDFNRNVPNLRVYSLADIEAATERFSIRNKLGEGGYGPVYKGVLPCGEVIAVKKLSKTSTQGFEEFKNEVMLTAKLQHVNLIRVLGFCIDSEERMLIYEYMPNKSLDCYLFGLFWNQVNINRVYNSFTYHLLSKTIYLL
cHHHHHHHHHHHHHHHcccccccccEEEEEEEcccccccccccccccccEEEEEEEEEcccccEEEccccccHHHHHHHHHHHHHHccccEEEEEEEccccccccccccccccHHHHHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHccccccEEEEEEccccccccccccHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccHHHHHHHHHHccccccHHccccccccccEEEccccccccccccccccccccccHHHHHHHHHHHccccccEEEEccccccccEEcccEEEEcccHHHHHHHHHHHHcccccEEEEEcccccccHHHHHHHHcccccccccccccccccccccEEEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccHHHHHHHHccccccccccccccccccccccccccEEEEEEcccccccHHHHHHHHHHHHHHcccccHHHHHccccccccEEEEEEEcccccccEEccccccccccHHHHHHHHHHHHHHHHHccc
cHHHHHHHHHHHHHHHHccccccccEEEEEEEccccccccccccccHccEEEEEEEEcccccEEEccccccHcHHHHHHHHHHHHHccccEEEEEEccccccccccHHHHHccHHHHHHHHHHHHHHHHHcccccccccccccccHcHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEccccHHHHHccccHHHHHHHHcHHHEHEEccccccccccccccccccccccccccccHHHHHHHHHHccccHHHEEEEccccccEEEEEcccccccccccccccccHcHHHHHHHHHHHHHccccccEEEEcccccccEEEcccEEEccccHHHHHHHHHHHHHccccEEEEEEEEcccccccccccccccHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccEcccccccccccccccccccccccEEEEHHHHHHHHcccEEEEEHHHHccccEEEEEEHHHcEEEEEEccccccccHHHHHHHHHHHHHcccccEccEEEEEccccccEEEEEcccccEHHHHHcccccHEEcHHHHEHHHHHHHHHHHHHHc
MASIIISIIFHTllyselhpakakpwirvgylnlsevstisginyDLFTHLIcssadinsttyqlslslpsdenQIAKFADtvkkknpsiTTILSigqgkdtnySIYSSMvrnsshrksfidSSIRIARLYGfrgldfawtapntstdmfniGLLFDEWRIAATkldaknstRQQSLLILTArfrysppansyLLNSIQRNLNWIHAVtasyyepvstnftappaalygsisgrfaRSTDQVLKAWIERGLSADKLVMCLPFYGYAwtlvkpedngigaaaagpalydsgLVTYKKIKNHiktygpdvqVMYNSTYEVNYFStgtvwfgfdDVEAVRAKIAYAKEKRLLGYYAWQVSFDDHDWLLSQAAAQkdsitsasvdkdehssnrRLSIALISTAAAALTLLLGCCAYKYNQMKRLNLIEedsakasntranneteagdfnrnvpnlrvysLADIEAATERFSIRnklgeggygpvykgvlpcgEVIAVKKLSKTSTQGFEEFKNEVMLTAKLQHVNLIRVLGFCIDSEERMLIYeympnksldcylfglfwnqvninrVYNSFTYHLLSKTIYLL
MASIIISIIFHTLLYSELHPAKAKPWIRVGYLNLSEVSTISGINYDLFTHLICSSADINSTTYQLSLSLPSDENQIAKFadtvkkknpsittilsigqgkdtnYSIYSSMvrnsshrksfIDSSIRIARLYGFRGLDFAWTAPNTSTDMFNIGLLFDEWRIAATkldaknstrqQSLLILTARFRYSPPANSYLLNSIQRNLNWIHAVTASYYEPVSTNFTAPPAALYGSISGRFARSTDQVLKAWIERGLSADKLVMCLPFYGYAWTLVKPEDNGIGAAAAGPALYDSGLVTYKKIKNHIKTYGPDVQVMYNSTYEVNYFSTGTVWFGFDDVEAVRAKIAYAKEKRLLGYYAWQVSFDDHDWLLSQAAAQKDSitsasvdkdehssnRRLSIALISTAAAALTLLLGCCAYKYNQMKRLNLIEEDSAKasntranneteagdfnrnvpnLRVYSLADIEAATERFSIRNKLGEGGYGPVYKGVLPCGEVIAVKKLSKTSTQGFEEFKNEVMLTAKLQHVNLIRVLGFCIDSEERMLIYEYMPNKSLDCYLFGLFWNQVNINRVYNSFTYHLLSKTIYLL
MASIIISIIFHTLLYSELHPAKAKPWIRVGYLNLSEVSTISGINYDLFTHLICSSADINSTTYQLSLSLPSDENQIAKFADTVKKKNPSITTILSIGQGKDTNYSIYSSMVRNSSHRKSFIDSSIRIARLYGFRGLDFAWTAPNTSTDMFNIGLLFDEWRIAATKLDAKNSTRQQSLLILTARFRYSPPANSYLLNSIQRNLNWIHAVTASYYEPVSTNFTAPPAALYGSISGRFARSTDQVLKAWIERGLSADKLVMCLPFYGYAWTLVKPEDNGIGAAAAGPALYDSGLVTYKKIKNHIKTYGPDVQVMYNSTYEVNYFSTGTVWFGFDDVEAVRAKIAYAKEKRLLGYYAWQVSFDDHDWLLSQAAAQKDSITSASVDKDEHSSNRRlsialistaaaaltlllGCCAYKYNQMKRLNLIEEDSAKASNTRANNETEAGDFNRNVPNLRVYSLADIEAATERFSIRNKLGEGGYGPVYKGVLPCGEVIAVKKLSKTSTQGFEEFKNEVMLTAKLQHVNLIRVLGFCIDSEERMLIYEYMPNKSLDCYLFGLFWNQVNINRVYNSFTYHLLSKTIYLL
***IIISIIFHTLLYSELHPAKAKPWIRVGYLNLSEVSTISGINYDLFTHLICSSADINSTTYQLSLSL******IAKFADTV****PSITTILSIGQGKDTNYSIYSSMVRN**HRKSFIDSSIRIARLYGFRGLDFAWTAPNTSTDMFNIGLLFDEWRIAATKLDAKNSTRQQSLLILTARFRYSPPANSYLLNSIQRNLNWIHAVTASYYEPVSTNFTAPPAALYGSISGRFARSTDQVLKAWIERGLSADKLVMCLPFYGYAWTLVKPEDNGIGAAAAGPALYDSGLVTYKKIKNHIKTYGPDVQVMYNSTYEVNYFSTGTVWFGFDDVEAVRAKIAYAKEKRLLGYYAWQVSFDDHDWLLSQ***********************LSIALISTAAAALTLLLGCCAYKYNQMKRLNLI***********************NVPNLRVYSLADIEAATERFSIRNKLGEGGYGPVYKGVLPCGEVIAVKKLSKTSTQGFEEFKNEVMLTAKLQHVNLIRVLGFCIDSEERMLIYEYMPNKSLDCYLFGLFWNQVNINRVYNSFTYHLLSKTIYL*
*ASIIISIIFHTLLYSELHPAKAKPWIRVGYLNLSEVSTISGINYDLFTHLICSSADINSTTYQLSLSLPSDENQIAKFADTVKKKNPSITTILSIGQGKDTNYSIYSSMVRNSSHRKSFIDSSIRIARLYGFRGLDFAWTAPNTSTDMFNIGLLFDEWRIAAT*************LILTARFRYSPPANSYLLNSIQRNLNWIHAVTASYYEPVSTNFTAPPAALYGSISGRFARSTDQVLKAWIERGLSADKLVMCLPFYGYAWTLVKPEDNGIGAAA**PALYDSGLVTYKKIKNHIKTYGPDVQVMYNSTYEVNYFSTGTVWFGFDDVEAVRAKIAYAKEKRLLGYYAWQVSFDDHDWLLSQAAAQKDSITSASVDKDEHSSNRRLSIALISTAAAALTLLLGCCAYKYNQM********************************NLRVYSLADIEAATERFSIRNKLGEGGYGPVYKGVLPCGEVIAVKKLSKT*TQGFEEFKNEVMLTAKLQHVNLIRVLGFCIDSEERMLIYEYMPNKSLDCYLFGLFWNQVNINRVYNSFTYHLLSKTIYLL
MASIIISIIFHTLLYSELHPAKAKPWIRVGYLNLSEVSTISGINYDLFTHLICSSADINSTTYQLSLSLPSDENQIAKFADTVKKKNPSITTILSIGQGKDTNYSIYSSMVRNSSHRKSFIDSSIRIARLYGFRGLDFAWTAPNTSTDMFNIGLLFDEWRIAATKLDAKNSTRQQSLLILTARFRYSPPANSYLLNSIQRNLNWIHAVTASYYEPVSTNFTAPPAALYGSISGRFARSTDQVLKAWIERGLSADKLVMCLPFYGYAWTLVKPEDNGIGAAAAGPALYDSGLVTYKKIKNHIKTYGPDVQVMYNSTYEVNYFSTGTVWFGFDDVEAVRAKIAYAKEKRLLGYYAWQVSFDDHDWLLSQAA*******************RRLSIALISTAAAALTLLLGCCAYKYNQMKRLNLIEEDS***********TEAGDFNRNVPNLRVYSLADIEAATERFSIRNKLGEGGYGPVYKGVLPCGEVIAVKKLSKTSTQGFEEFKNEVMLTAKLQHVNLIRVLGFCIDSEERMLIYEYMPNKSLDCYLFGLFWNQVNINRVYNSFTYHLLSKTIYLL
MASIIISIIFHTLLYSELHPAKAKPWIRVGYLNLSEVSTISGINYDLFTHLICSSADINSTTYQLSLSLPSDENQIAKFADTVKKKNPSITTILSIGQGKDTNYSIYSSMVRNSSHRKSFIDSSIRIARLYGFRGLDFAWTAPNTSTDMFNIGLLFDEWRIAATKLDAKNSTRQQSLLILTARFRYSPPANSYLLNSIQRNLNWIHAVTASYYEPVSTNFTAPPAALYGSISGRFARSTDQVLKAWIERGLSADKLVMCLPFYGYAWTLVKPEDNGIGAAAAGPALYDSGLVTYKKIKNHIKTYGPDVQVMYNSTYEVNYFSTGTVWFGFDDVEAVRAKIAYAKEKRLLGYYAWQVSFDDHDWLLSQAAAQKDSITSASVDKDEHSSNRRLSIALISTAAAALTLLLGCCAYKYNQMKRLN****DSAKAS***********DFNRNVPNLRVYSLADIEAATERFSIRNKLGEGGYGPVYKGVLPCGEVIAVKKLSKTSTQGFEEFKNEVMLTAKLQHVNLIRVLGFCIDSEERMLIYEYMPNKSLDCYLFGLFWNQVNINRVYNSFTYHLLSKTIYLL
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MASIIISIIFHTLLYSELHPAKAKPWIRVGYLNLSEVSTISGINYDLFTHLICSSADINSTTYQLSLSLPSDENQIAKFADTVKKKNPSITTILSIGQGKDTNYSIYSSMVRNSSHRKSFIDSSIRIARLYGFRGLDFAWTAPNTSTDMFNIGLLFDEWRIAATKLDAKNSTRQQSLLILTARFRYSPPANSYLLNSIQRNLNWIHAVTASYYEPVSTNFTAPPAALYGSISGRFARSTDQVLKAWIERGLSADKLVMCLPFYGYAWTLVKPEDNGIGAAAAGPALYDSGLVTYKKIKNHIKTYGPDVQVMYNSTYEVNYFSTGTVWFGFDDVEAVRAKIAYAKEKRLLGYYAWQVSFDDHDWLLSQAAAQKDSITSASVDKDEHSSNRRLSIALISTAAAALTLLLGCCAYKYNQMKRLNLIEEDSAKASNTRANNETEAGDFNRNVPNLRVYSLADIEAATERFSIRNKLGEGGYGPVYKGVLPCGEVIAVKKLSKTSTQGFEEFKNEVMLTAKLQHVNLIRVLGFCIDSEERMLIYEYMPNKSLDCYLFGLFWNQVNINRVYNSFTYHLLSKTIYLL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query580 2.2.26 [Sep-21-2011]
Q9T058 849 G-type lectin S-receptor- no no 0.312 0.213 0.425 2e-33
Q9LPZ3 845 G-type lectin S-receptor- no no 0.282 0.194 0.448 3e-33
O81832 783 G-type lectin S-receptor- no no 0.175 0.130 0.627 3e-33
Q9SXB8 842 G-type lectin S-receptor- no no 0.255 0.175 0.477 4e-33
O64771 809 G-type lectin S-receptor- no no 0.3 0.215 0.424 1e-32
O64778 807 G-type lectin S-receptor- no no 0.318 0.229 0.382 5e-32
Q9ZT07 833 G-type lectin S-receptor- no no 0.343 0.238 0.4 2e-31
Q9ZR08 852 G-type lectin S-receptor- no no 0.274 0.186 0.450 2e-31
O64784 821 G-type lectin S-receptor- no no 0.281 0.198 0.414 2e-31
Q9LZU4 676 Cysteine-rich receptor-li no no 0.215 0.184 0.523 3e-31
>sp|Q9T058|Y4119_ARATH G-type lectin S-receptor-like serine/threonine-protein kinase At4g11900 OS=Arabidopsis thaliana GN=At4g11900 PE=2 SV=1 Back     alignment and function desciption
 Score =  144 bits (363), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 83/195 (42%), Positives = 117/195 (60%), Gaps = 14/195 (7%)

Query: 361 HDWLLSQAAAQKDSITSASVDKDEHSSNRRLSIALIS---TAAAALTLLLGCCAYKYNQM 417
           H + L  A++   +I++A+  K EHS  + + + L+     A AA  + L CC     + 
Sbjct: 440 HTFFLRLASS---NISTANNRKTEHSKGKSIVLPLVLASLVATAACFVGLYCCISSRIRR 496

Query: 418 KRLNLIEEDSAKASNTRANNETEAGDFNRNVPNLRVYSLADIEAATERFSIRNKLGEGGY 477
           K+    E+ S +          E G  +    N+   +L DI  AT  FS + KLGEGG+
Sbjct: 497 KKKQRDEKHSREL--------LEGGLIDDAGENMCYLNLHDIMVATNSFSRKKKLGEGGF 548

Query: 478 GPVYKGVLPCGEVIAVKKLSKTSTQGFEEFKNEVMLTAKLQHVNLIRVLGFCIDSEERML 537
           GPVYKG LP G  +A+K+LSK S+QG  EFKNEV+L  KLQH NL+R+LG+C++ +E++L
Sbjct: 549 GPVYKGKLPNGMEVAIKRLSKKSSQGLTEFKNEVVLIIKLQHKNLVRLLGYCVEGDEKLL 608

Query: 538 IYEYMPNKSLDCYLF 552
           IYEYM NKSLD  LF
Sbjct: 609 IYEYMSNKSLDGLLF 623





Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 1
>sp|Q9LPZ3|Y1141_ARATH G-type lectin S-receptor-like serine/threonine-protein kinase At1g11410 OS=Arabidopsis thaliana GN=At1g11410 PE=3 SV=3 Back     alignment and function description
>sp|O81832|Y4729_ARATH G-type lectin S-receptor-like serine/threonine-protein kinase At4g27290 OS=Arabidopsis thaliana GN=At4g27290 PE=3 SV=4 Back     alignment and function description
>sp|Q9SXB8|Y1133_ARATH G-type lectin S-receptor-like serine/threonine-protein kinase At1g11330 OS=Arabidopsis thaliana GN=At1g11330 PE=1 SV=3 Back     alignment and function description
>sp|O64771|Y1148_ARATH G-type lectin S-receptor-like serine/threonine-protein kinase At1g61480 OS=Arabidopsis thaliana GN=At1g61480 PE=2 SV=2 Back     alignment and function description
>sp|O64778|Y1142_ARATH G-type lectin S-receptor-like serine/threonine-protein kinase At1g61420 OS=Arabidopsis thaliana GN=At1g61420 PE=2 SV=2 Back     alignment and function description
>sp|Q9ZT07|RKS1_ARATH G-type lectin S-receptor-like serine/threonine-protein kinase RKS1 OS=Arabidopsis thaliana GN=RKS1 PE=2 SV=3 Back     alignment and function description
>sp|Q9ZR08|Y4230_ARATH G-type lectin S-receptor-like serine/threonine-protein kinase At4g03230 OS=Arabidopsis thaliana GN=At4g03230 PE=3 SV=3 Back     alignment and function description
>sp|O64784|Y1136_ARATH G-type lectin S-receptor-like serine/threonine-protein kinase At1g61360 OS=Arabidopsis thaliana GN=At1g61360 PE=2 SV=1 Back     alignment and function description
>sp|Q9LZU4|CRK4_ARATH Cysteine-rich receptor-like protein kinase 4 OS=Arabidopsis thaliana GN=CRK4 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query580
356558668 909 PREDICTED: uncharacterized protein LOC10 0.879 0.561 0.519 1e-144
224142425 763 predicted protein [Populus trichocarpa] 0.908 0.690 0.529 1e-144
359484771 781 PREDICTED: G-type lectin S-receptor-like 0.868 0.645 0.498 1e-134
359497026 738 PREDICTED: G-type lectin S-receptor-like 0.881 0.692 0.460 1e-125
296088199 1130 unnamed protein product [Vitis vinifera] 0.85 0.436 0.435 1e-115
255565055 721 conserved hypothetical protein [Ricinus 0.836 0.672 0.442 1e-107
5814093 739 receptor-like kinase CHRK1 [Nicotiana ta 0.834 0.654 0.407 1e-101
147787796658 hypothetical protein VITISV_036051 [Viti 0.774 0.682 0.407 1e-97
296084604580 unnamed protein product [Vitis vinifera] 0.567 0.567 0.516 2e-91
255565053445 conserved hypothetical protein [Ricinus 0.617 0.804 0.460 2e-85
>gi|356558668|ref|XP_003547625.1| PREDICTED: uncharacterized protein LOC100787480 [Glycine max] Back     alignment and taxonomy information
 Score =  519 bits (1337), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 286/551 (51%), Positives = 367/551 (66%), Gaps = 41/551 (7%)

Query: 5   IISIIFHTLLYSELHPAKAKPWIRVGYLNLSEVSTISGINYDLFTHLICSSADINSTTYQ 64
           I  ++F  LL  E  P KA+ W++ GY        +S IN  L+THLIC+ A++NS+TY+
Sbjct: 7   IALVLFEFLLCQEFEPLKAQTWLQAGYWYSGSGFPVSDINSALYTHLICAFAELNSSTYE 66

Query: 65  LSLSLPSDENQIAKFADTVKKKNPSITTILSIGQGKDTNYSIYSSMVRNSSHRKSFIDSS 124
           L +S P DE   + F  TVK+KNPSITT+LSI  G + N ++ S MV   S RK FI SS
Sbjct: 67  LYVS-PEDEQSFSSFTTTVKQKNPSITTLLSIA-GGNGNDTVLSLMVSKDSSRKYFIQSS 124

Query: 125 IRIARLYGFRGLDFAWTAPNTSTDMFNIGLLFDEWRIAATKLDAKNSTRQQSLLILTARF 184
           IRIARLYGF+GLD +W  P T +DM N+G LF+EWR AA    A +ST+   +LILTA  
Sbjct: 125 IRIARLYGFQGLDLSWV-PETISDMNNMGRLFEEWRAAAKSEAANDSTQ---VLILTAAV 180

Query: 185 RYSPPANS--YLLNSIQRNLNWIHAVTASYYEPVSTNFTAPPAALYGSISGRFARSTDQV 242
            + P  +S  Y + SIQ NLNW+H +T  Y+ P   NFTA  AALY   S   + +TD  
Sbjct: 181 HFRPGLDSASYPVESIQNNLNWVHILTYDYHMPQLANFTAAHAALYDPSS---SVNTDNG 237

Query: 243 LKAWIERGLSADKLVMCLPFYGYAWTLVKPEDNGIGAAAAGPALYDSGLVTYKKIKNHIK 302
           +K WI  G++A KLV+ LPFYGYAW L  PEDN IGA+A GPA+  SG + YK IK +I+
Sbjct: 238 IKEWIGSGVTASKLVLGLPFYGYAWNLRNPEDNAIGASATGPAIGKSGAMNYKDIKAYIQ 297

Query: 303 TYGPDVQVMYNSTYEVNYFSTGTVWFGFDDVEAVRAKIAYAKEKRLLGYYAWQVSFDDHD 362
            YG  V+  YN+TY VNYFS G+ W G+DDVE V+ K++YA+E +LLGY  WQV +DD +
Sbjct: 298 RYGGHVK--YNATYVVNYFSNGSTWIGYDDVEVVKMKVSYARENKLLGYAVWQVPYDD-N 354

Query: 363 WLLSQAAAQKDSITSASVDKDEHSSNRRLSIALISTAAAALTLLLGCCAYKYNQMKRLNL 422
           W+LS AAA+        VD++  +S R L I LI TA + +  LLG   Y    ++R   
Sbjct: 355 WVLSSAAAEH-------VDQNGRNSWRLLVIILIITAMSVI--LLGILIY---YLRR--- 399

Query: 423 IEEDSAKASNTRANNETEAGD-FNRNVPNLRVYSLADIEAATERFSIRNKLGEGGYGPVY 481
                      R    T+A   F+ N P+L+V+S +DIE AT RFSI NK+G+GGYGPVY
Sbjct: 400 -----------RFPKSTDASRLFHSNAPDLQVFSFSDIEQATNRFSIENKVGQGGYGPVY 448

Query: 482 KGVLPCGEVIAVKKLSKTSTQGFEEFKNEVMLTAKLQHVNLIRVLGFCIDSEERMLIYEY 541
           KG+L   + +AVKKLSK STQGFEEFKNEVMLTA+LQHVNL+R+LGF ID E++ML+YEY
Sbjct: 449 KGILSNRQEVAVKKLSKASTQGFEEFKNEVMLTARLQHVNLVRLLGFYIDGEQQMLVYEY 508

Query: 542 MPNKSLDCYLF 552
           MPNKSLD YLF
Sbjct: 509 MPNKSLDSYLF 519




Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224142425|ref|XP_002324558.1| predicted protein [Populus trichocarpa] gi|222865992|gb|EEF03123.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359484771|ref|XP_003633158.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein kinase RKS1-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359497026|ref|XP_003635401.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein kinase At1g11410-like, partial [Vitis vinifera] Back     alignment and taxonomy information
>gi|296088199|emb|CBI35714.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|255565055|ref|XP_002523520.1| conserved hypothetical protein [Ricinus communis] gi|223537227|gb|EEF38859.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
>gi|5814093|gb|AAD52097.1|AF088885_1 receptor-like kinase CHRK1 [Nicotiana tabacum] Back     alignment and taxonomy information
>gi|147787796|emb|CAN60684.1| hypothetical protein VITISV_036051 [Vitis vinifera] Back     alignment and taxonomy information
>gi|296084604|emb|CBI25625.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|255565053|ref|XP_002523519.1| conserved hypothetical protein [Ricinus communis] gi|223537226|gb|EEF38858.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query580
TAIR|locus:2134025379 ChiC "class V chitinase" [Arab 0.629 0.963 0.368 7.1e-61
TAIR|locus:2134030366 AT4G19820 [Arabidopsis thalian 0.613 0.972 0.352 7.5e-57
TAIR|locus:2133955369 AT4G19760 [Arabidopsis thalian 0.565 0.888 0.384 1.6e-56
TAIR|locus:2133940362 AT4G19750 [Arabidopsis thalian 0.539 0.864 0.395 6.8e-56
TAIR|locus:2134015398 AT4G19800 [Arabidopsis thalian 0.541 0.788 0.365 1.8e-55
TAIR|locus:2134010363 AT4G19720 [Arabidopsis thalian 0.586 0.936 0.359 2e-49
TAIR|locus:2134020332 AT4G19730 [Arabidopsis thalian 0.55 0.960 0.345 1e-43
TAIR|locus:2133970261 AT4G19770 [Arabidopsis thalian 0.436 0.969 0.384 6.6e-42
UNIPROTKB|O49974 848 KIK1 "Serine/threonine-protein 0.175 0.120 0.666 1.4e-29
TAIR|locus:2131684 783 AT4G27290 [Arabidopsis thalian 0.224 0.166 0.514 1.9e-29
TAIR|locus:2134025 ChiC "class V chitinase" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 623 (224.4 bits), Expect = 7.1e-61, P = 7.1e-61
 Identities = 139/377 (36%), Positives = 219/377 (58%)

Query:     5 IISIIFHTLLYSELHPAKAKPWIRVGYLNLSEVSTISGINYDLFTHLICSSADINSTTYQ 64
             +IS+I     +  L  + A+  ++  Y   +    ++ I+  LFTHL C+ AD+NS T Q
Sbjct:     6 LISLIVSITFFLTLQCSMAQTVVKASYWFPASEFPVTDIDSSLFTHLFCAFADLNSQTNQ 65

Query:    65 LSLSLPSDENQIAKFADTVKKKNPSITTILSIGQGKDTNYSIYSSMVRNSSHRKSFIDSS 124
             +++S  +++ + + F  TV+++NPS+ T+LSIG G   + + Y+SM  N + RKSFIDSS
Sbjct:    66 VTVS-SANQPKFSTFTQTVQRRNPSVKTLLSIGGGI-ADKTAYASMASNPTSRKSFIDSS 123

Query:   125 IRIARLYGFRGLDFAWTAPNTSTDMFNIGLLFDEWRIAATKLDAKNSTRQQSLLILTARF 184
             IR+AR YGF GLD  W  P+++T+M N G L  EWR +A   +A +S + + LL+  A F
Sbjct:   124 IRVARSYGFHGLDLDWEYPSSATEMTNFGTLLREWR-SAVVAEASSSGKPR-LLLAAAVF 181

Query:   185 RYSPPANS--YLLNSIQRNLNWIHAVTASYYEPVSTNFTAPPAALYGSISGRFARSTDQV 242
              YS    S  Y ++++  +L+W++ +   +Y P  +  T PPAAL+   +     S D  
Sbjct:   182 -YSNNYYSVLYPVSAVASSLDWVNLMAYDFYGPGWSRVTGPPAALFDPSNA--GPSGDAG 238

Query:   243 LKAWIERGLSADKLVMCLPFYGYAWTLVKPEDNGIGAAAAGPALYDSGLVTYKKIKNHIK 302
              ++WI+ GL A K V+  P+YGYAW L     +   A   G A+   G + Y +I+  I 
Sbjct:   239 TRSWIQAGLPAKKAVLGFPYYGYAWRLTNANSHSYYAPTTGAAISPDGSIGYGQIRKFIV 298

Query:   303 TYGPDVQVMYNSTYEVNYFSTGTVWFGFDDVEAVRAKIAYAKEKRLLGYYAWQVSFDDHD 362
               G     +YNST   +Y   GT W G+DD +++  K+ YAK++ LLGY++W V  DD+ 
Sbjct:   299 DNG--ATTVYNSTVVGDYCYAGTNWIGYDDNQSIVTKVRYAKQRGLLGYFSWHVGADDNS 356

Query:   363 WLLSQAAAQKDSITSAS 379
              L S+AA+Q    T+A+
Sbjct:   357 GL-SRAASQAWDATTAT 372




GO:0003824 "catalytic activity" evidence=IEA
GO:0004553 "hydrolase activity, hydrolyzing O-glycosyl compounds" evidence=IEA;ISS
GO:0004568 "chitinase activity" evidence=IEA
GO:0005576 "extracellular region" evidence=ISM
GO:0005975 "carbohydrate metabolic process" evidence=IEA
GO:0043169 "cation binding" evidence=IEA
GO:0005618 "cell wall" evidence=IDA
GO:0006032 "chitin catabolic process" evidence=IDA
GO:0008843 "endochitinase activity" evidence=IDA
GO:0009651 "response to salt stress" evidence=IEP
GO:0009737 "response to abscisic acid stimulus" evidence=IEP
GO:0009753 "response to jasmonic acid stimulus" evidence=IEP
GO:0035885 "exochitinase activity" evidence=IDA
TAIR|locus:2134030 AT4G19820 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2133955 AT4G19760 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2133940 AT4G19750 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2134015 AT4G19800 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2134010 AT4G19720 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2134020 AT4G19730 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2133970 AT4G19770 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|O49974 KIK1 "Serine/threonine-protein kinase" [Zea mays (taxid:4577)] Back     alignment and assigned GO terms
TAIR|locus:2131684 AT4G27290 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.2.1.14LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query580
cd02879299 cd02879, GH18_plant_chitinase_class_V, The class V 2e-93
smart00636334 smart00636, Glyco_18, Glyco_18 domain 9e-63
pfam00704325 pfam00704, Glyco_hydro_18, Glycosyl hydrolases fam 2e-57
cd02872362 cd02872, GH18_chitolectin_chitotriosidase, This co 3e-40
cd02873413 cd02873, GH18_IDGF, The IDGF's (imaginal disc grow 9e-23
smart00219 257 smart00219, TyrKc, Tyrosine kinase, catalytic doma 5e-18
smart00221 258 smart00221, STYKc, Protein kinase; unclassified sp 2e-17
COG3325441 COG3325, ChiA, Chitinase [Carbohydrate transport a 2e-17
cd06548322 cd06548, GH18_chitinase, The GH18 (glycosyl hydrol 6e-17
pfam07714 258 pfam07714, Pkinase_Tyr, Protein tyrosine kinase 4e-16
cd00192 262 cd00192, PTKc, Catalytic domain of Protein Tyrosin 1e-15
cd00598210 cd00598, GH18_chitinase-like, The GH18 (glycosyl h 1e-13
smart00220 254 smart00220, S_TKc, Serine/Threonine protein kinase 2e-13
cd00180 215 cd00180, PKc, Catalytic domain of Protein Kinases 2e-13
pfam00069 260 pfam00069, Pkinase, Protein kinase domain 2e-12
cd05048 283 cd05048, PTKc_Ror, Catalytic Domain of the Protein 4e-12
cd06627 254 cd06627, STKc_Cdc7_like, Catalytic domain of Cell 3e-11
cd05057 279 cd05057, PTKc_EGFR_like, Catalytic domain of Epide 4e-11
cd06606 260 cd06606, STKc_MAPKKK, Catalytic domain of the Prot 4e-11
cd05049 280 cd05049, PTKc_Trk, Catalytic domain of the Protein 1e-10
cd05052 263 cd05052, PTKc_Abl, Catalytic domain of the Protein 1e-09
cd05044 269 cd05044, PTKc_c-ros, Catalytic domain of the Prote 1e-09
cd06631 265 cd06631, STKc_YSK4, Catalytic domain of the Protei 3e-09
cd02874313 cd02874, GH18_CFLE_spore_hydrolase, Cortical fragm 4e-09
cd05148 261 cd05148, PTKc_Srm_Brk, Catalytic domain of the Pro 8e-09
cd05041 251 cd05041, PTKc_Fes_like, Catalytic domain of Fes-li 4e-08
cd05122 253 cd05122, PKc_STE, Catalytic domain of STE family P 4e-08
cd05092 280 cd05092, PTKc_TrkA, Catalytic domain of the Protei 5e-08
cd05081 284 cd05081, PTKc_Jak2_Jak3_rpt2, Catalytic (repeat 2) 6e-08
cd05033 266 cd05033, PTKc_EphR, Catalytic domain of Ephrin Rec 7e-08
cd05035 273 cd05035, PTKc_Axl_like, Catalytic Domain of Axl-li 8e-08
cd05050 288 cd05050, PTKc_Musk, Catalytic domain of the Protei 9e-08
cd05038 284 cd05038, PTKc_Jak_rpt2, Catalytic (repeat 2) domai 1e-07
cd05068 261 cd05068, PTKc_Frk_like, Catalytic domain of Fyn-re 2e-07
cd05034 261 cd05034, PTKc_Src_like, Catalytic domain of Src ki 2e-07
cd05039 256 cd05039, PTKc_Csk_like, Catalytic domain of C-term 3e-07
cd05091 283 cd05091, PTKc_Ror2, Catalytic domain of the Protei 3e-07
cd05094 291 cd05094, PTKc_TrkC, Catalytic domain of the Protei 3e-07
cd05093 288 cd05093, PTKc_TrkB, Catalytic domain of the Protei 3e-07
cd05110 303 cd05110, PTKc_HER4, Catalytic domain of the Protei 4e-07
cd05051 296 cd05051, PTKc_DDR, Catalytic domain of the Protein 4e-07
cd05097 295 cd05097, PTKc_DDR_like, Catalytic domain of Discoi 4e-07
cd06632 258 cd06632, STKc_MEKK1_plant, Catalytic domain of the 9e-07
cd05036 277 cd05036, PTKc_ALK_LTK, Catalytic domain of the Pro 1e-06
cd07830 283 cd07830, STKc_MAK_like, Catalytic domain of Male g 2e-06
cd06613 262 cd06613, STKc_MAP4K3_like, Catalytic domain of Mit 3e-06
cd05046 275 cd05046, PTK_CCK4, Pseudokinase domain of the Prot 6e-06
cd05096 304 cd05096, PTKc_DDR1, Catalytic domain of the Protei 6e-06
cd05095 296 cd05095, PTKc_DDR2, Catalytic domain of the Protei 7e-06
cd05112 256 cd05112, PTKc_Itk, Catalytic domain of the Protein 9e-06
cd05040 257 cd05040, PTKc_Ack_like, Catalytic domain of the Pr 2e-05
cd05063 268 cd05063, PTKc_EphR_A2, Catalytic domain of the Pro 2e-05
COG0515 384 COG0515, SPS1, Serine/threonine protein kinase [Ge 2e-05
cd07836 284 cd07836, STKc_Pho85, Catalytic domain of the Serin 2e-05
cd07840 287 cd07840, STKc_CDK9_like, Catalytic domain of Cycli 2e-05
cd06612 256 cd06612, STKc_MST1_2, Catalytic domain of the Prot 2e-05
cd05060 257 cd05060, PTKc_Syk_like, Catalytic domain of Spleen 3e-05
cd05072 261 cd05072, PTKc_Lyn, Catalytic domain of the Protein 3e-05
cd05056 270 cd05056, PTKc_FAK, Catalytic domain of the Protein 3e-05
cd05080 283 cd05080, PTKc_Tyk2_rpt2, Catalytic (repeat 2) doma 4e-05
cd05045 290 cd05045, PTKc_RET, Catalytic domain of the Protein 4e-05
cd05090 283 cd05090, PTKc_Ror1, Catalytic domain of the Protei 4e-05
cd07860 284 cd07860, STKc_CDK2_3, Catalytic domain of the Seri 5e-05
cd05067 260 cd05067, PTKc_Lck_Blk, Catalytic domain of the Pro 5e-05
cd05108 316 cd05108, PTKc_EGFR, Catalytic domain of the Protei 6e-05
cd08529 256 cd08529, STKc_FA2-like, Catalytic domain of the Pr 7e-05
cd05065 269 cd05065, PTKc_EphR_B, Catalytic domain of the Prot 7e-05
cd07829 282 cd07829, STKc_CDK_like, Catalytic domain of Cyclin 1e-04
cd05059 256 cd05059, PTKc_Tec_like, Catalytic domain of Tec-li 1e-04
cd06626 264 cd06626, STKc_MEKK4, Catalytic domain of the Prote 1e-04
cd05111 279 cd05111, PTK_HER3, Pseudokinase domain of the Prot 1e-04
cd05066 267 cd05066, PTKc_EphR_A, Catalytic domain of the Prot 2e-04
cd05037 259 cd05037, PTK_Jak_rpt1, Pseudokinase (repeat 1) dom 2e-04
cd05070 260 cd05070, PTKc_Fyn_Yrk, Catalytic domain of the Pro 3e-04
cd05071 262 cd05071, PTKc_Src, Catalytic domain of the Protein 3e-04
cd07842 316 cd07842, STKc_CDK8_like, Catalytic domain of Cycli 3e-04
cd06624 268 cd06624, STKc_ASK, Catalytic domain of the Protein 3e-04
cd08530 256 cd08530, STKc_CNK2-like, Catalytic domain of the P 3e-04
cd08224 267 cd08224, STKc_Nek6_Nek7, Catalytic domain of the P 4e-04
cd05075 272 cd05075, PTKc_Axl, Catalytic domain of the Protein 4e-04
cd05042 269 cd05042, PTKc_Aatyk, Catalytic domain of the Prote 4e-04
cd06628 267 cd06628, STKc_MAPKKK_Byr2_like, Catalytic domain o 5e-04
COG3858423 COG3858, COG3858, Predicted glycosyl hydrolase [Ge 5e-04
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 5e-04
cd07833 288 cd07833, STKc_CDKL, Catalytic domain of Cyclin-Dep 7e-04
cd05078 258 cd05078, PTK_Jak2_Jak3_rpt1, Pseudokinase (repeat 9e-04
cd07861 285 cd07861, STKc_CDK1_euk, Catalytic domain of the Se 9e-04
cd05085 250 cd05085, PTKc_Fer, Catalytic domain of the Protein 0.001
cd07866 311 cd07866, STKc_BUR1, Catalytic domain of the Serine 0.001
cd07852 337 cd07852, STKc_MAPK15, Catalytic domain of the Seri 0.001
cd05032 277 cd05032, PTKc_InsR_like, Catalytic domain of Insul 0.001
cd06545253 cd06545, GH18_3CO4_chitinase, The Bacteroides thet 0.001
cd06629 272 cd06629, STKc_MAPKKK_Bck1_like, Catalytic domain o 0.001
cd05062 277 cd05062, PTKc_IGF-1R, Catalytic domain of the Prot 0.001
cd06630 268 cd06630, STKc_MEKK1, Catalytic domain of the Prote 0.001
cd06614 286 cd06614, STKc_PAK, Catalytic domain of the Protein 0.001
cd07839 284 cd07839, STKc_CDK5, Catalytic domain of the Serine 0.002
cd05079 284 cd05079, PTKc_Jak1_rpt2, Catalytic (repeat 2) doma 0.002
cd05061 288 cd05061, PTKc_InsR, Catalytic domain of the Protei 0.002
cd05118 283 cd05118, STKc_CMGC, Catalytic domain of CMGC famil 0.002
cd07841 298 cd07841, STKc_CDK7, Catalytic domain of the Serine 0.003
cd07864 302 cd07864, STKc_CDK12, Catalytic domain of the Serin 0.004
cd05058 262 cd05058, PTKc_Met_Ron, Catalytic domain of the Pro 0.004
cd06625 263 cd06625, STKc_MEKK3_like, Catalytic domain of MAP/ 0.004
cd06646 267 cd06646, STKc_MAP4K5, Catalytic domain of the Prot 0.004
>gnl|CDD|119358 cd02879, GH18_plant_chitinase_class_V, The class V plant chitinases have a glycosyl hydrolase family 18 (GH18) domain, but lack the chitin-binding domain present in other GH18 enzymes Back     alignment and domain information
 Score =  288 bits (738), Expect = 2e-93
 Identities = 133/348 (38%), Positives = 197/348 (56%), Gaps = 57/348 (16%)

Query: 25  PWIRVGY-LNLSEVSTISGINYDLFTHLICSSADINSTTYQLSLSLPSDENQIAKFADTV 83
             ++ GY    SE    S I+  LFTHL  + AD++ +TY++ +S PSDE++ + F +TV
Sbjct: 2   TIVKGGYWPAWSEEFPPSNIDSSLFTHLFYAFADLDPSTYEVVIS-PSDESEFSTFTETV 60

Query: 84  KKKNPSITTILSIGQGKDTNYSIYSSMVRNSSHRKSFIDSSIRIARLYGFRGLDFAWTAP 143
           K+KNPS+ T+LSIG G  ++ S +++M  + + RK+FI+SSI++AR YGF GLD  W  P
Sbjct: 61  KRKNPSVKTLLSIG-GGGSDSSAFAAMASDPTARKAFINSSIKVARKYGFDGLDLDWEFP 119

Query: 144 NTSTDMFNIGLLFDEWRIAATKLDAKNSTRQQSLLILTARFRYSP------PANSYLLNS 197
           ++  +M N G L +EWR AA K +A++S R    L+LTA   +SP       + SY + +
Sbjct: 120 SSQVEMENFGKLLEEWR-AAVKDEARSSGRPP--LLLTAAVYFSPILFLSDDSVSYPIEA 176

Query: 198 IQRNLNWIHAVTASYYEPVSTNFTAPPAALYGSISGRFARSTDQVLKAWIERGLSADKLV 257
           I +NL+W++ +   YY    +N T P AALY   S     STD  +K+WI+ G+ A KLV
Sbjct: 177 INKNLDWVNVMAYDYYGSWESNTTGPAAALYDPNSN---VSTDYGIKSWIKAGVPAKKLV 233

Query: 258 MCLPFYGYAWTLVKPEDNGIGAAAAGPALYDSGLVTYKKIKNHIKTYGPDVQVMYNSTYE 317
           + LP YG AWTL                                          Y++T  
Sbjct: 234 LGLPLYGRAWTL------------------------------------------YDTTTV 251

Query: 318 VNYFSTGTVWFGFDDVEAVRAKIAYAKEKRLLGYYAWQVSFDDHDWLL 365
            +Y   GT W G+DDV+++  K+ YAK+K LLGY+AW V +DD++WL 
Sbjct: 252 SSYVYAGTTWIGYDDVQSIAVKVKYAKQKGLLGYFAWAVGYDDNNWLS 299


The GH18 domain of the class V chitinases has endochitinase activity in some cases and no catalytic activity in others. Included in this family is a lectin found in black locust (Robinia pseudoacacia) bark, which binds chitin but lacks chitinase activity. Also included is a chitinase-related receptor-like kinase (CHRK1) from tobacco (Nicotiana tabacum), with an N-terminal GH18 domain and a C-terminal kinase domain, which is thought to be part of a plant signaling pathway. The GH18 domain of CHRK1 is expressed extracellularly where it binds chitin but lacks chitinase activity. Length = 299

>gnl|CDD|214753 smart00636, Glyco_18, Glyco_18 domain Back     alignment and domain information
>gnl|CDD|216071 pfam00704, Glyco_hydro_18, Glycosyl hydrolases family 18 Back     alignment and domain information
>gnl|CDD|119351 cd02872, GH18_chitolectin_chitotriosidase, This conserved domain family includes a large number of catalytically inactive chitinase-like lectins (chitolectins) including YKL-39, YKL-40 (HCGP39), YM1, oviductin, and AMCase (acidic mammalian chitinase), as well as catalytically active chitotriosidases Back     alignment and domain information
>gnl|CDD|119352 cd02873, GH18_IDGF, The IDGF's (imaginal disc growth factors) are a family of growth factors identified in insects that include at least five members, some of which are encoded by genes in a tight cluster Back     alignment and domain information
>gnl|CDD|197581 smart00219, TyrKc, Tyrosine kinase, catalytic domain Back     alignment and domain information
>gnl|CDD|214568 smart00221, STYKc, Protein kinase; unclassified specificity Back     alignment and domain information
>gnl|CDD|225862 COG3325, ChiA, Chitinase [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|119365 cd06548, GH18_chitinase, The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites Back     alignment and domain information
>gnl|CDD|219530 pfam07714, Pkinase_Tyr, Protein tyrosine kinase Back     alignment and domain information
>gnl|CDD|173624 cd00192, PTKc, Catalytic domain of Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|119349 cd00598, GH18_chitinase-like, The GH18 (glycosyl hydrolase, family 18) type II chitinases hydrolyze chitin, an abundant polymer of beta-1,4-linked N-acetylglucosamine (GlcNAc) which is a major component of the cell wall of fungi and the exoskeleton of arthropods Back     alignment and domain information
>gnl|CDD|214567 smart00220, S_TKc, Serine/Threonine protein kinases, catalytic domain Back     alignment and domain information
>gnl|CDD|173623 cd00180, PKc, Catalytic domain of Protein Kinases Back     alignment and domain information
>gnl|CDD|215690 pfam00069, Pkinase, Protein kinase domain Back     alignment and domain information
>gnl|CDD|133179 cd05048, PTKc_Ror, Catalytic Domain of the Protein Tyrosine Kinases, Receptor tyrosine kinase-like Orphan Receptors Back     alignment and domain information
>gnl|CDD|173731 cd06627, STKc_Cdc7_like, Catalytic domain of Cell division control protein 7-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173636 cd05057, PTKc_EGFR_like, Catalytic domain of Epidermal Growth Factor Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173724 cd06606, STKc_MAPKKK, Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase Back     alignment and domain information
>gnl|CDD|133180 cd05049, PTKc_Trk, Catalytic domain of the Protein Tyrosine Kinases, Tropomyosin Related Kinases Back     alignment and domain information
>gnl|CDD|173633 cd05052, PTKc_Abl, Catalytic domain of the Protein Tyrosine Kinase, Abelson kinase Back     alignment and domain information
>gnl|CDD|173630 cd05044, PTKc_c-ros, Catalytic domain of the Protein Tyrosine Kinase, C-ros Back     alignment and domain information
>gnl|CDD|132962 cd06631, STKc_YSK4, Catalytic domain of the Protein Serine/Threonine Kinase, Yeast Sps1/Ste20-related kinase 4 Back     alignment and domain information
>gnl|CDD|119353 cd02874, GH18_CFLE_spore_hydrolase, Cortical fragment-lytic enzyme (CFLE) is a peptidoglycan hydrolase involved in bacterial endospore germination Back     alignment and domain information
>gnl|CDD|133248 cd05148, PTKc_Srm_Brk, Catalytic domain of the Protein Tyrosine Kinases, Srm and Brk Back     alignment and domain information
>gnl|CDD|173629 cd05041, PTKc_Fes_like, Catalytic domain of Fes-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173659 cd05122, PKc_STE, Catalytic domain of STE family Protein Kinases Back     alignment and domain information
>gnl|CDD|173648 cd05092, PTKc_TrkA, Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase A Back     alignment and domain information
>gnl|CDD|133212 cd05081, PTKc_Jak2_Jak3_rpt2, Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>gnl|CDD|133165 cd05033, PTKc_EphR, Catalytic domain of Ephrin Receptor Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|133167 cd05035, PTKc_Axl_like, Catalytic Domain of Axl-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|133181 cd05050, PTKc_Musk, Catalytic domain of the Protein Tyrosine Kinase, Muscle-specific kinase Back     alignment and domain information
>gnl|CDD|173628 cd05038, PTKc_Jak_rpt2, Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>gnl|CDD|133199 cd05068, PTKc_Frk_like, Catalytic domain of Fyn-related kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173626 cd05034, PTKc_Src_like, Catalytic domain of Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|133171 cd05039, PTKc_Csk_like, Catalytic domain of C-terminal Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173647 cd05091, PTKc_Ror2, Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 2 Back     alignment and domain information
>gnl|CDD|173650 cd05094, PTKc_TrkC, Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase C Back     alignment and domain information
>gnl|CDD|173649 cd05093, PTKc_TrkB, Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase B Back     alignment and domain information
>gnl|CDD|173655 cd05110, PTKc_HER4, Catalytic domain of the Protein Tyrosine Kinase, HER4 Back     alignment and domain information
>gnl|CDD|173632 cd05051, PTKc_DDR, Catalytic domain of the Protein Tyrosine Kinases, Discoidin Domain Receptors Back     alignment and domain information
>gnl|CDD|133228 cd05097, PTKc_DDR_like, Catalytic domain of Discoidin Domain Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|132963 cd06632, STKc_MEKK1_plant, Catalytic domain of the Protein Serine/Threonine Kinase, Plant MAP/ERK kinase kinase 1 Back     alignment and domain information
>gnl|CDD|133168 cd05036, PTKc_ALK_LTK, Catalytic domain of the Protein Tyrosine Kinases, Anaplastic Lymphoma Kinase and Leukocyte Tyrosine Kinase Back     alignment and domain information
>gnl|CDD|173734 cd07830, STKc_MAK_like, Catalytic domain of Male germ cell-Associated Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173727 cd06613, STKc_MAP4K3_like, Catalytic domain of Mitogen-activated protein kinase kinase kinase kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|133178 cd05046, PTK_CCK4, Pseudokinase domain of the Protein Tyrosine Kinase, Colon Carcinoma Kinase 4 Back     alignment and domain information
>gnl|CDD|133227 cd05096, PTKc_DDR1, Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 1 Back     alignment and domain information
>gnl|CDD|173651 cd05095, PTKc_DDR2, Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 2 Back     alignment and domain information
>gnl|CDD|133243 cd05112, PTKc_Itk, Catalytic domain of the Protein Tyrosine Kinase, Interleukin-2-inducible T-cell Kinase Back     alignment and domain information
>gnl|CDD|133172 cd05040, PTKc_Ack_like, Catalytic domain of the Protein Tyrosine Kinase, Activated Cdc42-associated kinase Back     alignment and domain information
>gnl|CDD|133194 cd05063, PTKc_EphR_A2, Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A2 Back     alignment and domain information
>gnl|CDD|223589 COG0515, SPS1, Serine/threonine protein kinase [General function prediction only / Signal transduction mechanisms / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|143341 cd07836, STKc_Pho85, Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Pho85 Back     alignment and domain information
>gnl|CDD|143345 cd07840, STKc_CDK9_like, Catalytic domain of Cyclin-Dependent protein Kinase 9-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132943 cd06612, STKc_MST1_2, Catalytic domain of the Protein Serine/Threonine Kinases, Mammalian Ste20-like protein kinase 1 and 2 Back     alignment and domain information
>gnl|CDD|133191 cd05060, PTKc_Syk_like, Catalytic domain of Spleen Tyrosine Kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173641 cd05072, PTKc_Lyn, Catalytic domain of the Protein Tyrosine Kinase, Lyn Back     alignment and domain information
>gnl|CDD|133187 cd05056, PTKc_FAK, Catalytic domain of the Protein Tyrosine Kinase, Focal Adhesion Kinase Back     alignment and domain information
>gnl|CDD|133211 cd05080, PTKc_Tyk2_rpt2, Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>gnl|CDD|173631 cd05045, PTKc_RET, Catalytic domain of the Protein Tyrosine Kinase, REarranged during Transfection protein Back     alignment and domain information
>gnl|CDD|133221 cd05090, PTKc_Ror1, Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 1 Back     alignment and domain information
>gnl|CDD|173751 cd07860, STKc_CDK2_3, Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase 2 and 3 Back     alignment and domain information
>gnl|CDD|173640 cd05067, PTKc_Lck_Blk, Catalytic domain of the Protein Tyrosine Kinases, Lymphocyte-specific kinase and Blk Back     alignment and domain information
>gnl|CDD|173654 cd05108, PTKc_EGFR, Catalytic domain of the Protein Tyrosine Kinase, Epidermal Growth Factor Receptor Back     alignment and domain information
>gnl|CDD|173771 cd08529, STKc_FA2-like, Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii FA2 and similar domains Back     alignment and domain information
>gnl|CDD|173638 cd05065, PTKc_EphR_B, Catalytic domain of the Protein Tyrosine Kinases, Class EphB Ephrin Receptors Back     alignment and domain information
>gnl|CDD|173733 cd07829, STKc_CDK_like, Catalytic domain of Cyclin-Dependent protein Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173637 cd05059, PTKc_Tec_like, Catalytic domain of Tec-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|132957 cd06626, STKc_MEKK4, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 4 Back     alignment and domain information
>gnl|CDD|173656 cd05111, PTK_HER3, Pseudokinase domain of the Protein Tyrosine Kinase, HER3 Back     alignment and domain information
>gnl|CDD|173639 cd05066, PTKc_EphR_A, Catalytic domain of the Protein Tyrosine Kinases, Class EphA Ephrin Receptors Back     alignment and domain information
>gnl|CDD|173627 cd05037, PTK_Jak_rpt1, Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>gnl|CDD|133201 cd05070, PTKc_Fyn_Yrk, Catalytic domain of the Protein Tyrosine Kinases, Fyn and Yrk Back     alignment and domain information
>gnl|CDD|133202 cd05071, PTKc_Src, Catalytic domain of the Protein Tyrosine Kinase, Src Back     alignment and domain information
>gnl|CDD|173740 cd07842, STKc_CDK8_like, Catalytic domain of Cyclin-Dependent protein Kinase 8-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173730 cd06624, STKc_ASK, Catalytic domain of the Protein Serine/Threonine Kinase, Apoptosis signal-regulating kinase Back     alignment and domain information
>gnl|CDD|173772 cd08530, STKc_CNK2-like, Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii CNK2, and similar domains Back     alignment and domain information
>gnl|CDD|173764 cd08224, STKc_Nek6_Nek7, Catalytic domain of the Protein Serine/Threonine Kinases, Never In Mitosis gene A-related kinase 6 and 7 Back     alignment and domain information
>gnl|CDD|173642 cd05075, PTKc_Axl, Catalytic domain of the Protein Tyrosine Kinase, Axl Back     alignment and domain information
>gnl|CDD|133174 cd05042, PTKc_Aatyk, Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases Back     alignment and domain information
>gnl|CDD|173732 cd06628, STKc_MAPKKK_Byr2_like, Catalytic domain of fungal Byr2-like MAP Kinase Kinase Kinases Back     alignment and domain information
>gnl|CDD|226376 COG3858, COG3858, Predicted glycosyl hydrolase [General function prediction only] Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|143338 cd07833, STKc_CDKL, Catalytic domain of Cyclin-Dependent protein Kinase Like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|133209 cd05078, PTK_Jak2_Jak3_rpt1, Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>gnl|CDD|173752 cd07861, STKc_CDK1_euk, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 1 from higher eukaryotes-like Back     alignment and domain information
>gnl|CDD|133216 cd05085, PTKc_Fer, Catalytic domain of the Protein Tyrosine Kinase, Fer Back     alignment and domain information
>gnl|CDD|143371 cd07866, STKc_BUR1, Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Bypass UAS Requirement 1 and similar proteins Back     alignment and domain information
>gnl|CDD|173747 cd07852, STKc_MAPK15, Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase 15 Back     alignment and domain information
>gnl|CDD|173625 cd05032, PTKc_InsR_like, Catalytic domain of Insulin Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|119362 cd06545, GH18_3CO4_chitinase, The Bacteroides thetaiotaomicron protein represented by pdb structure 3CO4 is an uncharacterized bacterial member of the family 18 glycosyl hydrolases with homologs found in Flavobacterium, Stigmatella, and Pseudomonas Back     alignment and domain information
>gnl|CDD|132960 cd06629, STKc_MAPKKK_Bck1_like, Catalytic domain of fungal Bck1-like MAP Kinase Kinase Kinases Back     alignment and domain information
>gnl|CDD|133193 cd05062, PTKc_IGF-1R, Catalytic domain of the Protein Tyrosine Kinase, Insulin-like Growth Factor-1 Receptor Back     alignment and domain information
>gnl|CDD|132961 cd06630, STKc_MEKK1, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 1 Back     alignment and domain information
>gnl|CDD|173728 cd06614, STKc_PAK, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase Back     alignment and domain information
>gnl|CDD|143344 cd07839, STKc_CDK5, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 5 Back     alignment and domain information
>gnl|CDD|173644 cd05079, PTKc_Jak1_rpt2, Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information
>gnl|CDD|133192 cd05061, PTKc_InsR, Catalytic domain of the Protein Tyrosine Kinase, Insulin Receptor Back     alignment and domain information
>gnl|CDD|143333 cd05118, STKc_CMGC, Catalytic domain of CMGC family Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|143346 cd07841, STKc_CDK7, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 7 Back     alignment and domain information
>gnl|CDD|173753 cd07864, STKc_CDK12, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 12 Back     alignment and domain information
>gnl|CDD|133189 cd05058, PTKc_Met_Ron, Catalytic domain of the Protein Tyrosine Kinases, Met and Ron Back     alignment and domain information
>gnl|CDD|132956 cd06625, STKc_MEKK3_like, Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132977 cd06646, STKc_MAP4K5, Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 5 Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 580
cd02879299 GH18_plant_chitinase_class_V The class V plant chi 100.0
cd02873413 GH18_IDGF The IDGF's (imaginal disc growth factors 100.0
cd02872362 GH18_chitolectin_chitotriosidase This conserved do 100.0
KOG2806432 consensus Chitinase [Carbohydrate transport and me 100.0
cd02878345 GH18_zymocin_alpha Zymocin, alpha subunit. Zymocin 100.0
smart00636334 Glyco_18 Glycosyl hydrolase family 18. 100.0
COG3325441 ChiA Chitinase [Carbohydrate transport and metabol 100.0
cd06548322 GH18_chitinase The GH18 (glycosyl hydrolases, fami 100.0
PF00704343 Glyco_hydro_18: Glycosyl hydrolases family 18; Int 100.0
cd02876318 GH18_SI-CLP Stabilin-1 interacting chitinase-like 100.0
cd02875358 GH18_chitobiase Chitobiase (also known as di-N-ace 100.0
cd02874313 GH18_CFLE_spore_hydrolase Cortical fragment-lytic 100.0
cd06545253 GH18_3CO4_chitinase The Bacteroides thetaiotaomicr 100.0
cd06549298 GH18_trifunctional GH18 domain of an uncharacteriz 100.0
cd00598210 GH18_chitinase-like The GH18 (glycosyl hydrolase, 100.0
cd06544253 GH18_narbonin Narbonin is a plant 2S protein from 100.0
COG3858423 Predicted glycosyl hydrolase [General function pre 100.0
cd06546256 GH18_CTS3_chitinase GH18 domain of CTS3 (chitinase 99.98
cd02871312 GH18_chitinase_D-like GH18 domain of Chitinase D ( 99.97
cd06542255 GH18_EndoS-like Endo-beta-N-acetylglucosaminidases 99.9
KOG2091392 consensus Predicted member of glycosyl hydrolase f 99.9
cd02877280 GH18_hevamine_XipI_class_III This conserved domain 99.86
cd06543294 GH18_PF-ChiA-like PF-ChiA is an uncharacterized ch 99.84
KOG1026 774 consensus Nerve growth factor receptor TRKA and re 99.84
KOG1187 361 consensus Serine/threonine protein kinase [Signal 99.84
KOG1094 807 consensus Discoidin domain receptor DDR1 [Signal t 99.83
KOG0595 429 consensus Serine/threonine-protein kinase involved 99.81
COG3469332 Chitinase [Carbohydrate transport and metabolism] 99.81
KOG0196 996 consensus Tyrosine kinase, EPH (ephrin) receptor f 99.8
KOG0197 468 consensus Tyrosine kinases [Signal transduction me 99.77
KOG0192 362 consensus Tyrosine kinase specific for activated ( 99.73
KOG0194 474 consensus Protein tyrosine kinase [Signal transduc 99.73
KOG1095 1025 consensus Protein tyrosine kinase [Signal transduc 99.71
KOG1025 1177 consensus Epidermal growth factor receptor EGFR an 99.7
KOG3653 534 consensus Transforming growth factor beta/activin 99.69
KOG0575 592 consensus Polo-like serine/threonine protein kinas 99.68
KOG0600 560 consensus Cdc2-related protein kinase [Cell cycle 99.67
KOG2052 513 consensus Activin A type IB receptor, serine/threo 99.65
KOG0615 475 consensus Serine/threonine protein kinase Chk2 and 99.64
KOG4278 1157 consensus Protein tyrosine kinase [Signal transduc 99.63
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.62
KOG0581 364 consensus Mitogen-activated protein kinase kinase 99.61
KOG0611 668 consensus Predicted serine/threonine protein kinas 99.61
KOG0659 318 consensus Cdk activating kinase (CAK)/RNA polymera 99.6
KOG1024 563 consensus Receptor-like protein tyrosine kinase RY 99.58
KOG0193 678 consensus Serine/threonine protein kinase RAF [Sig 99.58
KOG0597 808 consensus Serine-threonine protein kinase FUSED [G 99.58
KOG0661 538 consensus MAPK related serine/threonine protein ki 99.57
KOG4257 974 consensus Focal adhesion tyrosine kinase FAK, cont 99.57
KOG0591 375 consensus NIMA (never in mitosis)-related G2-speci 99.56
KOG0580 281 consensus Serine/threonine protein kinase [Cell cy 99.55
PF07714 259 Pkinase_Tyr: Protein tyrosine kinase Protein kinas 99.54
KOG0598 357 consensus Ribosomal protein S6 kinase and related 99.54
KOG0616 355 consensus cAMP-dependent protein kinase catalytic 99.54
cd05064 266 PTKc_EphR_A10 Catalytic domain of the Protein Tyro 99.54
KOG0199 1039 consensus ACK and related non-receptor tyrosine ki 99.53
KOG0593 396 consensus Predicted protein kinase KKIAMRE [Genera 99.53
KOG0583 370 consensus Serine/threonine protein kinase [Signal 99.53
cd05599 364 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Rel 99.52
KOG4721 904 consensus Serine/threonine protein kinase, contain 99.52
KOG0663 419 consensus Protein kinase PITSLRE and related kinas 99.51
KOG0198 313 consensus MEKK and related serine/threonine protei 99.51
cd05626 381 STKc_LATS2 Catalytic domain of the Protein Serine/ 99.51
cd05629 377 STKc_NDR_like_fungal Catalytic domain of Fungal Nu 99.51
cd05598 376 STKc_LATS Catalytic domain of the Protein Serine/T 99.5
cd05102 338 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosi 99.5
PTZ00263 329 protein kinase A catalytic subunit; Provisional 99.5
cd05628 363 STKc_NDR1 Catalytic domain of the Protein Serine/T 99.49
cd05612 291 STKc_PRKX_like Catalytic domain of PRKX-like Prote 99.49
cd05625 382 STKc_LATS1 Catalytic domain of the Protein Serine/ 99.49
cd05600 333 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- 99.49
cd06650 333 PKc_MEK1 Catalytic domain of the dual-specificity 99.49
KOG0605 550 consensus NDR and related serine/threonine kinases 99.49
KOG0610 459 consensus Putative serine/threonine protein kinase 99.48
cd05105 400 PTKc_PDGFR_alpha Catalytic domain of the Protein T 99.48
cd05104 375 PTKc_Kit Catalytic domain of the Protein Tyrosine 99.48
cd05096 304 PTKc_DDR1 Catalytic domain of the Protein Tyrosine 99.48
cd06615 308 PKc_MEK Catalytic domain of the dual-specificity P 99.48
cd06649 331 PKc_MEK2 Catalytic domain of the dual-specificity 99.48
KOG0588 786 consensus Serine/threonine protein kinase [Cell cy 99.48
KOG0582 516 consensus Ste20-like serine/threonine protein kina 99.48
cd05597 331 STKc_DMPK_like Catalytic domain of Myotonic Dystro 99.47
cd06646 267 STKc_MAP4K5 Catalytic domain of the Protein Serine 99.47
PHA02988 283 hypothetical protein; Provisional 99.47
cd05076 274 PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of th 99.47
cd05114 256 PTKc_Tec_Rlk Catalytic domain of the Protein Tyros 99.47
cd05595 323 STKc_PKB_beta Catalytic domain of the Protein Seri 99.47
cd05571 323 STKc_PKB Catalytic domain of the Protein Serine/Th 99.47
PTZ00426 340 cAMP-dependent protein kinase catalytic subunit; P 99.47
cd05148 261 PTKc_Srm_Brk Catalytic domain of the Protein Tyros 99.46
cd06624 268 STKc_ASK Catalytic domain of the Protein Serine/Th 99.46
cd05593 328 STKc_PKB_gamma Catalytic domain of the Protein Ser 99.46
KOG0586 596 consensus Serine/threonine protein kinase [General 99.45
cd05107 401 PTKc_PDGFR_beta Catalytic domain of the Protein Ty 99.45
cd05631 285 STKc_GRK4 Catalytic domain of the Protein Serine/T 99.45
KOG0032 382 consensus Ca2+/calmodulin-dependent protein kinase 99.45
cd05596 370 STKc_ROCK Catalytic domain of the Protein Serine/T 99.45
KOG4250 732 consensus TANK binding protein kinase TBK1 [Signal 99.45
cd05621 370 STKc_ROCK2 Catalytic domain of the Protein Serine/ 99.44
cd05585 312 STKc_YPK1_like Catalytic domain of Yeast Protein K 99.44
cd05627 360 STKc_NDR2 Catalytic domain of the Protein Serine/T 99.44
cd05605 285 STKc_GRK4_like Catalytic domain of G protein-coupl 99.44
cd06611 280 STKc_SLK_like Catalytic domain of Ste20-like kinas 99.44
cd05113 256 PTKc_Btk_Bmx Catalytic domain of the Protein Tyros 99.44
cd05594 325 STKc_PKB_alpha Catalytic domain of the Protein Ser 99.44
KOG0662 292 consensus Cyclin-dependent kinase CDK5 [Intracellu 99.44
cd05582 318 STKc_RSK_N N-terminal catalytic domain of the Prot 99.43
KOG0578 550 consensus p21-activated serine/threonine protein k 99.43
cd05072 261 PTKc_Lyn Catalytic domain of the Protein Tyrosine 99.43
cd07871 288 STKc_PCTAIRE3 Catalytic domain of the Serine/Threo 99.43
cd05624 331 STKc_MRCK_beta Catalytic domain of the Protein Ser 99.43
cd05573 350 STKc_ROCK_NDR_like Catalytic domain of ROCK- and N 99.43
cd06645 267 STKc_MAP4K3 Catalytic domain of the Protein Serine 99.43
KOG0594 323 consensus Protein kinase PCTAIRE and related kinas 99.43
KOG1989 738 consensus ARK protein kinase family [Signal transd 99.43
cd05588 329 STKc_aPKC Catalytic domain of the Protein Serine/T 99.42
cd05077 262 PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of th 99.42
cd05033 266 PTKc_EphR Catalytic domain of Ephrin Receptor Prot 99.42
cd05068 261 PTKc_Frk_like Catalytic domain of Fyn-related kina 99.42
cd05622 371 STKc_ROCK1 Catalytic domain of the Protein Serine/ 99.42
cd05081 284 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of 99.42
cd05601 330 STKc_CRIK Catalytic domain of the Protein Serine/T 99.42
cd05106 374 PTKc_CSF-1R Catalytic domain of the Protein Tyrosi 99.41
cd05034 261 PTKc_Src_like Catalytic domain of Src kinase-like 99.41
cd07869 303 STKc_PFTAIRE1 Catalytic domain of the Serine/Threo 99.41
cd06630 268 STKc_MEKK1 Catalytic domain of the Protein Serine/ 99.41
cd05584 323 STKc_p70S6K Catalytic domain of the Protein Serine 99.41
cd06620 284 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr 99.41
cd07848 287 STKc_CDKL5 Catalytic domain of the Serine/Threonin 99.41
KOG0592 604 consensus 3-phosphoinositide-dependent protein kin 99.41
PLN00034 353 mitogen-activated protein kinase kinase; Provision 99.41
cd08228 267 STKc_Nek6 Catalytic domain of the Protein Serine/T 99.41
cd06622 286 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS 99.41
cd06631 265 STKc_YSK4 Catalytic domain of the Protein Serine/T 99.41
cd05066 267 PTKc_EphR_A Catalytic domain of the Protein Tyrosi 99.4
cd05084 252 PTKc_Fes Catalytic domain of the Protein Tyrosine 99.4
KOG0585 576 consensus Ca2+/calmodulin-dependent protein kinase 99.4
cd05090 283 PTKc_Ror1 Catalytic domain of the Protein Tyrosine 99.4
cd05042 269 PTKc_Aatyk Catalytic domain of the Protein Tyrosin 99.4
cd05039 256 PTKc_Csk_like Catalytic domain of C-terminal Src k 99.4
cd05608 280 STKc_GRK1 Catalytic domain of the Protein Serine/T 99.4
cd08227 327 PK_STRAD_alpha Pseudokinase domain of STE20-relate 99.39
cd05067 260 PTKc_Lck_Blk Catalytic domain of the Protein Tyros 99.39
cd05108 316 PTKc_EGFR Catalytic domain of the Protein Tyrosine 99.39
cd05619 316 STKc_nPKC_theta Catalytic domain of the Protein Se 99.39
cd05618 329 STKc_aPKC_iota Catalytic domain of the Protein Ser 99.39
cd05059 256 PTKc_Tec_like Catalytic domain of Tec-like Protein 99.39
cd05046 275 PTK_CCK4 Pseudokinase domain of the Protein Tyrosi 99.39
cd05587 324 STKc_cPKC Catalytic domain of the Protein Serine/T 99.39
KOG4717 864 consensus Serine/threonine protein kinase [Signal 99.39
cd05580 290 STKc_PKA Catalytic domain of the Protein Serine/Th 99.39
cd08219 255 STKc_Nek3 Catalytic domain of the Protein Serine/T 99.39
cd05589 324 STKc_PKN Catalytic domain of the Protein Serine/Th 99.39
cd05623 332 STKc_MRCK_alpha Catalytic domain of the Protein Se 99.39
cd05591 321 STKc_nPKC_epsilon Catalytic domain of the Protein 99.39
cd05093 288 PTKc_TrkB Catalytic domain of the Protein Tyrosine 99.39
cd05590 320 STKc_nPKC_eta Catalytic domain of the Protein Seri 99.39
cd05087 269 PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein 99.38
cd07861 285 STKc_CDK1_euk Catalytic domain of the Serine/Threo 99.38
cd05592 316 STKc_nPKC_theta_delta Catalytic domain of the Prot 99.38
cd06654 296 STKc_PAK1 Catalytic domain of the Protein Serine/T 99.38
cd06656 297 STKc_PAK3 Catalytic domain of the Protein Serine/T 99.38
cd06644 292 STKc_STK10_LOK Catalytic domain of the Protein Ser 99.38
cd05575 323 STKc_SGK Catalytic domain of the Protein Serine/Th 99.38
cd05065 269 PTKc_EphR_B Catalytic domain of the Protein Tyrosi 99.38
cd05604 325 STKc_SGK3 Catalytic domain of the Protein Serine/T 99.38
cd05632 285 STKc_GRK5 Catalytic domain of the Protein Serine/T 99.38
cd05049 280 PTKc_Trk Catalytic domain of the Protein Tyrosine 99.38
PRK13184 932 pknD serine/threonine-protein kinase; Reviewed 99.38
cd05052 263 PTKc_Abl Catalytic domain of the Protein Tyrosine 99.38
cd06632 258 STKc_MEKK1_plant Catalytic domain of the Protein S 99.38
cd05086 268 PTKc_Aatyk2 Catalytic domain of the Protein Tyrosi 99.38
cd05061 288 PTKc_InsR Catalytic domain of the Protein Tyrosine 99.38
cd06625 263 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase 99.38
cd08221 256 STKc_Nek9 Catalytic domain of the Protein Serine/T 99.38
cd05043 280 PTK_Ryk Pseudokinase domain of Ryk (Receptor relat 99.38
cd07872 309 STKc_PCTAIRE2 Catalytic domain of the Serine/Threo 99.37
cd05630 285 STKc_GRK6 Catalytic domain of the Protein Serine/T 99.37
PTZ00267 478 NIMA-related protein kinase; Provisional 99.37
cd05103 343 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosi 99.37
cd05570 318 STKc_PKC Catalytic domain of the Protein Serine/Th 99.37
cd05085 250 PTKc_Fer Catalytic domain of the Protein Tyrosine 99.37
KOG0589 426 consensus Serine/threonine protein kinase [General 99.37
cd06652 265 STKc_MEKK2 Catalytic domain of the Protein Serine/ 99.37
cd05615 323 STKc_cPKC_alpha Catalytic domain of the Protein Se 99.37
cd07859 338 STKc_TDY_MAPK_plant Catalytic domain of the Serine 99.37
cd08529 256 STKc_FA2-like Catalytic domain of the Protein Seri 99.37
cd05614 332 STKc_MSK2_N N-terminal catalytic domain of the Pro 99.37
cd06626 264 STKc_MEKK4 Catalytic domain of the Protein Serine/ 99.37
cd05603 321 STKc_SGK2 Catalytic domain of the Protein Serine/T 99.37
cd06613 262 STKc_MAP4K3_like Catalytic domain of Mitogen-activ 99.37
cd08224 267 STKc_Nek6_Nek7 Catalytic domain of the Protein Ser 99.37
cd05609 305 STKc_MAST Catalytic domain of the Protein Serine/T 99.37
PTZ00266 1021 NIMA-related protein kinase; Provisional 99.37
cd06629 272 STKc_MAPKKK_Bck1_like Catalytic domain of fungal B 99.37
cd06643 282 STKc_SLK Catalytic domain of the Protein Serine/Th 99.36
cd06619 279 PKc_MKK5 Catalytic domain of the dual-specificity 99.36
cd05071 262 PTKc_Src Catalytic domain of the Protein Tyrosine 99.36
KOG0658 364 consensus Glycogen synthase kinase-3 [Carbohydrate 99.36
cd06628 267 STKc_MAPKKK_Byr2_like Catalytic domain of fungal B 99.36
cd07841 298 STKc_CDK7 Catalytic domain of the Serine/Threonine 99.36
cd05617 327 STKc_aPKC_zeta Catalytic domain of the Protein Ser 99.36
cd05055 302 PTKc_PDGFR Catalytic domain of the Protein Tyrosin 99.36
cd08229 267 STKc_Nek7 Catalytic domain of the Protein Serine/T 99.36
cd05036 277 PTKc_ALK_LTK Catalytic domain of the Protein Tyros 99.36
cd05616 323 STKc_cPKC_beta Catalytic domain of the Protein Ser 99.36
cd05078 258 PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain 99.36
cd06638 286 STKc_myosinIIIA Catalytic domain of the Protein Se 99.36
cd08218 256 STKc_Nek1 Catalytic domain of the Protein Serine/T 99.36
cd06647 293 STKc_PAK_I Catalytic domain of the Protein Serine/ 99.36
cd05073 260 PTKc_Hck Catalytic domain of the Protein Tyrosine 99.36
KOG0200 609 consensus Fibroblast/platelet-derived growth facto 99.35
cd05578 258 STKc_Yank1 Catalytic domain of the Protein Serine/ 99.35
cd05097 295 PTKc_DDR_like Catalytic domain of Discoidin Domain 99.35
cd07847 286 STKc_CDKL1_4 Catalytic domain of the Serine/Threon 99.35
cd05050 288 PTKc_Musk Catalytic domain of the Protein Tyrosine 99.35
cd07836 284 STKc_Pho85 Catalytic domain of the Serine/Threonin 99.35
cd07853 372 STKc_NLK Catalytic domain of the Serine/Threonine 99.35
cd05062 277 PTKc_IGF-1R Catalytic domain of the Protein Tyrosi 99.35
cd05620 316 STKc_nPKC_delta Catalytic domain of the Protein Se 99.35
cd05037 259 PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the 99.35
cd05053 293 PTKc_FGFR Catalytic domain of the Protein Tyrosine 99.35
cd06610 267 STKc_OSR1_SPAK Catalytic domain of the Protein Ser 99.35
cd05070 260 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyros 99.35
KOG0607 463 consensus MAP kinase-interacting kinase and relate 99.35
cd07873 301 STKc_PCTAIRE1 Catalytic domain of the Serine/Threo 99.35
cd06637 272 STKc_TNIK Catalytic domain of the Protein Serine/T 99.34
cd06641 277 STKc_MST3 Catalytic domain of the Protein Serine/T 99.34
cd06621 287 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek 99.34
cd05063 268 PTKc_EphR_A2 Catalytic domain of the Protein Tyros 99.34
cd05048 283 PTKc_Ror Catalytic Domain of the Protein Tyrosine 99.34
cd07846 286 STKc_CDKL2_3 Catalytic domain of the Serine/Threon 99.34
cd06623 264 PKc_MAPKK_plant_like Catalytic domain of Plant dua 99.34
cd05610 669 STKc_MASTL Catalytic domain of the Protein Serine/ 99.34
cd05115 257 PTKc_Zap-70 Catalytic domain of the Protein Tyrosi 99.34
cd05098 307 PTKc_FGFR1 Catalytic domain of the Protein Tyrosin 99.34
cd05057 279 PTKc_EGFR_like Catalytic domain of Epidermal Growt 99.34
cd05035 273 PTKc_Axl_like Catalytic Domain of Axl-like Protein 99.34
PHA03212 391 serine/threonine kinase US3; Provisional 99.34
cd05051 296 PTKc_DDR Catalytic domain of the Protein Tyrosine 99.34
cd06642 277 STKc_STK25-YSK1 Catalytic domain of the Protein Se 99.34
cd06651 266 STKc_MEKK3 Catalytic domain of the Protein Serine/ 99.33
cd06655 296 STKc_PAK2 Catalytic domain of the Protein Serine/T 99.33
cd05112 256 PTKc_Itk Catalytic domain of the Protein Tyrosine 99.33
cd08220 256 STKc_Nek8 Catalytic domain of the Protein Serine/T 99.33
cd06640 277 STKc_MST4 Catalytic domain of the Protein Serine/T 99.33
cd06612 256 STKc_MST1_2 Catalytic domain of the Protein Serine 99.33
cd05079 284 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the 99.33
cd07844 291 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like 99.33
cd05602 325 STKc_SGK1 Catalytic domain of the Protein Serine/T 99.33
cd05092 280 PTKc_TrkA Catalytic domain of the Protein Tyrosine 99.33
cd05574 316 STKc_phototropin_like Catalytic domain of Phototro 99.33
cd07832 286 STKc_CCRK Catalytic domain of the Serine/Threonine 99.33
cd05088 303 PTKc_Tie2 Catalytic domain of the Protein Tyrosine 99.33
cd05032 277 PTKc_InsR_like Catalytic domain of Insulin Recepto 99.33
cd05607 277 STKc_GRK7 Catalytic domain of the Protein Serine/T 99.32
KOG0694 694 consensus Serine/threonine protein kinase [Signal 99.32
KOG2345 302 consensus Serine/threonine protein kinase/TGF-beta 99.32
cd08225 257 STKc_Nek5 Catalytic domain of the Protein Serine/T 99.32
cd05111 279 PTK_HER3 Pseudokinase domain of the Protein Tyrosi 99.32
cd06609 274 STKc_MST3_like Catalytic domain of Mammalian Ste20 99.32
cd06653 264 STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kina 99.32
cd06605 265 PKc_MAPKK Catalytic domain of the dual-specificity 99.32
cd05094 291 PTKc_TrkC Catalytic domain of the Protein Tyrosine 99.32
cd05045 290 PTKc_RET Catalytic domain of the Protein Tyrosine 99.32
cd05095 296 PTKc_DDR2 Catalytic domain of the Protein Tyrosine 99.32
KOG0033 355 consensus Ca2+/calmodulin-dependent protein kinase 99.32
cd05101 304 PTKc_FGFR2 Catalytic domain of the Protein Tyrosin 99.32
cd05056 270 PTKc_FAK Catalytic domain of the Protein Tyrosine 99.32
cd05069 260 PTKc_Yes Catalytic domain of the Protein Tyrosine 99.32
KOG4236 888 consensus Serine/threonine protein kinase PKC mu/P 99.31
PF00069 260 Pkinase: Protein kinase domain Protein kinase; unc 99.31
cd05040 257 PTKc_Ack_like Catalytic domain of the Protein Tyro 99.31
cd05099 314 PTKc_FGFR4 Catalytic domain of the Protein Tyrosin 99.31
cd05038 284 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the P 99.31
cd06658 292 STKc_PAK5 Catalytic domain of the Protein Serine/T 99.31
cd05089 297 PTKc_Tie1 Catalytic domain of the Protein Tyrosine 99.31
cd05075 272 PTKc_Axl Catalytic domain of the Protein Tyrosine 99.3
cd07860 284 STKc_CDK2_3 Catalytic domain of the Serine/Threoni 99.3
cd05116 257 PTKc_Syk Catalytic domain of the Protein Tyrosine 99.3
cd00192 262 PTKc Catalytic domain of Protein Tyrosine Kinases. 99.3
KOG0660 359 consensus Mitogen-activated protein kinase [Signal 99.3
cd06659 297 STKc_PAK6 Catalytic domain of the Protein Serine/T 99.3
cd05080 283 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the 99.3
cd05100 334 PTKc_FGFR3 Catalytic domain of the Protein Tyrosin 99.3
KOG0574 502 consensus STE20-like serine/threonine kinase MST [ 99.3
cd07870 291 STKc_PFTAIRE2 Catalytic domain of the Serine/Threo 99.3
cd06917 277 STKc_NAK1_like Catalytic domain of Fungal Nak1-lik 99.3
cd06617 283 PKc_MKK3_6 Catalytic domain of the dual-specificit 99.3
cd06614 286 STKc_PAK Catalytic domain of the Protein Serine/Th 99.29
cd06636 282 STKc_MAP4K4_6 Catalytic domain of the Protein Seri 99.29
cd05041 251 PTKc_Fes_like Catalytic domain of Fes-like Protein 99.29
PTZ00283 496 serine/threonine protein kinase; Provisional 99.29
cd05109 279 PTKc_HER2 Catalytic domain of the Protein Tyrosine 99.29
smart00219 258 TyrKc Tyrosine kinase, catalytic domain. Phosphotr 99.29
cd07833 288 STKc_CDKL Catalytic domain of Cyclin-Dependent pro 99.29
cd05577 277 STKc_GRK Catalytic domain of the Protein Serine/Th 99.29
cd05054 337 PTKc_VEGFR Catalytic domain of the Protein Tyrosin 99.28
cd05613 290 STKc_MSK1_N N-terminal catalytic domain of the Pro 99.28
cd05082 256 PTKc_Csk Catalytic domain of the Protein Tyrosine 99.28
cd05572 262 STKc_cGK_PKG Catalytic domain of the Protein Serin 99.28
cd05586 330 STKc_Sck1_like Catalytic domain of Suppressor of l 99.28
cd06608 275 STKc_myosinIII_like Catalytic domain of Class III 99.28
cd06639 291 STKc_myosinIIIB Catalytic domain of the Protein Se 99.28
cd08528 269 STKc_Nek10 Catalytic domain of the Protein Serine/ 99.28
cd06627 254 STKc_Cdc7_like Catalytic domain of Cell division c 99.28
cd07862 290 STKc_CDK6 Catalytic domain of the Serine/Threonine 99.28
cd05579 265 STKc_MAST_like Catalytic domain of Microtubule-ass 99.28
cd05091 283 PTKc_Ror2 Catalytic domain of the Protein Tyrosine 99.27
cd05060 257 PTKc_Syk_like Catalytic domain of Spleen Tyrosine 99.27
KOG0201 467 consensus Serine/threonine protein kinase [Signal 99.27
cd05083 254 PTKc_Chk Catalytic domain of the Protein Tyrosine 99.27
KOG0577 948 consensus Serine/threonine protein kinase [Signal 99.26
cd05058 262 PTKc_Met_Ron Catalytic domain of the Protein Tyros 99.26
cd06606 260 STKc_MAPKKK Catalytic domain of the Protein Serine 99.26
KOG0584 632 consensus Serine/threonine protein kinase [General 99.26
cd05581 280 STKc_PDK1 Catalytic domain of the Protein Serine/T 99.26
cd07839 284 STKc_CDK5 Catalytic domain of the Serine/Threonine 99.26
cd06607 307 STKc_TAO Catalytic domain of the Protein Serine/Th 99.26
cd07864 302 STKc_CDK12 Catalytic domain of the Serine/Threonin 99.26
cd08226 328 PK_STRAD_beta Pseudokinase domain of STE20-related 99.26
cd05047 270 PTKc_Tie Catalytic domain of Tie Protein Tyrosine 99.26
cd05044 269 PTKc_c-ros Catalytic domain of the Protein Tyrosin 99.26
cd08217 265 STKc_Nek2 Catalytic domain of the Protein Serine/T 99.26
cd06657 292 STKc_PAK4 Catalytic domain of the Protein Serine/T 99.25
PHA03209 357 serine/threonine kinase US3; Provisional 99.25
cd06648 285 STKc_PAK_II Catalytic domain of the Protein Serine 99.25
PLN00009 294 cyclin-dependent kinase A; Provisional 99.25
cd07837 295 STKc_CdkB_plant Catalytic domain of the Serine/Thr 99.25
cd08215 258 STKc_Nek Catalytic domain of the Protein Serine/Th 99.25
cd05611 260 STKc_Rim15_like Catalytic domain of fungal Rim15-l 99.24
cd05110 303 PTKc_HER4 Catalytic domain of the Protein Tyrosine 99.24
cd07843 293 STKc_CDC2L1 Catalytic domain of the Serine/Threoni 99.24
cd08223 257 STKc_Nek4 Catalytic domain of the Protein Serine/T 99.24
PHA03211 461 serine/threonine kinase US3; Provisional 99.24
cd07876 359 STKc_JNK2 Catalytic domain of the Serine/Threonine 99.23
cd05122 253 PKc_STE Catalytic domain of STE family Protein Kin 99.23
cd07842 316 STKc_CDK8_like Catalytic domain of Cyclin-Dependen 99.22
cd07835 283 STKc_CDK1_like Catalytic domain of Cyclin-Dependen 99.22
KOG4279 1226 consensus Serine/threonine protein kinase [Signal 99.22
cd07878 343 STKc_p38beta_MAPK11 Catalytic domain of the Serine 99.22
cd07865 310 STKc_CDK9 Catalytic domain of the Serine/Threonine 99.22
cd06635 317 STKc_TAO1 Catalytic domain of the Protein Serine/T 99.22
cd05583 288 STKc_MSK_N N-terminal catalytic domain of the Prot 99.22
cd08222 260 STKc_Nek11 Catalytic domain of the Protein Serine/ 99.21
cd07831 282 STKc_MOK Catalytic domain of the Serine/Threonine 99.21
KOG0579 1187 consensus Ste20-like serine/threonine protein kina 99.21
cd05074 273 PTKc_Tyro3 Catalytic domain of the Protein Tyrosin 99.21
PTZ00024 335 cyclin-dependent protein kinase; Provisional 99.21
cd07840 287 STKc_CDK9_like Catalytic domain of Cyclin-Dependen 99.21
cd08530 256 STKc_CNK2-like Catalytic domain of the Protein Ser 99.2
PTZ00036 440 glycogen synthase kinase; Provisional 99.2
cd07863 288 STKc_CDK4 Catalytic domain of the Serine/Threonine 99.2
cd07854 342 STKc_MAPK4_6 Catalytic domain of the Serine/Threon 99.2
cd07856 328 STKc_Sty1_Hog1 Catalytic domain of the Serine/Thre 99.2
cd05633 279 STKc_GRK3 Catalytic domain of the Protein Serine/T 99.2
KOG0666 438 consensus Cyclin C-dependent kinase CDK8 [Transcri 99.2
PHA03207 392 serine/threonine kinase US3; Provisional 99.19
cd07845 309 STKc_CDK10 Catalytic domain of the Serine/Threonin 99.19
cd07868 317 STKc_CDK8 Catalytic domain of the Serine/Threonine 99.19
cd08216 314 PK_STRAD Pseudokinase domain of STE20-related kina 99.19
PHA03390 267 pk1 serine/threonine-protein kinase 1; Provisional 99.19
cd07830 283 STKc_MAK_like Catalytic domain of Male germ cell-A 99.18
cd07855 334 STKc_ERK5 Catalytic domain of the Serine/Threonine 99.18
cd07858 337 STKc_TEY_MAPK_plant Catalytic domain of the Serine 99.18
cd07880 343 STKc_p38gamma_MAPK12 Catalytic domain of the Serin 99.18
cd07875 364 STKc_JNK1 Catalytic domain of the Serine/Threonine 99.17
cd07874 355 STKc_JNK3 Catalytic domain of the Serine/Threonine 99.17
cd05606 278 STKc_beta_ARK Catalytic domain of the Protein Seri 99.16
cd05123 250 STKc_AGC Catalytic domain of AGC family Protein Se 99.16
cd07877 345 STKc_p38alpha_MAPK14 Catalytic domain of the Serin 99.16
cd06633 313 STKc_TAO3 Catalytic domain of the Protein Serine/T 99.16
cd07834 330 STKc_MAPK Catalytic domain of the Serine/Threonine 99.16
cd07867 317 STKc_CDC2L6 Catalytic domain of Serine/Threonine K 99.14
cd06634 308 STKc_TAO2 Catalytic domain of the Protein Serine/T 99.14
KOG0667 586 consensus Dual-specificity tyrosine-phosphorylatio 99.14
cd07849 336 STKc_ERK1_2_like Catalytic domain of Extracellular 99.14
KOG0587 953 consensus Traf2- and Nck-interacting kinase and re 99.14
cd07852 337 STKc_MAPK15 Catalytic domain of the Serine/Threoni 99.13
KOG0690 516 consensus Serine/threonine protein kinase [Signal 99.13
cd07829 282 STKc_CDK_like Catalytic domain of Cyclin-Dependent 99.13
KOG0612 1317 consensus Rho-associated, coiled-coil containing p 99.13
cd07850 353 STKc_JNK Catalytic domain of the Serine/Threonine 99.13
PTZ00284 467 protein kinase; Provisional 99.12
cd06616 288 PKc_MKK4 Catalytic domain of the dual-specificity 99.1
smart00221 225 STYKc Protein kinase; unclassified specificity. Ph 99.1
PLN03224 507 probable serine/threonine protein kinase; Provisio 99.1
cd06618 296 PKc_MKK7 Catalytic domain of the dual-specificity 99.1
cd05118 283 STKc_CMGC Catalytic domain of CMGC family Serine/T 99.1
PRK09188 365 serine/threonine protein kinase; Provisional 99.09
cd07879 342 STKc_p38delta_MAPK13 Catalytic domain of the Serin 99.09
cd07838 287 STKc_CDK4_6_like Catalytic domain of Cyclin-Depend 99.08
cd07866 311 STKc_BUR1 Catalytic domain of the Serine/Threonine 99.07
PHA03210 501 serine/threonine kinase US3; Provisional 99.07
KOG1151 775 consensus Tousled-like protein kinase [Signal tran 99.07
KOG1152772 consensus Signal transduction serine/threonine kin 99.05
KOG0599 411 consensus Phosphorylase kinase gamma subunit [Carb 99.04
cd07857 332 STKc_MPK1 Catalytic domain of the Serine/Threonine 99.04
cd07851 343 STKc_p38 Catalytic domain of the Serine/Threonine 99.03
KOG0576 829 consensus Mitogen-activated protein kinase kinase 99.02
KOG0195 448 consensus Integrin-linked kinase [Signal transduct 99.02
cd05147190 RIO1_euk RIO kinase family; eukaryotic RIO1, catal 99.02
cd05576 237 STKc_RPK118_like Catalytic domain of the Protein S 99.0
KOG0604 400 consensus MAP kinase-activated protein kinase 2 [S 98.98
cd00180 215 PKc Catalytic domain of Protein Kinases. Protein K 98.96
KOG4701568 consensus Chitinase [Cell wall/membrane/envelope b 98.96
KOG4645 1509 consensus MAPKKK (MAP kinase kinase kinase) SSK2 a 98.96
KOG0986 591 consensus G protein-coupled receptor kinase [Signa 98.95
KOG1290 590 consensus Serine/threonine protein kinase [Signal 98.94
KOG0668 338 consensus Casein kinase II, alpha subunit [Signal 98.94
PRK10345210 hypothetical protein; Provisional 98.94
KOG0608 1034 consensus Warts/lats-like serine threonine kinases 98.93
cd05145190 RIO1_like RIO kinase family; RIO1, RIO3 and simila 98.9
smart00220 244 S_TKc Serine/Threonine protein kinases, catalytic 98.87
KOG0669 376 consensus Cyclin T-dependent kinase CDK9 [Cell cyc 98.84
PRK14879211 serine/threonine protein kinase; Provisional 98.8
KOG0664 449 consensus Nemo-like MAPK-related serine/threonine 98.79
KOG0695 593 consensus Serine/threonine protein kinase [Signal 98.75
KOG0671 415 consensus LAMMER dual specificity kinases [Signal 98.72
TIGR03724199 arch_bud32 Kae1-associated kinase Bud32. Members o 98.72
KOG1345 378 consensus Serine/threonine kinase [Signal transduc 98.67
PHA02882 294 putative serine/threonine kinase; Provisional 98.66
smart00090237 RIO RIO-like kinase. 98.64
PRK09605535 bifunctional UGMP family protein/serine/threonine 98.64
KOG1027 903 consensus Serine/threonine protein kinase and endo 98.63
KOG1035 1351 consensus eIF-2alpha kinase GCN2 [Translation, rib 98.61
PRK10359232 lipopolysaccharide core biosynthesis protein; Prov 98.6
KOG1006 361 consensus Mitogen-activated protein kinase (MAPK) 98.59
KOG0696 683 consensus Serine/threonine protein kinase [Signal 98.59
KOG0984 282 consensus Mitogen-activated protein kinase (MAPK) 98.59
KOG0596 677 consensus Dual specificity; serine/threonine and t 98.57
PLN03225 566 Serine/threonine-protein kinase SNT7; Provisional 98.57
KOG0614 732 consensus cGMP-dependent protein kinase [Signal tr 98.53
KOG1165 449 consensus Casein kinase (serine/threonine/tyrosine 98.47
KOG1163 341 consensus Casein kinase (serine/threonine/tyrosine 98.44
KOG1167 418 consensus Serine/threonine protein kinase of the C 98.43
cd06547339 GH85_ENGase Endo-beta-N-acetylglucosaminidase (ENG 98.41
KOG1164 322 consensus Casein kinase (serine/threonine/tyrosine 98.35
cd05144198 RIO2_C RIO kinase family; RIO2, C-terminal catalyt 98.35
cd05120155 APH_ChoK_like Aminoglycoside 3'-phosphotransferase 98.29
KOG0603 612 consensus Ribosomal protein S6 kinase [Signal tran 98.27
KOG0983 391 consensus Mitogen-activated protein kinase (MAPK) 98.2
COG0515 384 SPS1 Serine/threonine protein kinase [General func 98.14
cd05119187 RIO RIO kinase family, catalytic domain. The RIO k 98.01
PRK12274 218 serine/threonine protein kinase; Provisional 97.96
KOG0670 752 consensus U4/U6-associated splicing factor PRP4 [R 97.91
cd05154 223 ACAD10_11_like Acyl-CoA dehydrogenase (ACAD) 10 an 97.84
KOG1166 974 consensus Mitotic checkpoint serine/threonine prot 97.83
KOG0665 369 consensus Jun-N-terminal kinase (JNK) [Signal tran 97.81
PF03644311 Glyco_hydro_85: Glycosyl hydrolase family 85 ; Int 97.71
PF02638311 DUF187: Glycosyl hydrolase like GH101; InterPro: I 97.66
PRK01723239 3-deoxy-D-manno-octulosonic-acid kinase; Reviewed 97.62
PF13200316 DUF4015: Putative glycosyl hydrolase domain 97.55
KOG1023 484 consensus Natriuretic peptide receptor, guanylate 97.38
TIGR01982 437 UbiB 2-polyprenylphenol 6-hydroxylase. This model 97.32
PF11340181 DUF3142: Protein of unknown function (DUF3142); In 97.26
PRK04750 537 ubiB putative ubiquinone biosynthesis protein UbiB 97.15
cd05151170 ChoK Choline Kinase (ChoK). The ChoK subfamily is 97.06
KOG1266 458 consensus Protein kinase [Signal transduction mech 96.84
KOG1243 690 consensus Protein kinase [General function predict 96.56
KOG3741 655 consensus Poly(A) ribonuclease subunit [RNA proces 96.51
KOG0590 601 consensus Checkpoint kinase and related serine/thr 96.27
KOG1240 1431 consensus Protein kinase containing WD40 repeats [ 95.9
KOG0603 612 consensus Ribosomal protein S6 kinase [Signal tran 95.82
PLN02876 822 acyl-CoA dehydrogenase 95.29
PLN00181 793 protein SPA1-RELATED; Provisional 95.14
COG2112201 Predicted Ser/Thr protein kinase [Signal transduct 94.82
cd05146197 RIO3_euk RIO kinase family; eukaryotic RIO3, catal 94.66
PRK10593 297 hypothetical protein; Provisional 94.41
PF0869340 SKG6: Transmembrane alpha-helix domain; InterPro: 94.37
KOG3087229 consensus Serine/threonine protein kinase [General 94.22
PF01636 239 APH: Phosphotransferase enzyme family This family 94.01
TIGR02172 226 Fb_sc_TIGR02172 Fibrobacter succinogenes paralogou 93.66
KOG2331526 consensus Predicted glycosylhydrolase [General fun 93.38
KOG0601 524 consensus Cyclin-dependent kinase WEE1 [Cell cycle 93.32
KOG0590 601 consensus Checkpoint kinase and related serine/thr 92.86
KOG4158 598 consensus BRPK/PTEN-induced protein kinase [Signal 92.7
PF14883294 GHL13: Hypothetical glycosyl hydrolase family 13 91.96
cd05150 244 APH Aminoglycoside 3'-phosphotransferase (APH). Th 91.59
KOG0601 524 consensus Cyclin-dependent kinase WEE1 [Cell cycle 91.31
COG0661 517 AarF Predicted unusual protein kinase [General fun 91.25
PF04478154 Mid2: Mid2 like cell wall stress sensor; InterPro: 90.46
PF15102146 TMEM154: TMEM154 protein family 90.2
PRK15123 268 lipopolysaccharide core heptose(I) kinase RfaP; Pr 90.18
PF03109119 ABC1: ABC1 family; InterPro: IPR004147 This entry 89.07
PRK09550 401 mtnK methylthioribose kinase; Reviewed 88.9
PF01102122 Glycophorin_A: Glycophorin A; InterPro: IPR001195 87.75
PF13095207 FTA2: Kinetochore Sim4 complex subunit FTA2 87.41
COG3642204 Mn2+-dependent serine/threonine protein kinase [Si 87.19
PRK09902216 hypothetical protein; Provisional 87.15
PF0243938 Adeno_E3_CR2: Adenovirus E3 region protein CR2; In 84.96
cd05157 235 ETNK_euk Ethanolamine kinase (ETNK) in eukaryotes. 83.39
PTZ0038296 Variant-specific surface protein (VSP); Provisiona 82.2
COG1649418 Uncharacterized protein conserved in bacteria [Fun 81.43
PF14531 288 Kinase-like: Kinase-like; PDB: 3DZO_A 2W1Z_A 3BYV_ 80.29
>cd02879 GH18_plant_chitinase_class_V The class V plant chitinases have a glycosyl hydrolase family 18 (GH18) domain, but lack the chitin-binding domain present in other GH18 enzymes Back     alignment and domain information
Probab=100.00  E-value=1e-63  Score=492.42  Aligned_cols=288  Identities=43%  Similarity=0.808  Sum_probs=251.5

Q ss_pred             cEEEEEecCCC-CCcCCCCCCCCCcEEEEeeEEeeCCceEEeeCCCccHHHHHHHHHHHHhhCCCceEEEEecCCCCccc
Q 008036           26 WIRVGYLNLSE-VSTISGINYDLFTHLICSSADINSTTYQLSLSLPSDENQIAKFADTVKKKNPSITTILSIGQGKDTNY  104 (580)
Q Consensus        26 ~~~vgY~~~~~-~~~~~~i~~~~~thii~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~lk~~~~~~kvllsigg~~~~~~  104 (580)
                      -+++|||++|+ .+.+++||+++||||+|+|+.++++++.+...+ .++..+..+.+.+|+++|++|+++|||||+. ++
T Consensus         3 ~~~~~Y~~~w~~~~~~~~i~~~~~THi~yaf~~~~~~~~~~~~~~-~~~~~~~~~~~~~k~~~~~lkvlisiGG~~~-~s   80 (299)
T cd02879           3 IVKGGYWPAWSEEFPPSNIDSSLFTHLFYAFADLDPSTYEVVISP-SDESEFSTFTETVKRKNPSVKTLLSIGGGGS-DS   80 (299)
T ss_pred             eEEEEEECCCCCCCChhHCCcccCCEEEEEEEEecCCCCEEeecc-ccHHHHHHHHHHHHHhCCCCeEEEEEeCCCC-CC
Confidence            47899999998 899999999999999999999999876776654 3455677888789999999999999999875 45


Q ss_pred             ccccccccChhHHHHHHHHHHHHHHHcCCCeeeeeecCCCCCCCCchhhhhHHHHHHHHhhhhhhccccccceEEEEeec
Q 008036          105 SIYSSMVRNSSHRKSFIDSSIRIARLYGFRGLDFAWTAPNTSTDMFNIGLLFDEWRIAATKLDAKNSTRQQSLLILTARF  184 (580)
Q Consensus       105 ~~f~~~~~~~~~r~~fi~~i~~~~~~~~~DGidiDwE~p~~~~~~~~~~~~~~~l~~~l~~~~~~~~~~~~~~~~~~~~~  184 (580)
                      ..|+.+++++++|++||+++++++++|||||||||||||+.++|+.+|+.|+++||.+|++..+..+   +..+++++++
T Consensus        81 ~~fs~~~~~~~~R~~fi~siv~~l~~~~fDGidiDWE~P~~~~d~~n~~~ll~elr~~l~~~~~~~~---~~~~~ls~av  157 (299)
T cd02879          81 SAFAAMASDPTARKAFINSSIKVARKYGFDGLDLDWEFPSSQVEMENFGKLLEEWRAAVKDEARSSG---RPPLLLTAAV  157 (299)
T ss_pred             chhhHHhCCHHHHHHHHHHHHHHHHHhCCCceeecccCCCChhHHHHHHHHHHHHHHHHHHHhhccC---CCcEEEEeec
Confidence            7899999999999999999999999999999999999998888999999999999999985433221   2345666666


Q ss_pred             ccCCC------CCccchHHHhhhcceeeeeeccCcCCCCCCCCCCCCCCCCCCCCCCccCHHHHHHHHHHcCCCCCceeE
Q 008036          185 RYSPP------ANSYLLNSIQRNLNWIHAVTASYYEPVSTNFTAPPAALYGSISGRFARSTDQVLKAWIERGLSADKLVM  258 (580)
Q Consensus       185 ~~~~~------~~~~~~~~l~~~vD~i~vm~yd~~~~~~~~~~~~~a~l~~~~~~~~~~~v~~~v~~~~~~gvp~~Kl~l  258 (580)
                      +..+.      ...|+++++.++|||||||+||++|+|....++|++|++....   ..+++.+|++|++.|+|++||+|
T Consensus       158 ~~~~~~~~~~~~~~yd~~~l~~~vD~i~vMtYD~~g~~~~~~~~~~a~l~~~~~---~~~~~~~v~~~~~~g~p~~Klvl  234 (299)
T cd02879         158 YFSPILFLSDDSVSYPIEAINKNLDWVNVMAYDYYGSWESNTTGPAAALYDPNS---NVSTDYGIKSWIKAGVPAKKLVL  234 (299)
T ss_pred             ccchhhccccccccCCHHHHHhhCCEEEEEeecccCCCCCCCCCCCCcCCCCCC---CCCHHHHHHHHHHcCCCHHHEEE
Confidence            55432      3568999999999999999999999998777899999987543   35899999999999999999999


Q ss_pred             eccccceeeeecCCCCCCCCCCCCCCCCCCCccccHHHHHHHhhhcCCCeEEeecCceeEEEeecCCEEEecCCHHHHHH
Q 008036          259 CLPFYGYAWTLVKPEDNGIGAAAAGPALYDSGLVTYKKIKNHIKTYGPDVQVMYNSTYEVNYFSTGTVWFGFDDVEAVRA  338 (580)
Q Consensus       259 Gip~yG~~~~~~~~~~~~~~~~~~g~~~~~~g~~~y~~i~~~~~~~~~~~~~~~d~~~~~~~~~~~~~wi~ydd~~Si~~  338 (580)
                      |+|+|||.|++                                          ||+.+..+|...+++||+|||++|++.
T Consensus       235 Gvp~YGr~~~~------------------------------------------~D~~~~~~y~~~~~~wi~ydd~~Si~~  272 (299)
T cd02879         235 GLPLYGRAWTL------------------------------------------YDTTTVSSYVYAGTTWIGYDDVQSIAV  272 (299)
T ss_pred             Eeccccccccc------------------------------------------cCCCcceEEEEECCEEEEeCCHHHHHH
Confidence            99999999954                                          566667788888899999999999999


Q ss_pred             HHHHhhhcCCceEEEEEeccCCchh
Q 008036          339 KIAYAKEKRLLGYYAWQVSFDDHDW  363 (580)
Q Consensus       339 K~~~~~~~gLgGv~~W~l~~Dd~~~  363 (580)
                      |++|++++||||+|+|++++||+++
T Consensus       273 K~~~a~~~~lgGv~~W~l~~Dd~~~  297 (299)
T cd02879         273 KVKYAKQKGLLGYFAWAVGYDDNNW  297 (299)
T ss_pred             HHHHHHhCCCCeEEEEEeecCCccc
Confidence            9999999999999999999999885



The GH18 domain of the class V chitinases has endochitinase activity in some cases and no catalytic activity in others. Included in this family is a lectin found in black locust (Robinia pseudoacacia) bark, which binds chitin but lacks chitinase activity. Also included is a chitinase-related receptor-like kinase (CHRK1) from tobacco (Nicotiana tabacum), with an N-terminal GH18 domain and a C-terminal kinase domain, which is thought to be part of a plant signaling pathway. The GH18 domain of CHRK1 is expressed extracellularly where it binds chitin but lacks chitinase activity.

>cd02873 GH18_IDGF The IDGF's (imaginal disc growth factors) are a family of growth factors identified in insects that include at least five members, some of which are encoded by genes in a tight cluster Back     alignment and domain information
>cd02872 GH18_chitolectin_chitotriosidase This conserved domain family includes a large number of catalytically inactive chitinase-like lectins (chitolectins) including YKL-39, YKL-40 (HCGP39), YM1, oviductin, and AMCase (acidic mammalian chitinase), as well as catalytically active chitotriosidases Back     alignment and domain information
>KOG2806 consensus Chitinase [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd02878 GH18_zymocin_alpha Zymocin, alpha subunit Back     alignment and domain information
>smart00636 Glyco_18 Glycosyl hydrolase family 18 Back     alignment and domain information
>COG3325 ChiA Chitinase [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd06548 GH18_chitinase The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites Back     alignment and domain information
>PF00704 Glyco_hydro_18: Glycosyl hydrolases family 18; InterPro: IPR001223 O-Glycosyl hydrolases 3 Back     alignment and domain information
>cd02876 GH18_SI-CLP Stabilin-1 interacting chitinase-like protein (SI-CLP) is a eukaryotic chitinase-like protein of unknown function that interacts with the endocytic/sorting transmembrane receptor stabilin-1 and is secreted from the lysosome Back     alignment and domain information
>cd02875 GH18_chitobiase Chitobiase (also known as di-N-acetylchitobiase) is a lysosomal glycosidase that hydrolyzes the reducing-end N-acetylglucosamine from the chitobiose core of oligosaccharides during the ordered degradation of asparagine-linked glycoproteins in eukaryotes Back     alignment and domain information
>cd02874 GH18_CFLE_spore_hydrolase Cortical fragment-lytic enzyme (CFLE) is a peptidoglycan hydrolase involved in bacterial endospore germination Back     alignment and domain information
>cd06545 GH18_3CO4_chitinase The Bacteroides thetaiotaomicron protein represented by pdb structure 3CO4 is an uncharacterized bacterial member of the family 18 glycosyl hydrolases with homologs found in Flavobacterium, Stigmatella, and Pseudomonas Back     alignment and domain information
>cd06549 GH18_trifunctional GH18 domain of an uncharacterized family of bacterial proteins, which share a common three-domain architecture: an N-terminal glycosyl hydrolase family 18 (GH18) domain, a glycosyl transferase family 2 domain, and a C-terminal polysaccharide deacetylase domain Back     alignment and domain information
>cd00598 GH18_chitinase-like The GH18 (glycosyl hydrolase, family 18) type II chitinases hydrolyze chitin, an abundant polymer of beta-1,4-linked N-acetylglucosamine (GlcNAc) which is a major component of the cell wall of fungi and the exoskeleton of arthropods Back     alignment and domain information
>cd06544 GH18_narbonin Narbonin is a plant 2S protein from the globulin fraction of narbon bean (Vicia narbonensis L Back     alignment and domain information
>COG3858 Predicted glycosyl hydrolase [General function prediction only] Back     alignment and domain information
>cd06546 GH18_CTS3_chitinase GH18 domain of CTS3 (chitinase 3), an uncharacterized protein from the human fungal pathogen Coccidioides posadasii Back     alignment and domain information
>cd02871 GH18_chitinase_D-like GH18 domain of Chitinase D (ChiD) Back     alignment and domain information
>cd06542 GH18_EndoS-like Endo-beta-N-acetylglucosaminidases are bacterial chitinases that hydrolyze the chitin core of various asparagine (N)-linked glycans and glycoproteins Back     alignment and domain information
>KOG2091 consensus Predicted member of glycosyl hydrolase family 18 [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd02877 GH18_hevamine_XipI_class_III This conserved domain family includes xylanase inhibitor Xip-I, and the class III plant chitinases such as hevamine, concanavalin B, and PPL2, all of which have a glycosyl hydrolase family 18 (GH18) domain Back     alignment and domain information
>cd06543 GH18_PF-ChiA-like PF-ChiA is an uncharacterized chitinase found in the hyperthermophilic archaeon Pyrococcus furiosus with a glycosyl hydrolase family 18 (GH18) catalytic domain as well as a cellulose-binding domain Back     alignment and domain information
>KOG1026 consensus Nerve growth factor receptor TRKA and related tyrosine kinases [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1187 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1094 consensus Discoidin domain receptor DDR1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0595 consensus Serine/threonine-protein kinase involved in autophagy [Posttranslational modification, protein turnover, chaperones; Intracellular trafficking, secretion, and vesicular transport; Signal transduction mechanisms] Back     alignment and domain information
>COG3469 Chitinase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG0196 consensus Tyrosine kinase, EPH (ephrin) receptor family [Signal transduction mechanisms] Back     alignment and domain information
>KOG0197 consensus Tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG0192 consensus Tyrosine kinase specific for activated (GTP-bound) p21cdc42Hs [Signal transduction mechanisms] Back     alignment and domain information
>KOG0194 consensus Protein tyrosine kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1095 consensus Protein tyrosine kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1025 consensus Epidermal growth factor receptor EGFR and related tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG3653 consensus Transforming growth factor beta/activin receptor subfamily of serine/threonine kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG0575 consensus Polo-like serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0600 consensus Cdc2-related protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG2052 consensus Activin A type IB receptor, serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0615 consensus Serine/threonine protein kinase Chk2 and related proteins [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG4278 consensus Protein tyrosine kinase [Signal transduction mechanisms] Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG0581 consensus Mitogen-activated protein kinase kinase (MAP2K) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0611 consensus Predicted serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>KOG0659 consensus Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH/TFIIK, kinase subunit CDK7 [Cell cycle control, cell division, chromosome partitioning; Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG1024 consensus Receptor-like protein tyrosine kinase RYK/derailed [Signal transduction mechanisms] Back     alignment and domain information
>KOG0193 consensus Serine/threonine protein kinase RAF [Signal transduction mechanisms] Back     alignment and domain information
>KOG0597 consensus Serine-threonine protein kinase FUSED [General function prediction only] Back     alignment and domain information
>KOG0661 consensus MAPK related serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4257 consensus Focal adhesion tyrosine kinase FAK, contains FERM domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG0591 consensus NIMA (never in mitosis)-related G2-specific serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0580 consensus Serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF07714 Pkinase_Tyr: Protein tyrosine kinase Protein kinase; unclassified specificity Back     alignment and domain information
>KOG0598 consensus Ribosomal protein S6 kinase and related proteins [General function prediction only; Signal transduction mechanisms] Back     alignment and domain information
>KOG0616 consensus cAMP-dependent protein kinase catalytic subunit (PKA) [Signal transduction mechanisms] Back     alignment and domain information
>cd05064 PTKc_EphR_A10 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A10 Back     alignment and domain information
>KOG0199 consensus ACK and related non-receptor tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG0593 consensus Predicted protein kinase KKIAMRE [General function prediction only] Back     alignment and domain information
>KOG0583 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05599 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG4721 consensus Serine/threonine protein kinase, contains leucine zipper domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG0663 consensus Protein kinase PITSLRE and related kinases [General function prediction only] Back     alignment and domain information
>KOG0198 consensus MEKK and related serine/threonine protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd05626 STKc_LATS2 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 2 Back     alignment and domain information
>cd05629 STKc_NDR_like_fungal Catalytic domain of Fungal Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05598 STKc_LATS Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor Back     alignment and domain information
>cd05102 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 3 Back     alignment and domain information
>PTZ00263 protein kinase A catalytic subunit; Provisional Back     alignment and domain information
>cd05628 STKc_NDR1 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 1 Back     alignment and domain information
>cd05612 STKc_PRKX_like Catalytic domain of PRKX-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05625 STKc_LATS1 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 1 Back     alignment and domain information
>cd05600 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06650 PKc_MEK1 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 1 Back     alignment and domain information
>KOG0605 consensus NDR and related serine/threonine kinases [General function prediction only] Back     alignment and domain information
>KOG0610 consensus Putative serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>cd05105 PTKc_PDGFR_alpha Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor alpha Back     alignment and domain information
>cd05104 PTKc_Kit Catalytic domain of the Protein Tyrosine Kinase, Kit Back     alignment and domain information
>cd05096 PTKc_DDR1 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 1 Back     alignment and domain information
>cd06615 PKc_MEK Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase Back     alignment and domain information
>cd06649 PKc_MEK2 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 2 Back     alignment and domain information
>KOG0588 consensus Serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0582 consensus Ste20-like serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05597 STKc_DMPK_like Catalytic domain of Myotonic Dystrophy protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06646 STKc_MAP4K5 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 5 Back     alignment and domain information
>PHA02988 hypothetical protein; Provisional Back     alignment and domain information
>cd05076 PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>cd05114 PTKc_Tec_Rlk Catalytic domain of the Protein Tyrosine Kinases, Tyrosine kinase expressed in hepatocellular carcinoma and Resting lymphocyte kinase Back     alignment and domain information
>cd05595 STKc_PKB_beta Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B beta Back     alignment and domain information
>cd05571 STKc_PKB Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B Back     alignment and domain information
>PTZ00426 cAMP-dependent protein kinase catalytic subunit; Provisional Back     alignment and domain information
>cd05148 PTKc_Srm_Brk Catalytic domain of the Protein Tyrosine Kinases, Srm and Brk Back     alignment and domain information
>cd06624 STKc_ASK Catalytic domain of the Protein Serine/Threonine Kinase, Apoptosis signal-regulating kinase Back     alignment and domain information
>cd05593 STKc_PKB_gamma Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B gamma Back     alignment and domain information
>KOG0586 consensus Serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>cd05107 PTKc_PDGFR_beta Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor beta Back     alignment and domain information
>cd05631 STKc_GRK4 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 4 Back     alignment and domain information
>KOG0032 consensus Ca2+/calmodulin-dependent protein kinase, EF-Hand protein superfamily [Signal transduction mechanisms] Back     alignment and domain information
>cd05596 STKc_ROCK Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase Back     alignment and domain information
>KOG4250 consensus TANK binding protein kinase TBK1 [Signal transduction mechanisms] Back     alignment and domain information
>cd05621 STKc_ROCK2 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 2 Back     alignment and domain information
>cd05585 STKc_YPK1_like Catalytic domain of Yeast Protein Kinase 1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05627 STKc_NDR2 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 2 Back     alignment and domain information
>cd05605 STKc_GRK4_like Catalytic domain of G protein-coupled Receptor Kinase 4-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06611 STKc_SLK_like Catalytic domain of Ste20-like kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05113 PTKc_Btk_Bmx Catalytic domain of the Protein Tyrosine Kinases, Bruton's tyrosine kinase and Bone marrow kinase on the X chromosome Back     alignment and domain information
>cd05594 STKc_PKB_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B alpha Back     alignment and domain information
>KOG0662 consensus Cyclin-dependent kinase CDK5 [Intracellular trafficking, secretion, and vesicular transport; Signal transduction mechanisms] Back     alignment and domain information
>cd05582 STKc_RSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, 90 kDa ribosomal protein S6 kinase Back     alignment and domain information
>KOG0578 consensus p21-activated serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05072 PTKc_Lyn Catalytic domain of the Protein Tyrosine Kinase, Lyn Back     alignment and domain information
>cd07871 STKc_PCTAIRE3 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-3 kinase Back     alignment and domain information
>cd05624 STKc_MRCK_beta Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase beta Back     alignment and domain information
>cd05573 STKc_ROCK_NDR_like Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06645 STKc_MAP4K3 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 3 Back     alignment and domain information
>KOG0594 consensus Protein kinase PCTAIRE and related kinases [General function prediction only] Back     alignment and domain information
>KOG1989 consensus ARK protein kinase family [Signal transduction mechanisms] Back     alignment and domain information
>cd05588 STKc_aPKC Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C Back     alignment and domain information
>cd05077 PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information
>cd05033 PTKc_EphR Catalytic domain of Ephrin Receptor Protein Tyrosine Kinases Back     alignment and domain information
>cd05068 PTKc_Frk_like Catalytic domain of Fyn-related kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05622 STKc_ROCK1 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 1 Back     alignment and domain information
>cd05081 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>cd05601 STKc_CRIK Catalytic domain of the Protein Serine/Threonine Kinase, Citron Rho-interacting kinase Back     alignment and domain information
>cd05106 PTKc_CSF-1R Catalytic domain of the Protein Tyrosine Kinase, Colony-Stimulating Factor-1 Receptor Back     alignment and domain information
>cd05034 PTKc_Src_like Catalytic domain of Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd07869 STKc_PFTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-1 kinase Back     alignment and domain information
>cd06630 STKc_MEKK1 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 1 Back     alignment and domain information
>cd05584 STKc_p70S6K Catalytic domain of the Protein Serine/Threonine Kinase, 70 kDa ribosomal protein S6 kinase Back     alignment and domain information
>cd06620 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>cd07848 STKc_CDKL5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase Like 5 Back     alignment and domain information
>KOG0592 consensus 3-phosphoinositide-dependent protein kinase (PDK1) [Signal transduction mechanisms] Back     alignment and domain information
>PLN00034 mitogen-activated protein kinase kinase; Provisional Back     alignment and domain information
>cd08228 STKc_Nek6 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 6 Back     alignment and domain information
>cd06622 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS2-like dual-specificity MAP kinase kinases Back     alignment and domain information
>cd06631 STKc_YSK4 Catalytic domain of the Protein Serine/Threonine Kinase, Yeast Sps1/Ste20-related kinase 4 Back     alignment and domain information
>cd05066 PTKc_EphR_A Catalytic domain of the Protein Tyrosine Kinases, Class EphA Ephrin Receptors Back     alignment and domain information
>cd05084 PTKc_Fes Catalytic domain of the Protein Tyrosine Kinase, Fes Back     alignment and domain information
>KOG0585 consensus Ca2+/calmodulin-dependent protein kinase kinase beta and related serine/threonine protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd05090 PTKc_Ror1 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 1 Back     alignment and domain information
>cd05042 PTKc_Aatyk Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases Back     alignment and domain information
>cd05039 PTKc_Csk_like Catalytic domain of C-terminal Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05608 STKc_GRK1 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 1 Back     alignment and domain information
>cd08227 PK_STRAD_alpha Pseudokinase domain of STE20-related kinase adapter protein alpha Back     alignment and domain information
>cd05067 PTKc_Lck_Blk Catalytic domain of the Protein Tyrosine Kinases, Lymphocyte-specific kinase and Blk Back     alignment and domain information
>cd05108 PTKc_EGFR Catalytic domain of the Protein Tyrosine Kinase, Epidermal Growth Factor Receptor Back     alignment and domain information
>cd05619 STKc_nPKC_theta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C theta Back     alignment and domain information
>cd05618 STKc_aPKC_iota Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C iota Back     alignment and domain information
>cd05059 PTKc_Tec_like Catalytic domain of Tec-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05046 PTK_CCK4 Pseudokinase domain of the Protein Tyrosine Kinase, Colon Carcinoma Kinase 4 Back     alignment and domain information
>cd05587 STKc_cPKC Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C Back     alignment and domain information
>KOG4717 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05580 STKc_PKA Catalytic domain of the Protein Serine/Threonine Kinase, cAMP-dependent protein kinase Back     alignment and domain information
>cd08219 STKc_Nek3 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 3 Back     alignment and domain information
>cd05589 STKc_PKN Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase N Back     alignment and domain information
>cd05623 STKc_MRCK_alpha Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase alpha Back     alignment and domain information
>cd05591 STKc_nPKC_epsilon Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C epsilon Back     alignment and domain information
>cd05093 PTKc_TrkB Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase B Back     alignment and domain information
>cd05590 STKc_nPKC_eta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C eta Back     alignment and domain information
>cd05087 PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases 1 and 3 Back     alignment and domain information
>cd07861 STKc_CDK1_euk Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 1 from higher eukaryotes-like Back     alignment and domain information
>cd05592 STKc_nPKC_theta_delta Catalytic domain of the Protein Serine/Threonine Kinases, Novel Protein Kinase C theta and delta Back     alignment and domain information
>cd06654 STKc_PAK1 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 1 Back     alignment and domain information
>cd06656 STKc_PAK3 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 3 Back     alignment and domain information
>cd06644 STKc_STK10_LOK Catalytic domain of the Protein Serine/Threonine Kinase, STK10 or Lymphocyte-oriented kinase Back     alignment and domain information
>cd05575 STKc_SGK Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase Back     alignment and domain information
>cd05065 PTKc_EphR_B Catalytic domain of the Protein Tyrosine Kinases, Class EphB Ephrin Receptors Back     alignment and domain information
>cd05604 STKc_SGK3 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 3 Back     alignment and domain information
>cd05632 STKc_GRK5 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 5 Back     alignment and domain information
>cd05049 PTKc_Trk Catalytic domain of the Protein Tyrosine Kinases, Tropomyosin Related Kinases Back     alignment and domain information
>PRK13184 pknD serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>cd05052 PTKc_Abl Catalytic domain of the Protein Tyrosine Kinase, Abelson kinase Back     alignment and domain information
>cd06632 STKc_MEKK1_plant Catalytic domain of the Protein Serine/Threonine Kinase, Plant MAP/ERK kinase kinase 1 Back     alignment and domain information
>cd05086 PTKc_Aatyk2 Catalytic domain of the Protein Tyrosine Kinase, Apoptosis-associated tyrosine kinase 2 Back     alignment and domain information
>cd05061 PTKc_InsR Catalytic domain of the Protein Tyrosine Kinase, Insulin Receptor Back     alignment and domain information
>cd06625 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd08221 STKc_Nek9 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 9 Back     alignment and domain information
>cd05043 PTK_Ryk Pseudokinase domain of Ryk (Receptor related to tyrosine kinase) Back     alignment and domain information
>cd07872 STKc_PCTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-2 kinase Back     alignment and domain information
>cd05630 STKc_GRK6 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 6 Back     alignment and domain information
>PTZ00267 NIMA-related protein kinase; Provisional Back     alignment and domain information
>cd05103 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 2 Back     alignment and domain information
>cd05570 STKc_PKC Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase C Back     alignment and domain information
>cd05085 PTKc_Fer Catalytic domain of the Protein Tyrosine Kinase, Fer Back     alignment and domain information
>KOG0589 consensus Serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>cd06652 STKc_MEKK2 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 2 Back     alignment and domain information
>cd05615 STKc_cPKC_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C alpha Back     alignment and domain information
>cd07859 STKc_TDY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TDY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>cd08529 STKc_FA2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii FA2 and similar domains Back     alignment and domain information
>cd05614 STKc_MSK2_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 2 Back     alignment and domain information
>cd06626 STKc_MEKK4 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 4 Back     alignment and domain information
>cd05603 STKc_SGK2 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 2 Back     alignment and domain information
>cd06613 STKc_MAP4K3_like Catalytic domain of Mitogen-activated protein kinase kinase kinase kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd08224 STKc_Nek6_Nek7 Catalytic domain of the Protein Serine/Threonine Kinases, Never In Mitosis gene A-related kinase 6 and 7 Back     alignment and domain information
>cd05609 STKc_MAST Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine kinase Back     alignment and domain information
>PTZ00266 NIMA-related protein kinase; Provisional Back     alignment and domain information
>cd06629 STKc_MAPKKK_Bck1_like Catalytic domain of fungal Bck1-like MAP Kinase Kinase Kinases Back     alignment and domain information
>cd06643 STKc_SLK Catalytic domain of the Protein Serine/Threonine Kinase, Ste20-like kinase Back     alignment and domain information
>cd06619 PKc_MKK5 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 5 Back     alignment and domain information
>cd05071 PTKc_Src Catalytic domain of the Protein Tyrosine Kinase, Src Back     alignment and domain information
>KOG0658 consensus Glycogen synthase kinase-3 [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd06628 STKc_MAPKKK_Byr2_like Catalytic domain of fungal Byr2-like MAP Kinase Kinase Kinases Back     alignment and domain information
>cd07841 STKc_CDK7 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 7 Back     alignment and domain information
>cd05617 STKc_aPKC_zeta Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C zeta Back     alignment and domain information
>cd05055 PTKc_PDGFR Catalytic domain of the Protein Tyrosine Kinases, Platelet Derived Growth Factor Receptors Back     alignment and domain information
>cd08229 STKc_Nek7 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 7 Back     alignment and domain information
>cd05036 PTKc_ALK_LTK Catalytic domain of the Protein Tyrosine Kinases, Anaplastic Lymphoma Kinase and Leukocyte Tyrosine Kinase Back     alignment and domain information
>cd05616 STKc_cPKC_beta Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C beta Back     alignment and domain information
>cd05078 PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>cd06638 STKc_myosinIIIA Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIA myosin Back     alignment and domain information
>cd08218 STKc_Nek1 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 1 Back     alignment and domain information
>cd06647 STKc_PAK_I Catalytic domain of the Protein Serine/Threonine Kinase, Group I p21-activated kinase Back     alignment and domain information
>cd05073 PTKc_Hck Catalytic domain of the Protein Tyrosine Kinase, Hematopoietic cell kinase Back     alignment and domain information
>KOG0200 consensus Fibroblast/platelet-derived growth factor receptor and related receptor tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd05578 STKc_Yank1 Catalytic domain of the Protein Serine/Threonine Kinase, Yank1 Back     alignment and domain information
>cd05097 PTKc_DDR_like Catalytic domain of Discoidin Domain Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd07847 STKc_CDKL1_4 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 1 and 4 Back     alignment and domain information
>cd05050 PTKc_Musk Catalytic domain of the Protein Tyrosine Kinase, Muscle-specific kinase Back     alignment and domain information
>cd07836 STKc_Pho85 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Pho85 Back     alignment and domain information
>cd07853 STKc_NLK Catalytic domain of the Serine/Threonine Kinase, Nemo-Like Kinase Back     alignment and domain information
>cd05062 PTKc_IGF-1R Catalytic domain of the Protein Tyrosine Kinase, Insulin-like Growth Factor-1 Receptor Back     alignment and domain information
>cd05620 STKc_nPKC_delta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C delta Back     alignment and domain information
>cd05037 PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>cd05053 PTKc_FGFR Catalytic domain of the Protein Tyrosine Kinases, Fibroblast Growth Factor Receptors Back     alignment and domain information
>cd06610 STKc_OSR1_SPAK Catalytic domain of the Protein Serine/Threonine Kinases, Oxidative stress response kinase and Ste20-related proline alanine-rich kinase Back     alignment and domain information
>cd05070 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyrosine Kinases, Fyn and Yrk Back     alignment and domain information
>KOG0607 consensus MAP kinase-interacting kinase and related serine/threonine protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd07873 STKc_PCTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-1 kinase Back     alignment and domain information
>cd06637 STKc_TNIK Catalytic domain of the Protein Serine/Threonine Kinase, Traf2- and Nck-interacting kinase Back     alignment and domain information
>cd06641 STKc_MST3 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 3 Back     alignment and domain information
>cd06621 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>cd05063 PTKc_EphR_A2 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A2 Back     alignment and domain information
>cd05048 PTKc_Ror Catalytic Domain of the Protein Tyrosine Kinases, Receptor tyrosine kinase-like Orphan Receptors Back     alignment and domain information
>cd07846 STKc_CDKL2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 2 and 3 Back     alignment and domain information
>cd06623 PKc_MAPKK_plant_like Catalytic domain of Plant dual-specificity MAP kinase kinases and similar proteins Back     alignment and domain information
>cd05610 STKc_MASTL Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine-like kinase Back     alignment and domain information
>cd05115 PTKc_Zap-70 Catalytic domain of the Protein Tyrosine Kinase, Zeta-chain-associated protein of 70kDa Back     alignment and domain information
>cd05098 PTKc_FGFR1 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 1 Back     alignment and domain information
>cd05057 PTKc_EGFR_like Catalytic domain of Epidermal Growth Factor Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05035 PTKc_Axl_like Catalytic Domain of Axl-like Protein Tyrosine Kinases Back     alignment and domain information
>PHA03212 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd05051 PTKc_DDR Catalytic domain of the Protein Tyrosine Kinases, Discoidin Domain Receptors Back     alignment and domain information
>cd06642 STKc_STK25-YSK1 Catalytic domain of the Protein Serine/Threonine Kinase, STK25 or Yeast Sps1/Ste20-related kinase 1 Back     alignment and domain information
>cd06651 STKc_MEKK3 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 3 Back     alignment and domain information
>cd06655 STKc_PAK2 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 2 Back     alignment and domain information
>cd05112 PTKc_Itk Catalytic domain of the Protein Tyrosine Kinase, Interleukin-2-inducible T-cell Kinase Back     alignment and domain information
>cd08220 STKc_Nek8 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 8 Back     alignment and domain information
>cd06640 STKc_MST4 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 4 Back     alignment and domain information
>cd06612 STKc_MST1_2 Catalytic domain of the Protein Serine/Threonine Kinases, Mammalian Ste20-like protein kinase 1 and 2 Back     alignment and domain information
>cd05079 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information
>cd07844 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like Serine/Threonine Kinases Back     alignment and domain information
>cd05602 STKc_SGK1 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 1 Back     alignment and domain information
>cd05092 PTKc_TrkA Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase A Back     alignment and domain information
>cd05574 STKc_phototropin_like Catalytic domain of Phototropin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07832 STKc_CCRK Catalytic domain of the Serine/Threonine Kinase, Cell Cycle-Related Kinase Back     alignment and domain information
>cd05088 PTKc_Tie2 Catalytic domain of the Protein Tyrosine Kinase, Tie2 Back     alignment and domain information
>cd05032 PTKc_InsR_like Catalytic domain of Insulin Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05607 STKc_GRK7 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 7 Back     alignment and domain information
>KOG0694 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG2345 consensus Serine/threonine protein kinase/TGF-beta stimulated factor [Transcription; Lipid transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>cd08225 STKc_Nek5 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 5 Back     alignment and domain information
>cd05111 PTK_HER3 Pseudokinase domain of the Protein Tyrosine Kinase, HER3 Back     alignment and domain information
>cd06609 STKc_MST3_like Catalytic domain of Mammalian Ste20-like protein kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06653 STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06605 PKc_MAPKK Catalytic domain of the dual-specificity Protein Kinase, Mitogen-Activated Protein Kinase Kinase Back     alignment and domain information
>cd05094 PTKc_TrkC Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase C Back     alignment and domain information
>cd05045 PTKc_RET Catalytic domain of the Protein Tyrosine Kinase, REarranged during Transfection protein Back     alignment and domain information
>cd05095 PTKc_DDR2 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 2 Back     alignment and domain information
>KOG0033 consensus Ca2+/calmodulin-dependent protein kinase, EF-Hand protein superfamily [Signal transduction mechanisms] Back     alignment and domain information
>cd05101 PTKc_FGFR2 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 2 Back     alignment and domain information
>cd05056 PTKc_FAK Catalytic domain of the Protein Tyrosine Kinase, Focal Adhesion Kinase Back     alignment and domain information
>cd05069 PTKc_Yes Catalytic domain of the Protein Tyrosine Kinase, Yes Back     alignment and domain information
>KOG4236 consensus Serine/threonine protein kinase PKC mu/PKD and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PF00069 Pkinase: Protein kinase domain Protein kinase; unclassified specificity Back     alignment and domain information
>cd05040 PTKc_Ack_like Catalytic domain of the Protein Tyrosine Kinase, Activated Cdc42-associated kinase Back     alignment and domain information
>cd05099 PTKc_FGFR4 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 4 Back     alignment and domain information
>cd05038 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>cd06658 STKc_PAK5 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 5 Back     alignment and domain information
>cd05089 PTKc_Tie1 Catalytic domain of the Protein Tyrosine Kinase, Tie1 Back     alignment and domain information
>cd05075 PTKc_Axl Catalytic domain of the Protein Tyrosine Kinase, Axl Back     alignment and domain information
>cd07860 STKc_CDK2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase 2 and 3 Back     alignment and domain information
>cd05116 PTKc_Syk Catalytic domain of the Protein Tyrosine Kinase, Spleen tyrosine kinase Back     alignment and domain information
>cd00192 PTKc Catalytic domain of Protein Tyrosine Kinases Back     alignment and domain information
>KOG0660 consensus Mitogen-activated protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd06659 STKc_PAK6 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 6 Back     alignment and domain information
>cd05080 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>cd05100 PTKc_FGFR3 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 3 Back     alignment and domain information
>KOG0574 consensus STE20-like serine/threonine kinase MST [Signal transduction mechanisms] Back     alignment and domain information
>cd07870 STKc_PFTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-2 kinase Back     alignment and domain information
>cd06917 STKc_NAK1_like Catalytic domain of Fungal Nak1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06617 PKc_MKK3_6 Catalytic domain of the dual-specificity Protein Kinases, MAP kinase kinases 3 and 6 Back     alignment and domain information
>cd06614 STKc_PAK Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase Back     alignment and domain information
>cd06636 STKc_MAP4K4_6 Catalytic domain of the Protein Serine/Threonine Kinases, Mitogen-Activated Protein Kinase Kinase Kinase Kinase 4 and 6 Back     alignment and domain information
>cd05041 PTKc_Fes_like Catalytic domain of Fes-like Protein Tyrosine Kinases Back     alignment and domain information
>PTZ00283 serine/threonine protein kinase; Provisional Back     alignment and domain information
>cd05109 PTKc_HER2 Catalytic domain of the Protein Tyrosine Kinase, HER2 Back     alignment and domain information
>smart00219 TyrKc Tyrosine kinase, catalytic domain Back     alignment and domain information
>cd07833 STKc_CDKL Catalytic domain of Cyclin-Dependent protein Kinase Like Serine/Threonine Kinases Back     alignment and domain information
>cd05577 STKc_GRK Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase Back     alignment and domain information
>cd05054 PTKc_VEGFR Catalytic domain of the Protein Tyrosine Kinases, Vascular Endothelial Growth Factor Receptors Back     alignment and domain information
>cd05613 STKc_MSK1_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 1 Back     alignment and domain information
>cd05082 PTKc_Csk Catalytic domain of the Protein Tyrosine Kinase, C-terminal Src kinase Back     alignment and domain information
>cd05572 STKc_cGK_PKG Catalytic domain of the Protein Serine/Threonine Kinase, cGMP-dependent protein kinase Back     alignment and domain information
>cd05586 STKc_Sck1_like Catalytic domain of Suppressor of loss of cAMP-dependent protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06608 STKc_myosinIII_like Catalytic domain of Class III myosin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06639 STKc_myosinIIIB Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIB myosin Back     alignment and domain information
>cd08528 STKc_Nek10 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 10 Back     alignment and domain information
>cd06627 STKc_Cdc7_like Catalytic domain of Cell division control protein 7-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07862 STKc_CDK6 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 6 Back     alignment and domain information
>cd05579 STKc_MAST_like Catalytic domain of Microtubule-associated serine/threonine kinase-like proteins Back     alignment and domain information
>cd05091 PTKc_Ror2 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 2 Back     alignment and domain information
>cd05060 PTKc_Syk_like Catalytic domain of Spleen Tyrosine Kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>KOG0201 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05083 PTKc_Chk Catalytic domain of the Protein Tyrosine Kinase, Csk homologous kinase Back     alignment and domain information
>KOG0577 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05058 PTKc_Met_Ron Catalytic domain of the Protein Tyrosine Kinases, Met and Ron Back     alignment and domain information
>cd06606 STKc_MAPKKK Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase Back     alignment and domain information
>KOG0584 consensus Serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>cd05581 STKc_PDK1 Catalytic domain of the Protein Serine/Threonine Kinase, Phosphoinositide-dependent kinase 1 Back     alignment and domain information
>cd07839 STKc_CDK5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 5 Back     alignment and domain information
>cd06607 STKc_TAO Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids proteins Back     alignment and domain information
>cd07864 STKc_CDK12 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 12 Back     alignment and domain information
>cd08226 PK_STRAD_beta Pseudokinase domain of STE20-related kinase adapter protein beta Back     alignment and domain information
>cd05047 PTKc_Tie Catalytic domain of Tie Protein Tyrosine Kinases Back     alignment and domain information
>cd05044 PTKc_c-ros Catalytic domain of the Protein Tyrosine Kinase, C-ros Back     alignment and domain information
>cd08217 STKc_Nek2 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 2 Back     alignment and domain information
>cd06657 STKc_PAK4 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 4 Back     alignment and domain information
>PHA03209 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd06648 STKc_PAK_II Catalytic domain of the Protein Serine/Threonine Kinase, Group II p21-activated kinase Back     alignment and domain information
>PLN00009 cyclin-dependent kinase A; Provisional Back     alignment and domain information
>cd07837 STKc_CdkB_plant Catalytic domain of the Serine/Threonine Kinase, Plant B-type Cyclin-Dependent protein Kinase Back     alignment and domain information
>cd08215 STKc_Nek Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase Back     alignment and domain information
>cd05611 STKc_Rim15_like Catalytic domain of fungal Rim15-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05110 PTKc_HER4 Catalytic domain of the Protein Tyrosine Kinase, HER4 Back     alignment and domain information
>cd07843 STKc_CDC2L1 Catalytic domain of the Serine/Threonine Kinase, Cell Division Cycle 2-like 1 Back     alignment and domain information
>cd08223 STKc_Nek4 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 4 Back     alignment and domain information
>PHA03211 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd07876 STKc_JNK2 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 2 Back     alignment and domain information
>cd05122 PKc_STE Catalytic domain of STE family Protein Kinases Back     alignment and domain information
>cd07842 STKc_CDK8_like Catalytic domain of Cyclin-Dependent protein Kinase 8-like Serine/Threonine Kinases Back     alignment and domain information
>cd07835 STKc_CDK1_like Catalytic domain of Cyclin-Dependent protein Kinase 1-like Serine/Threonine Kinases Back     alignment and domain information
>KOG4279 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd07878 STKc_p38beta_MAPK11 Catalytic domain of the Serine/Threonine Kinase, p38beta Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd07865 STKc_CDK9 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 9 Back     alignment and domain information
>cd06635 STKc_TAO1 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 1 Back     alignment and domain information
>cd05583 STKc_MSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase Back     alignment and domain information
>cd08222 STKc_Nek11 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 11 Back     alignment and domain information
>cd07831 STKc_MOK Catalytic domain of the Serine/Threonine Kinase, MAPK/MAK/MRK Overlapping Kinase Back     alignment and domain information
>KOG0579 consensus Ste20-like serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05074 PTKc_Tyro3 Catalytic domain of the Protein Tyrosine Kinase, Tyro3 Back     alignment and domain information
>PTZ00024 cyclin-dependent protein kinase; Provisional Back     alignment and domain information
>cd07840 STKc_CDK9_like Catalytic domain of Cyclin-Dependent protein Kinase 9-like Serine/Threonine Kinases Back     alignment and domain information
>cd08530 STKc_CNK2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii CNK2, and similar domains Back     alignment and domain information
>PTZ00036 glycogen synthase kinase; Provisional Back     alignment and domain information
>cd07863 STKc_CDK4 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 4 Back     alignment and domain information
>cd07854 STKc_MAPK4_6 Catalytic domain of the Serine/Threonine Kinases, Mitogen-Activated Protein Kinases 4 and 6 Back     alignment and domain information
>cd07856 STKc_Sty1_Hog1 Catalytic domain of the Serine/Threonine Kinases, Fungal Mitogen-Activated Protein Kinases Sty1 and Hog1 Back     alignment and domain information
>cd05633 STKc_GRK3 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 3 Back     alignment and domain information
>KOG0666 consensus Cyclin C-dependent kinase CDK8 [Transcription] Back     alignment and domain information
>PHA03207 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd07845 STKc_CDK10 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 10 Back     alignment and domain information
>cd07868 STKc_CDK8 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 8 Back     alignment and domain information
>cd08216 PK_STRAD Pseudokinase domain of STE20-related kinase adapter protein Back     alignment and domain information
>PHA03390 pk1 serine/threonine-protein kinase 1; Provisional Back     alignment and domain information
>cd07830 STKc_MAK_like Catalytic domain of Male germ cell-Associated Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>cd07855 STKc_ERK5 Catalytic domain of the Serine/Threonine Kinase, Extracellular signal-Regulated Kinase 5 Back     alignment and domain information
>cd07858 STKc_TEY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TEY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>cd07880 STKc_p38gamma_MAPK12 Catalytic domain of the Serine/Threonine Kinase, p38gamma Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd07875 STKc_JNK1 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 1 Back     alignment and domain information
>cd07874 STKc_JNK3 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 3 Back     alignment and domain information
>cd05606 STKc_beta_ARK Catalytic domain of the Protein Serine/Threonine Kinase, beta-adrenergic receptor kinase Back     alignment and domain information
>cd05123 STKc_AGC Catalytic domain of AGC family Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07877 STKc_p38alpha_MAPK14 Catalytic domain of the Serine/Threonine Kinase, p38alpha Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd06633 STKc_TAO3 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 3 Back     alignment and domain information
>cd07834 STKc_MAPK Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd07867 STKc_CDC2L6 Catalytic domain of Serine/Threonine Kinase, Cell Division Cycle 2-like 6 Back     alignment and domain information
>cd06634 STKc_TAO2 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 2 Back     alignment and domain information
>KOG0667 consensus Dual-specificity tyrosine-phosphorylation regulated kinase [General function prediction only] Back     alignment and domain information
>cd07849 STKc_ERK1_2_like Catalytic domain of Extracellular signal-Regulated Kinase 1 and 2-like Serine/Threonine Kinases Back     alignment and domain information
>KOG0587 consensus Traf2- and Nck-interacting kinase and related germinal center kinase (GCK) family protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd07852 STKc_MAPK15 Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase 15 Back     alignment and domain information
>KOG0690 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd07829 STKc_CDK_like Catalytic domain of Cyclin-Dependent protein Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd07850 STKc_JNK Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase Back     alignment and domain information
>PTZ00284 protein kinase; Provisional Back     alignment and domain information
>cd06616 PKc_MKK4 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 4 Back     alignment and domain information
>smart00221 STYKc Protein kinase; unclassified specificity Back     alignment and domain information
>PLN03224 probable serine/threonine protein kinase; Provisional Back     alignment and domain information
>cd06618 PKc_MKK7 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 7 Back     alignment and domain information
>cd05118 STKc_CMGC Catalytic domain of CMGC family Serine/Threonine Kinases Back     alignment and domain information
>PRK09188 serine/threonine protein kinase; Provisional Back     alignment and domain information
>cd07879 STKc_p38delta_MAPK13 Catalytic domain of the Serine/Threonine Kinase, p38delta Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd07838 STKc_CDK4_6_like Catalytic domain of Cyclin-Dependent protein Kinase 4 and 6-like Serine/Threonine Kinases Back     alignment and domain information
>cd07866 STKc_BUR1 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Bypass UAS Requirement 1 and similar proteins Back     alignment and domain information
>PHA03210 serine/threonine kinase US3; Provisional Back     alignment and domain information
>KOG1151 consensus Tousled-like protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1152 consensus Signal transduction serine/threonine kinase with PAS/PAC sensor domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG0599 consensus Phosphorylase kinase gamma subunit [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd07857 STKc_MPK1 Catalytic domain of the Serine/Threonine Kinase, Fungal Mitogen-Activated Protein Kinase MPK1 Back     alignment and domain information
>cd07851 STKc_p38 Catalytic domain of the Serine/Threonine Kinase, p38 Mitogen-Activated Protein Kinase Back     alignment and domain information
>KOG0576 consensus Mitogen-activated protein kinase kinase kinase kinase (MAP4K), germinal center kinase family [Signal transduction mechanisms] Back     alignment and domain information
>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05147 RIO1_euk RIO kinase family; eukaryotic RIO1, catalytic domain Back     alignment and domain information
>cd05576 STKc_RPK118_like Catalytic domain of the Protein Serine/Threonine Kinases, RPK118 and similar proteins Back     alignment and domain information
>KOG0604 consensus MAP kinase-activated protein kinase 2 [Signal transduction mechanisms] Back     alignment and domain information
>cd00180 PKc Catalytic domain of Protein Kinases Back     alignment and domain information
>KOG4701 consensus Chitinase [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>KOG4645 consensus MAPKKK (MAP kinase kinase kinase) SSK2 and related serine/threonine protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG0986 consensus G protein-coupled receptor kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1290 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0668 consensus Casein kinase II, alpha subunit [Signal transduction mechanisms; Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>PRK10345 hypothetical protein; Provisional Back     alignment and domain information
>KOG0608 consensus Warts/lats-like serine threonine kinases [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd05145 RIO1_like RIO kinase family; RIO1, RIO3 and similar proteins, catalytic domain Back     alignment and domain information
>smart00220 S_TKc Serine/Threonine protein kinases, catalytic domain Back     alignment and domain information
>KOG0669 consensus Cyclin T-dependent kinase CDK9 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK14879 serine/threonine protein kinase; Provisional Back     alignment and domain information
>KOG0664 consensus Nemo-like MAPK-related serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0695 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0671 consensus LAMMER dual specificity kinases [Signal transduction mechanisms] Back     alignment and domain information
>TIGR03724 arch_bud32 Kae1-associated kinase Bud32 Back     alignment and domain information
>KOG1345 consensus Serine/threonine kinase [Signal transduction mechanisms] Back     alignment and domain information
>PHA02882 putative serine/threonine kinase; Provisional Back     alignment and domain information
>smart00090 RIO RIO-like kinase Back     alignment and domain information
>PRK09605 bifunctional UGMP family protein/serine/threonine protein kinase; Validated Back     alignment and domain information
>KOG1027 consensus Serine/threonine protein kinase and endoribonuclease ERN1/IRE1, sensor of the unfolded protein response pathway [Signal transduction mechanisms] Back     alignment and domain information
>KOG1035 consensus eIF-2alpha kinase GCN2 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK10359 lipopolysaccharide core biosynthesis protein; Provisional Back     alignment and domain information
>KOG1006 consensus Mitogen-activated protein kinase (MAPK) kinase MKK4 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0696 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0984 consensus Mitogen-activated protein kinase (MAPK) kinase MKK3/MKK6 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0596 consensus Dual specificity; serine/threonine and tyrosine kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PLN03225 Serine/threonine-protein kinase SNT7; Provisional Back     alignment and domain information
>KOG0614 consensus cGMP-dependent protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1165 consensus Casein kinase (serine/threonine/tyrosine protein kinase) [Signal transduction mechanisms] Back     alignment and domain information
>KOG1163 consensus Casein kinase (serine/threonine/tyrosine protein kinase) [Signal transduction mechanisms] Back     alignment and domain information
>KOG1167 consensus Serine/threonine protein kinase of the CDC7 subfamily involved in DNA synthesis, repair and recombination [Replication, recombination and repair] Back     alignment and domain information
>cd06547 GH85_ENGase Endo-beta-N-acetylglucosaminidase (ENGase) hydrolyzes the N-N'-diacetylchitobiosyl core of N-glycosylproteins Back     alignment and domain information
>KOG1164 consensus Casein kinase (serine/threonine/tyrosine protein kinase) [Signal transduction mechanisms] Back     alignment and domain information
>cd05144 RIO2_C RIO kinase family; RIO2, C-terminal catalytic domain Back     alignment and domain information
>cd05120 APH_ChoK_like Aminoglycoside 3'-phosphotransferase (APH) and Choline Kinase (ChoK) family Back     alignment and domain information
>KOG0603 consensus Ribosomal protein S6 kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0983 consensus Mitogen-activated protein kinase (MAPK) kinase MKK7/JNKK2 [Signal transduction mechanisms] Back     alignment and domain information
>COG0515 SPS1 Serine/threonine protein kinase [General function prediction only / Signal transduction mechanisms / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>cd05119 RIO RIO kinase family, catalytic domain Back     alignment and domain information
>PRK12274 serine/threonine protein kinase; Provisional Back     alignment and domain information
>KOG0670 consensus U4/U6-associated splicing factor PRP4 [RNA processing and modification] Back     alignment and domain information
>cd05154 ACAD10_11_like Acyl-CoA dehydrogenase (ACAD) 10 and 11, N-terminal domain, and similar proteins Back     alignment and domain information
>KOG1166 consensus Mitotic checkpoint serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0665 consensus Jun-N-terminal kinase (JNK) [Signal transduction mechanisms] Back     alignment and domain information
>PF03644 Glyco_hydro_85: Glycosyl hydrolase family 85 ; InterPro: IPR005201 O-Glycosyl hydrolases 3 Back     alignment and domain information
>PF02638 DUF187: Glycosyl hydrolase like GH101; InterPro: IPR003790 This entry describes proteins of unknown function Back     alignment and domain information
>PRK01723 3-deoxy-D-manno-octulosonic-acid kinase; Reviewed Back     alignment and domain information
>PF13200 DUF4015: Putative glycosyl hydrolase domain Back     alignment and domain information
>KOG1023 consensus Natriuretic peptide receptor, guanylate cyclase [Signal transduction mechanisms] Back     alignment and domain information
>TIGR01982 UbiB 2-polyprenylphenol 6-hydroxylase Back     alignment and domain information
>PF11340 DUF3142: Protein of unknown function (DUF3142); InterPro: IPR021488 This bacterial family of proteins has no known function Back     alignment and domain information
>PRK04750 ubiB putative ubiquinone biosynthesis protein UbiB; Reviewed Back     alignment and domain information
>cd05151 ChoK Choline Kinase (ChoK) Back     alignment and domain information
>KOG1266 consensus Protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1243 consensus Protein kinase [General function prediction only] Back     alignment and domain information
>KOG3741 consensus Poly(A) ribonuclease subunit [RNA processing and modification] Back     alignment and domain information
>KOG0590 consensus Checkpoint kinase and related serine/threonine protein kinases [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms] Back     alignment and domain information
>KOG0603 consensus Ribosomal protein S6 kinase [Signal transduction mechanisms] Back     alignment and domain information
>PLN02876 acyl-CoA dehydrogenase Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>COG2112 Predicted Ser/Thr protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05146 RIO3_euk RIO kinase family; eukaryotic RIO3, catalytic domain Back     alignment and domain information
>PRK10593 hypothetical protein; Provisional Back     alignment and domain information
>PF08693 SKG6: Transmembrane alpha-helix domain; InterPro: IPR014805 SKG6 and AXL2 are membrane proteins that show polarised intracellular localisation [, ] Back     alignment and domain information
>KOG3087 consensus Serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>PF01636 APH: Phosphotransferase enzyme family This family is part of the larger protein kinase superfamily Back     alignment and domain information
>TIGR02172 Fb_sc_TIGR02172 Fibrobacter succinogenes paralogous family TIGR02172 Back     alignment and domain information
>KOG2331 consensus Predicted glycosylhydrolase [General function prediction only] Back     alignment and domain information
>KOG0601 consensus Cyclin-dependent kinase WEE1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0590 consensus Checkpoint kinase and related serine/threonine protein kinases [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG4158 consensus BRPK/PTEN-induced protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PF14883 GHL13: Hypothetical glycosyl hydrolase family 13 Back     alignment and domain information
>cd05150 APH Aminoglycoside 3'-phosphotransferase (APH) Back     alignment and domain information
>KOG0601 consensus Cyclin-dependent kinase WEE1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG0661 AarF Predicted unusual protein kinase [General function prediction only] Back     alignment and domain information
>PF04478 Mid2: Mid2 like cell wall stress sensor; InterPro: IPR007567 This family represents a region near the C terminus of Mid2, which contains a transmembrane region Back     alignment and domain information
>PF15102 TMEM154: TMEM154 protein family Back     alignment and domain information
>PRK15123 lipopolysaccharide core heptose(I) kinase RfaP; Provisional Back     alignment and domain information
>PF03109 ABC1: ABC1 family; InterPro: IPR004147 This entry includes ABC1 from yeast [] and AarF from Escherichia coli [] Back     alignment and domain information
>PRK09550 mtnK methylthioribose kinase; Reviewed Back     alignment and domain information
>PF01102 Glycophorin_A: Glycophorin A; InterPro: IPR001195 Proteins in this group are responsible for the molecular basis of the blood group antigens, surface markers on the outside of the red blood cell membrane Back     alignment and domain information
>PF13095 FTA2: Kinetochore Sim4 complex subunit FTA2 Back     alignment and domain information
>COG3642 Mn2+-dependent serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PRK09902 hypothetical protein; Provisional Back     alignment and domain information
>PF02439 Adeno_E3_CR2: Adenovirus E3 region protein CR2; InterPro: IPR003470 Early region 3 (E3) of human adenoviruses (Ads) codes for proteins that appear to control viral interactions with the host [] Back     alignment and domain information
>cd05157 ETNK_euk Ethanolamine kinase (ETNK) in eukaryotes Back     alignment and domain information
>PTZ00382 Variant-specific surface protein (VSP); Provisional Back     alignment and domain information
>COG1649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF14531 Kinase-like: Kinase-like; PDB: 3DZO_A 2W1Z_A 3BYV_A 3Q5Z_A 3Q60_A Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query580
3alg_A353 Crystal Structure Of Class V Chitinase (E115q Mutan 4e-60
3alf_A353 Crystal Structure Of Class V Chitinase From Nicotia 4e-60
3aqu_A356 Crystal Structure Of A Class V Chitinase From Arabi 6e-60
1guv_A366 Structure Of Human Chitotriosidase Length = 366 6e-28
1hki_A365 Crystal Structure Of Human Chitinase In Complex Wit 1e-27
1hkk_A364 High Resoultion Crystal Structure Of Human Chitinas 2e-27
1lg1_A365 Crystal Structure Of Human Chitotriosidase In Compl 2e-27
1waw_A445 Specificity And Affinity Of Natural Product Cyclope 3e-27
4ay1_A365 Human Ykl-39 Is A Pseudo-Chitinase With Retained Ch 8e-25
3fxy_A395 Acidic Mammalian Chinase, Catalytic Domain Length = 1e-23
2ybt_A381 Crystal Structure Of Human Acidic Chitinase In Comp 2e-23
1hjv_A362 Crystal Structure Of Hcgp-39 In Complex With Chitin 1e-22
1e9l_A377 The Crystal Structure Of Novel Mammalian Lectin Ym1 4e-22
1sr0_A361 Crystal Structure Of Signalling Protein From Sheep( 6e-20
1ljy_A361 Crystal Structure Of A Novel Regulatory 40 Kda Mamm 2e-19
1xhg_A361 Crystal Structure Of A 40 Kda Signalling Protein Fr 2e-19
2pi6_A361 Crystal Structure Of The Sheep Signalling Glycoprot 3e-19
1syt_A361 Crystal Structure Of Signalling Protein From Goat S 4e-19
2esc_A361 Crystal Structure Of A 40 Kda Protective Signalling 4e-19
1owq_A361 Crystal Structure Of A 40 Kda Signalling Protein (S 6e-19
1tfv_A361 Crystal Structure Of A Buffalo Signaling Glycoprote 8e-19
1zbv_A361 Crystal Structure Of The Goat Signalling Protein (S 8e-19
3uim_A 326 Structural Basis For The Impact Of Phosphorylation 7e-18
3tl8_A 349 The Avrptob-Bak1 Complex Reveals Two Structurally S 9e-18
1itx_A419 Catalytic Domain Of Chitinase A1 From Bacillus Circ 8e-14
2oib_A 301 Crystal Structure Of Irak4 Kinase Domain Apo Form L 8e-13
2nry_A 307 Crystal Structure Of Irak-4 Length = 307 8e-13
2nru_A 307 Crystal Structure Of Irak-4 Length = 307 8e-13
2qkw_B 321 Structural Basis For Activation Of Plant Immunity B 2e-12
3hgk_A 327 Crystal Structure Of Effect Protein Avrptob Complex 2e-12
3g6l_A406 The Crystal Structure Of A Chitinase Crchi1 From Th 3e-12
2o8y_A 298 Apo Irak4 Kinase Domain Length = 298 1e-11
1jnd_A420 Crystal Structure Of Imaginal Disc Growth Factor-2 2e-10
1eib_A540 Crystal Structure Of Chitinase A Mutant D313a Compl 3e-10
1d2k_A392 C. Immitis Chitinase 1 At 2.2 Angstroms Resolution 4e-10
1ll7_A392 Structure Of The E171q Mutant Of C. Immitis Chitina 4e-10
1ll6_A392 Structure Of The D169n Mutant Of C. Immitis Chitina 4e-10
1rd6_A563 Crystal Structure Of S. Marcescens Chitinase A Muta 4e-10
2wly_A548 Chitinase A From Serratia Marcescens Atcc990 In Com 5e-10
2wk2_A540 Chitinase A From Serratia Marcescens Atcc990 In Com 5e-10
1k9t_A540 Chitinase A Complexed With Tetra-N-Acetylchitotrios 1e-09
1ctn_A540 Crystal Structure Of A Bacterial Chitinase At 2.3 A 2e-09
1ffr_A540 Crystal Structure Of Chitinase A Mutant Y390f Compl 2e-09
1edq_A540 Crystal Structure Of Chitinase A From S. Marcescens 2e-09
1ehn_A540 Crystal Structure Of Chitinase A Mutant E315q Compl 2e-09
1nh6_A540 Structure Of S. Marcescens Chitinase A, E315l, Comp 2e-09
1w9p_A433 Specificity And Affinity Of Natural Product Cyclope 2e-09
1wno_A395 Crystal Structure Of A Native Chitinase From Asperg 3e-09
3ars_A584 Crystal Structure Analysis Of Chitinase A From Vibr 2e-08
3gvu_A 292 The Crystal Structure Of Human Abl2 In Complex With 3e-08
1e15_A499 Chitinase B From Serratia Marcescens Length = 499 3e-08
1e6n_B499 Chitinase B From Serratia Marcescens Inactive Mutan 4e-08
1ur9_A499 Interactions Of A Family 18 Chitinase With The Desi 4e-08
1ogb_A499 Chitinase B From Serratia Marcescens Mutant D142n L 4e-08
1h0g_A499 Complex Of A Chitinase With The Natural Product Cyc 4e-08
1e6z_A498 Chitinase B From Serratia Marcescens Wildtype In Co 4e-08
3b9a_A584 Crystal Structure Of Vibrio Harveyi Chitinase A Com 1e-07
3b8s_A584 Crystal Structure Of Wild-Type Chitinase A From Vib 1e-07
1goi_A499 Crystal Structure Of The D140n Mutant Of Chitinase 1e-07
4f0i_A 300 Crystal Structure Of Apo Trka Length = 300 4e-07
4gt5_A 306 Crystal Structure Of The Inactive Trka Kinase Domai 4e-07
3dk7_A 277 Crystal Structure Of Mutant Abl Kinase Domain In Co 4e-07
4aoj_A 329 Human Trka In Complex With The Inhibitor Az-23 Leng 4e-07
1opk_A 495 Structural Basis For The Auto-Inhibition Of C-Abl T 4e-07
1opl_A 537 Structural Basis For The Auto-Inhibition Of C-Abl T 5e-07
2fo0_A 495 Organization Of The Sh3-Sh2 Unit In Active And Inac 5e-07
3qrj_A 277 The Crystal Structure Of Human Abl1 Kinase Domain T 6e-07
3dk3_A 293 Crystal Structure Of Mutant Abl Kinase Domain In Co 6e-07
3qri_A 277 The Crystal Structure Of Human Abl1 Kinase Domain I 6e-07
2hyy_A 273 Human Abl Kinase Domain In Complex With Imatinib (S 7e-07
2hzi_A 277 Abl Kinase Domain In Complex With Pd180970 Length = 7e-07
3oy3_A 284 Crystal Structure Of Abl T315i Mutant Kinase Domain 7e-07
2z60_A 288 Crystal Structure Of The T315i Mutant Of Abl Kinase 7e-07
2hz0_A 270 Abl Kinase Domain In Complex With Nvp-Aeg082 Length 7e-07
2gqg_A 278 X-Ray Crystal Structure Of Dasatinib (Bms-354825) B 7e-07
2xa4_A 298 Inhibitors Of Jak2 Kinase Domain Length = 298 7e-07
2v7a_A 286 Crystal Structure Of The T315i Abl Mutant In Comple 7e-07
2e2b_A 293 Crystal Structure Of The C-Abl Kinase Domain In Com 8e-07
1fpu_A 293 Crystal Structure Of Abl Kinase Domain In Complex W 8e-07
2hiw_A 287 Crystal Structure Of Inactive Conformation Abl Kina 8e-07
2w1i_A 326 Structure Determination Of Aurora Kinase In Complex 8e-07
2g1t_A 287 A Src-Like Inactive Conformation In The Abl Tyrosin 8e-07
3pyy_A 298 Discovery And Characterization Of A Cell-Permeable, 8e-07
3e62_A 293 Fragment Based Discovery Of Jak-2 Inhibitors Length 8e-07
2g2f_A 287 A Src-Like Inactive Conformation In The Abl Tyrosin 8e-07
3oxz_A 284 Crystal Structure Of Abl Kinase Domain Bound With A 8e-07
3tjc_A 298 Co-Crystal Structure Of Jak2 With Thienopyridine 8 8e-07
4e4m_A 302 Jak2 Kinase (Jh1 Domain) In Complex With Compound 3 8e-07
4bbe_A 298 Aminoalkylpyrimidine Inhibitor Complexes With Jak2 8e-07
4aqc_A 301 Triazolopyridine-Based Inhibitor Of Janus Kinase 2 8e-07
3rvg_A 303 Crystals Structure Of Jak2 With A 1-Amino-5h-Pyrido 8e-07
4hge_A 300 Jak2 Kinase (Jh1 Domain) In Complex With Compound 8 8e-07
2qoh_A 288 Crystal Structure Of Abl Kinase Bound With Ppy-a Le 8e-07
2f4j_A 287 Structure Of The Kinase Domain Of An Imatinib-Resis 9e-07
3q32_A 301 Structure Of Janus Kinase 2 With A Pyrrolotriazine 9e-07
3lpb_A 295 Crystal Structure Of Jak2 Complexed With A Potent 2 9e-07
2b7a_A 293 The Structural Basis Of Janus Kinase 2 Inhibition B 9e-07
3ugc_A 295 Structural Basis Of Jak2 Inhibition By The Type Ii 9e-07
3io7_A 313 2-Aminopyrazolo[1,5-A]pyrimidines As Potent And Sel 1e-06
3jy9_A 311 Janus Kinase 2 Inhibitors Length = 311 1e-06
4asz_A 299 Crystal Structure Of Apo Trkb Kinase Domain Length 1e-06
3dk6_A 293 Crystal Structure Of Mutant Abl Kinase Domain In Co 2e-06
3bbt_B 328 Crystal Structure Of The Erbb4 Kinase In Complex Wi 2e-06
4e6d_A 298 Jak2 Kinase (Jh1 Domain) Triple Mutant In Complex W 2e-06
2r4b_A 321 Erbb4 Kinase Domain Complexed With A Thienopyrimidi 2e-06
4gt4_A 308 Structure Of Unliganded, Inactive Ror2 Kinase Domai 3e-06
1kfw_A435 Structure Of Catalytic Domain Of Psychrophilic Chit 3e-06
3zzw_A 289 Crystal Structure Of The Kinase Domain Of Ror2 Leng 4e-06
3v5q_A 297 Discovery Of A Selective Trk Inhibitor With Efficac 6e-06
4f1m_A 287 Crystal Structure Of The G1179s Roco4 Kinase Domain 8e-06
4f1o_A 287 Crystal Structure Of The L1180t Mutant Roco4 Kinase 9e-06
4f0f_A 287 Crystal Structure Of The Roco4 Kinase Domain Bound 9e-06
4fnw_A 327 Crystal Structure Of The Apo F1174l Anaplastic Lymp 1e-05
2yjr_A 342 Structure Of F1174l Mutant Anaplastic Lymphoma Kina 2e-05
4fob_A 353 Crystal Structure Of Human Anaplastic Lymphoma Kina 3e-05
4fnx_A 327 Crystal Structure Of The Apo R1275q Anaplastic Lymp 4e-05
4fnz_A 327 Crystal Structure Of Human Anaplastic Lymphoma Kina 4e-05
4dce_A 333 Crystal Structure Of Human Anaplastic Lymphoma Kina 4e-05
2qoo_A 373 Human Epha3 Kinase And Juxtamembrane Region, Y596f: 4e-05
2qok_A 373 Human Epha3 Kinase And Juxtamembrane Region, Y596f: 4e-05
2qoi_A 373 Human Epha3 Kinase And Juxtamembrane Region, Y596f: 4e-05
2gsf_A 373 The Human Epha3 Receptor Tyrosine Kinase And Juxtam 4e-05
2qof_A 373 Human Epha3 Kinase And Juxtamembrane Region, Y596f 4e-05
2qod_A 373 Human Epha3 Kinase And Juxtamembrane Region, Y602f 4e-05
2yhv_A 342 Structure Of L1196m Mutant Anaplastic Lymphoma Kina 4e-05
2qol_A 373 Human Epha3 Kinase And Juxtamembrane Region, Y596:y 4e-05
3fxx_A 371 Human Epha3 Kinase And Juxtamembrane Region Bound T 4e-05
3l9p_A 367 Crystal Structure Of The Anaplastic Lymphoma Kinase 4e-05
2yfx_A 327 Structure Of L1196m Mutant Anaplastic Lymphoma Kina 5e-05
3aox_A 344 X-Ray Crystal Structure Of Human Anaplastic Lymphom 5e-05
2xb7_A 315 Structure Of Human Anaplastic Lymphoma Kinase In Co 5e-05
2xp2_A 327 Structure Of The Human Anaplastic Lymphoma Kinase I 5e-05
3lct_A 344 Crystal Structure Of The Anaplastic Lymphoma Kinase 5e-05
2yjs_A 342 Structure Of C1156y Mutant Anaplastic Lymphoma Kina 7e-05
2qoc_A 344 Human Epha3 Kinase Domain, Phosphorylated, Amp-Pnp 7e-05
3kex_A 325 Crystal Structure Of The Catalytically Inactive Kin 7e-05
3omv_A 307 Crystal Structure Of C-Raf (Raf-1) Length = 307 8e-05
3lmg_A 344 Crystal Structure Of The Erbb3 Kinase Domain In Com 8e-05
3dzq_A 361 Human Epha3 Kinase Domain In Complex With Inhibitor 8e-05
1luf_A 343 Crystal Structure Of The Musk Tyrosine Kinase: Insi 9e-05
2r2p_A 295 Kinase Domain Of Human Ephrin Type-A Receptor 5 (Ep 1e-04
2vwu_A 302 Ephb4 Kinase Domain Inhibitor Complex Length = 302 1e-04
1mqb_A 333 Crystal Structure Of Ephrin A2 (Epha2) Receptor Pro 1e-04
4aw5_A 291 Complex Of The Ephb4 Kinase Domain With An Oxindole 2e-04
3ii5_A 306 The Complex Of Wild-Type B-Raf With Pyrazolo Pyrimi 2e-04
3idp_A 300 B-Raf V600e Kinase Domain In Complex With An Aminoi 2e-04
3d4q_A 307 Pyrazole-Based Inhibitors Of B-Raf Kinase Length = 2e-04
4g9r_A 307 B-Raf V600e Kinase Domain Bound To A Type Ii Dihydr 2e-04
2p0c_A 313 Catalytic Domain Of The Proto-Oncogene Tyrosine-Pro 2e-04
3qok_A420 Crystal Structure Of Putative Chitinase Ii From Kle 2e-04
4dbn_A 284 Crystal Structure Of The Kinase Domain Of Human B-R 2e-04
4h58_A 275 Braf In Complex With Compound 3 Length = 275 3e-04
3q96_A 282 B-Raf Kinase Domain In Complex With A Tetrahydronap 3e-04
2fb8_A 281 Structure Of The B-Raf Kinase Domain Bound To Sb-59 3e-04
4eoq_A 301 Thr 160 Phosphorylated Cdk2 Wt - Human Cyclin A3 Co 3e-04
4bcq_A 301 Structure Of Cdk2 In Complex With Cyclin A And A 2- 3e-04
3coh_A 268 Crystal Structure Of Aurora-A In Complex With A Pen 3e-04
4eos_A 300 Thr 160 Phosphorylated Cdk2 Wt - Human Cyclin A3 Co 3e-04
4eok_A 300 Thr 160 Phosphorylated Cdk2 H84s, Q85m, K89d - Huma 3e-04
3bht_A 300 Structure Of Phosphorylated Thr160 Cdk2CYCLIN A IN 3e-04
3ezr_A 300 Cdk-2 With Indazole Inhibitor 17 Bound At Its Activ 3e-04
1uwh_A 276 The Complex Of Wild Type B-Raf And Bay439006 Length 3e-04
4eoj_A 302 Thr 160 Phosphorylated Cdk2 H84s, Q85m, K89d - Huma 3e-04
4eop_A 300 Thr 160 Phosphorylated Cdk2 Q131e - Human Cyclin A3 3e-04
1uwj_A 276 The Complex Of Mutant V599e B-raf And Bay439006 Len 3e-04
3c4c_A 280 B-Raf Kinase In Complex With Plx4720 Length = 280 3e-04
4eoo_A 299 Thr 160 Phosphorylated Cdk2 Q131e - Human Cyclin A3 3e-04
2jgz_A 289 Crystal Structure Of Phospho-Cdk2 In Complex With C 3e-04
1ogu_A 302 Structure Of Human Thr160-phospho Cdk2/cyclin A Com 3e-04
4eoi_A 299 Thr 160 Phosphorylated Cdk2 K89d, Q131e - Human Cyc 3e-04
1qmz_A 299 Phosphorylated Cdk2-Cyclyin A-Substrate Peptide Com 3e-04
4eon_A 300 Thr 160 Phosphorylated Cdk2 H84s, Q85m, Q131e - Hum 3e-04
4eom_A 301 Thr 160 Phosphorylated Cdk2 H84s, Q85m, Q131e - Hum 3e-04
2qon_A 373 Human Epha3 Kinase And Juxtamembrane Region, Y596f: 3e-04
2iw6_A 302 Structure Of Human Thr160-Phospho Cdk2-Cyclin A Com 3e-04
1e9h_A 297 Thr 160 Phosphorylated Cdk2-Human Cyclin A3 Complex 3e-04
1gz8_A 299 Human Cyclin Dependent Kinase 2 Complexed With The 3e-04
1h1p_A 303 Structure Of Human Thr160-Phospho Cdk2CYCLIN A COMP 3e-04
3og7_A 289 B-Raf Kinase V600e Oncogenic Mutant In Complex With 3e-04
2qo7_A 373 Human Epha3 Kinase And Juxtamembrane Region, Dephos 3e-04
1w98_A 298 The Structural Basis Of Cdk2 Activation By Cyclin E 3e-04
1oit_A 299 Imidazopyridines: A Potent And Selective Class Of C 3e-04
2w17_A 299 Cdk2 In Complex With The Imidazole Pyrimidine Amide 3e-04
1fin_A 298 Cyclin A-Cyclin-Dependent Kinase 2 Complex Length = 3e-04
3pj8_A 299 Structure Of Cdk2 In Complex With A Pyrazolo[4,3-D] 3e-04
4fk3_A 292 B-Raf Kinase V600e Oncogenic Mutant In Complex With 3e-04
4i3z_A 296 Structure Of Pcdk2CYCLINA BOUND TO ADP AND 2 MAGNES 4e-04
1vyw_A 309 Structure Of Cdk2CYCLIN A WITH PNU-292137 Length = 4e-04
1pf8_A 298 Crystal Structure Of Human Cyclin-dependent Kinase 4e-04
3qhr_A 298 Structure Of A Pcdk2CYCLINA TRANSITION-State Mimic 4e-04
1jst_A 298 Phosphorylated Cyclin-Dependent Kinase-2 Bound To C 4e-04
4erw_A 306 Cdk2 In Complex With Staurosporine Length = 306 4e-04
3pxf_A 306 Cdk2 In Complex With Two Molecules Of 8-Anilino-1-N 4e-04
3d14_A 272 Crystal Structure Of Mouse Aurora A (Asn186->gly, L 4e-04
3a4o_X 286 Lyn Kinase Domain Length = 286 5e-04
3daj_A 272 Crystal Structure Of Aurora A Complexed With An Inh 5e-04
3w2o_A 331 Egfr Kinase Domain T790m/l858r Mutant With Tak-285 5e-04
3h0y_A 268 Aurora A In Complex With A Bisanilinopyrimidine Len 5e-04
3qbn_A 281 Structure Of Human Aurora A In Complex With A Diami 5e-04
2qob_A 344 Human Epha3 Kinase Domain, Base Structure Length = 5e-04
2iw8_A 302 Structure Of Human Thr160-Phospho Cdk2-Cyclin A F82 5e-04
1fmk_A 452 Crystal Structure Of Human Tyrosine-Protein Kinase 5e-04
3ika_A 331 Crystal Structure Of Egfr 696-1022 T790m Mutant Cov 5e-04
2h8h_A 535 Src Kinase In Complex With A Quinazoline Inhibitor 5e-04
3lau_A 287 Crystal Structure Of Aurora2 Kinase In Complex With 5e-04
1y57_A 452 Structure Of Unphosphorylated C-Src In Complex With 5e-04
3o50_A 267 Crystal Structure Of Benzamide 9 Bound To Auroraa L 5e-04
2jiv_A 328 Crystal Structure Of Egfr Kinase Domain T790m Mutat 5e-04
1ol6_A 282 Structure Of Unphosphorylated D274n Mutant Of Auror 6e-04
4g5p_A 330 Crystal Structure Of Egfr Kinase T790m In Complex W 6e-04
2zv7_A 279 Lyn Tyrosine Kinase Domain, Apo Form Length = 279 6e-04
4i21_A 329 Crystal Structure Of L858r + T790m Egfr Kinase Doma 6e-04
3unz_A 279 Aurora A In Complex With Rpm1679 Length = 279 6e-04
3fdn_A 279 Structure-Based Drug Design Of Novel Aurora Kinase 6e-04
2jiu_A 328 Crystal Structure Of Egfr Kinase Domain T790m Mutat 6e-04
4i24_A 329 Structure Of T790m Egfr Kinase Domain Co-crystalliz 6e-04
4i1z_A 329 Crystal Structure Of The Monomeric (v948r) Form Of 6e-04
2c6e_A 283 Aurora A Kinase Activated Mutant (T287d) In Complex 6e-04
3e5a_A 268 Crystal Structure Of Aurora A In Complex With Vx-68 6e-04
2dwb_A 285 Aurora-A Kinase Complexed With Amppnp Length = 285 6e-04
3r21_A 271 Design, Synthesis, And Biological Evaluation Of Pyr 6e-04
2c6d_A 275 Aurora A Kinase Activated Mutant (T287d) In Complex 6e-04
1gii_A 298 Human Cyclin Dependent Kinase 2 Complexed With The 6e-04
2xng_A 283 Structure Of Aurora-A Bound To A Selective Imidazop 6e-04
2wtv_A 285 Aurora-A Inhibitor Structure Length = 285 6e-04
2jit_A 327 Crystal Structure Of Egfr Kinase Domain T790m Mutat 6e-04
2x6d_A 285 Aurora-A Bound To An Inhibitor Length = 285 6e-04
1mq4_A 272 Crystal Structure Of Aurora-A Protein Kinase Length 6e-04
3nrm_A 283 Imidazo[1,2-A]pyrazine-Based Aurora Kinase Inhibito 6e-04
2w1d_A 275 Structure Determination Of Aurora Kinase In Complex 6e-04
3gbz_A 329 Structure Of The Cmgc Cdk Kinase From Giardia Lambl 6e-04
2w1c_A 275 Structure Determination Of Aurora Kinase In Complex 6e-04
2j50_A 280 Structure Of Aurora-2 In Complex With Pha-739358 Le 6e-04
1ol5_A 282 Structure Of Aurora-A 122-403, Phosphorylated On Th 6e-04
3ha6_A 268 Crystal Structure Of Aurora A In Complex With Tpx2 6e-04
2xne_A 272 Structure Of Aurora-A Bound To An Imidazopyrazine I 6e-04
2wtw_A 285 Aurora-A Inhibitor Structure (2nd Crystal Form) Len 6e-04
1muo_A 297 Crystal Structure Of Aurora-2, An Oncogenic Serine- 6e-04
2xru_A 280 Aurora-A T288e Complexed With Pha-828300 Length = 2 7e-04
1m14_A 333 Tyrosine Kinase Domain From Epidermal Growth Factor 7e-04
2bmc_A 306 Aurora-2 T287d T288d Complexed With Pha-680632 Leng 7e-04
3bel_A 315 X-Ray Structure Of Egfr In Complex With Oxime Inhib 7e-04
4hjo_A 337 Crystal Structure Of The Inactive Egfr Tyrosine Kin 7e-04
4i20_A 329 Crystal Structure Of Monomeric (v948r) Primary Onco 7e-04
1ksw_A 452 Structure Of Human C-Src Tyrosine Kinase (Thr338gly 7e-04
3miy_A 266 X-Ray Crystal Structure Of Itk Complexed With Sunit 7e-04
2gs7_A 330 Crystal Structure Of The Inactive Egfr Kinase Domai 7e-04
4i23_A 329 Crystal Structure Of The Wild-type Egfr Kinase Doma 7e-04
4g5j_A 330 Crystal Structure Of Egfr Kinase In Complex With Bi 7e-04
2j5e_A 327 Crystal Structure Of Egfr Kinase Domain In Complex 7e-04
2gs2_A 330 Crystal Structure Of The Active Egfr Kinase Domain 7e-04
3vjo_A 334 Crystal Structure Of The Wild-Type Egfr Kinase Doma 7e-04
2itt_A 327 Crystal Structure Of Egfr Kinase Domain L858r Mutat 7e-04
2eb3_A 334 Crystal Structure Of Mutated Egfr Kinase Domain (L8 7e-04
3lw0_A 304 Igf-1rk In Complex With Ligand Msc1609119a-1 Length 8e-04
1xkk_A 352 Egfr Kinase Domain Complexed With A Quinazoline Inh 8e-04
2j5f_A 327 Crystal Structure Of Egfr Kinase Domain In Complex 8e-04
2rfd_A 324 Crystal Structure Of The Complex Between The Egfr K 8e-04
2j4z_A 306 Structure Of Aurora-2 In Complex With Pha-680626 Le 8e-04
3lvp_A 336 Crystal Structure Of Bisphosphorylated Igf1-R Kinas 8e-04
1p4o_A 322 Structure Of Apo Unactivated Igf-1r Kinase Domain A 8e-04
3oz6_A 388 Crystal Structure Of Mapk From Cryptosporidium Parv 9e-04
3i81_A 315 Crystal Structure Of Insulin-Like Growth Factor 1 R 9e-04
1jqh_A 308 Igf-1 Receptor Kinase Domain Length = 308 9e-04
2wqe_A 262 Structure Of S155r Aurora-A Somatic Mutant Length = 9e-04
2zm3_A 308 Complex Structure Of Insulin-Like Growth Factor Rec 9e-04
2oj9_A 307 Structure Of Igf-1r Kinase Domain Complexed With A 9e-04
3dqw_A 286 C-Src Kinase Domain Thr338ile Mutant In Complex Wit 9e-04
>pdb|3ALG|A Chain A, Crystal Structure Of Class V Chitinase (E115q Mutant) From Nicotiana Tobaccum In Complex With Nag4 Length = 353 Back     alignment and structure

Iteration: 1

Score = 229 bits (583), Expect = 4e-60, Method: Compositional matrix adjust. Identities = 138/351 (39%), Positives = 203/351 (57%), Gaps = 17/351 (4%) Query: 27 IRVGYLNLSEVSTISGINYDLFTHLICSSADINSTTYQLSLSLPSDENQIAKFADTVKKK 86 ++ GY ++ I+ LFTHL C+ AD+N QL +S P +++ +F TV++K Sbjct: 4 VKGGYWFKDSGLALNNIDSTLFTHLFCAFADLNPQLNQLIIS-PENQDSFRQFTSTVQRK 62 Query: 87 NPSITTILSIGQGKDTNYSIYSSMVRNSSHRKSFIDSSIRIARLYGFRGLDFAWTAPNTS 146 NPS+ T LSI G+ N + Y M R + RKSFIDSSIR+AR GF GLD W P ++ Sbjct: 63 NPSVKTFLSIAGGR-ANSTAYGIMARQPNSRKSFIDSSIRLARQLGFHGLDLDWQYPLSA 121 Query: 147 TDMFNIGLLFDEWRIAATKLDAKNSTRQQSLLILTARFRYSPPAN--SYLLNSIQRNLNW 204 DM N+G L +EWR A +A+NS R + L+LTA SP N +Y + S+ RNL+W Sbjct: 122 ADMTNLGTLLNEWR-TAINTEARNSGR--AALLLTAAVSNSPRVNGLNYPVESLARNLDW 178 Query: 205 IHAVTASYYEP-VSTNFTAPPAALYGSISGRFARSTDQVLKAWIERGLSADKLVMCLPFY 263 I+ + +Y P S + T A L+ ++ S + AWI+ G+ KLV+ +PFY Sbjct: 179 INLMAYDFYGPNWSPSQTNSHAQLFDPVN---HVSGSDGINAWIQAGVPTKKLVLGIPFY 235 Query: 264 GYAWTLVKPEDNGIGAAAAGPA---LYDSGLVTYKKIKNHIKTYGPDVQVMYNSTYEVNY 320 GYAW LV +G+ A AAG + D G +TY +I+++I +YN+T +Y Sbjct: 236 GYAWRLVNANIHGLRAPAAGKSNVGAVDDGSMTYNRIRDYIVE--SRATTVYNATIVGDY 293 Query: 321 FSTGTVWFGFDDVEAVRAKIAYAKEKRLLGYYAWQVSFDDHDWLLSQAAAQ 371 +G+ W +DD + VR K+ Y K + LLGY+AW V+ D +W LS+ A+Q Sbjct: 294 CYSGSNWISYDDTQTVRNKVNYVKGRGLLGYFAWHVA-GDQNWGLSRTASQ 343
>pdb|3ALF|A Chain A, Crystal Structure Of Class V Chitinase From Nicotiana Tobaccum Length = 353 Back     alignment and structure
>pdb|3AQU|A Chain A, Crystal Structure Of A Class V Chitinase From Arabidopsis Thaliana Length = 356 Back     alignment and structure
>pdb|1GUV|A Chain A, Structure Of Human Chitotriosidase Length = 366 Back     alignment and structure
>pdb|1HKI|A Chain A, Crystal Structure Of Human Chitinase In Complex With Glucoallosamidin B Length = 365 Back     alignment and structure
>pdb|1HKK|A Chain A, High Resoultion Crystal Structure Of Human Chitinase In Complex With Allosamidin Length = 364 Back     alignment and structure
>pdb|1LG1|A Chain A, Crystal Structure Of Human Chitotriosidase In Complex With Chitobiose Length = 365 Back     alignment and structure
>pdb|1WAW|A Chain A, Specificity And Affinity Of Natural Product Cyclopentapeptide Inhibitor Argadin Against Human Chitinase Length = 445 Back     alignment and structure
>pdb|4AY1|A Chain A, Human Ykl-39 Is A Pseudo-Chitinase With Retained Chitooligosaccharide Binding Properties Length = 365 Back     alignment and structure
>pdb|3FXY|A Chain A, Acidic Mammalian Chinase, Catalytic Domain Length = 395 Back     alignment and structure
>pdb|2YBT|A Chain A, Crystal Structure Of Human Acidic Chitinase In Complex With Bisdionin C Length = 381 Back     alignment and structure
>pdb|1HJV|A Chain A, Crystal Structure Of Hcgp-39 In Complex With Chitin Tetramer Length = 362 Back     alignment and structure
>pdb|1E9L|A Chain A, The Crystal Structure Of Novel Mammalian Lectin Ym1 Suggests A Saccharide Binding Site Length = 377 Back     alignment and structure
>pdb|1SR0|A Chain A, Crystal Structure Of Signalling Protein From Sheep(Sps-40) At 3.0a Resolution Using Crystal Grown In The Presence Of Polysaccharides Length = 361 Back     alignment and structure
>pdb|1LJY|A Chain A, Crystal Structure Of A Novel Regulatory 40 Kda Mammary Gland Protein (Mgp-40) Secreted During Involution Length = 361 Back     alignment and structure
>pdb|1XHG|A Chain A, Crystal Structure Of A 40 Kda Signalling Protein From Porcine (spp-40) At 2.89a Resolution Length = 361 Back     alignment and structure
>pdb|2PI6|A Chain A, Crystal Structure Of The Sheep Signalling Glycoprotein (Sps-40) Complex With 2-Methyl-2-4-Pentanediol At 1.65a Resolution Reveals Specific Binding Characteristics Of Sps-40 Length = 361 Back     alignment and structure
>pdb|1SYT|A Chain A, Crystal Structure Of Signalling Protein From Goat Spg-40 In The Presense Of N,n',n''-triacetyl-chitotriose At 2.6a Resolution Length = 361 Back     alignment and structure
>pdb|2ESC|A Chain A, Crystal Structure Of A 40 Kda Protective Signalling Protein From Bovine (Spc-40) At 2.1 A Resolution Length = 361 Back     alignment and structure
>pdb|1OWQ|A Chain A, Crystal Structure Of A 40 Kda Signalling Protein (Spc-40) Secreted During Involution Length = 361 Back     alignment and structure
>pdb|1TFV|A Chain A, Crystal Structure Of A Buffalo Signaling Glycoprotein (Spb-40) Secreted During Involution Length = 361 Back     alignment and structure
>pdb|1ZBV|A Chain A, Crystal Structure Of The Goat Signalling Protein (Spg-40) Complexed With A Designed Peptide Trp-Pro-Trp At 3.2a Resolution Length = 361 Back     alignment and structure
>pdb|3UIM|A Chain A, Structural Basis For The Impact Of Phosphorylation On Plant Receptor- Like Kinase Bak1 Activation Length = 326 Back     alignment and structure
>pdb|3TL8|A Chain A, The Avrptob-Bak1 Complex Reveals Two Structurally Similar Kinaseinteracting Domains In A Single Type Iii Effector Length = 349 Back     alignment and structure
>pdb|1ITX|A Chain A, Catalytic Domain Of Chitinase A1 From Bacillus Circulans Wl-12 Length = 419 Back     alignment and structure
>pdb|2OIB|A Chain A, Crystal Structure Of Irak4 Kinase Domain Apo Form Length = 301 Back     alignment and structure
>pdb|2NRY|A Chain A, Crystal Structure Of Irak-4 Length = 307 Back     alignment and structure
>pdb|2NRU|A Chain A, Crystal Structure Of Irak-4 Length = 307 Back     alignment and structure
>pdb|2QKW|B Chain B, Structural Basis For Activation Of Plant Immunity By Bacterial Effector Protein Avrpto Length = 321 Back     alignment and structure
>pdb|3HGK|A Chain A, Crystal Structure Of Effect Protein Avrptob Complexed With Kinase Pto Length = 327 Back     alignment and structure
>pdb|3G6L|A Chain A, The Crystal Structure Of A Chitinase Crchi1 From The Nematophagous Fungus Clonostachys Rosea Length = 406 Back     alignment and structure
>pdb|2O8Y|A Chain A, Apo Irak4 Kinase Domain Length = 298 Back     alignment and structure
>pdb|1JND|A Chain A, Crystal Structure Of Imaginal Disc Growth Factor-2 Length = 420 Back     alignment and structure
>pdb|1EIB|A Chain A, Crystal Structure Of Chitinase A Mutant D313a Complexed With Octa-N- Acetylchitooctaose (Nag)8 Length = 540 Back     alignment and structure
>pdb|1D2K|A Chain A, C. Immitis Chitinase 1 At 2.2 Angstroms Resolution Length = 392 Back     alignment and structure
>pdb|1LL7|A Chain A, Structure Of The E171q Mutant Of C. Immitis Chitinase 1 Length = 392 Back     alignment and structure
>pdb|1LL6|A Chain A, Structure Of The D169n Mutant Of C. Immitis Chitinase 1 Length = 392 Back     alignment and structure
>pdb|1RD6|A Chain A, Crystal Structure Of S. Marcescens Chitinase A Mutant W167a Length = 563 Back     alignment and structure
>pdb|2WLY|A Chain A, Chitinase A From Serratia Marcescens Atcc990 In Complex With Chitotrio-Thiazoline. Length = 548 Back     alignment and structure
>pdb|2WK2|A Chain A, Chitinase A From Serratia Marcescens Atcc990 In Complex With Chitotrio-Thiazoline Dithioamide Length = 540 Back     alignment and structure
>pdb|1K9T|A Chain A, Chitinase A Complexed With Tetra-N-Acetylchitotriose Length = 540 Back     alignment and structure
>pdb|1CTN|A Chain A, Crystal Structure Of A Bacterial Chitinase At 2.3 Angstroms Resolution Length = 540 Back     alignment and structure
>pdb|1FFR|A Chain A, Crystal Structure Of Chitinase A Mutant Y390f Complexed With Hexa-n- Acetylchitohexaose (nag)6 Length = 540 Back     alignment and structure
>pdb|1EDQ|A Chain A, Crystal Structure Of Chitinase A From S. Marcescens At 1.55 Angstroms Length = 540 Back     alignment and structure
>pdb|1EHN|A Chain A, Crystal Structure Of Chitinase A Mutant E315q Complexed With Octa-N- Acetylchitooctaose (Nag)8 Length = 540 Back     alignment and structure
>pdb|1NH6|A Chain A, Structure Of S. Marcescens Chitinase A, E315l, Complex With Hexasaccharide Length = 540 Back     alignment and structure
>pdb|1W9P|A Chain A, Specificity And Affinity Of Natural Product Cyclopentapeptide Inhibitors Against Aspergillus Fumigatus, Human And Bacterial Chitinasefra Length = 433 Back     alignment and structure
>pdb|1WNO|A Chain A, Crystal Structure Of A Native Chitinase From Aspergillus Fumigatus Yj- 407 Length = 395 Back     alignment and structure
>pdb|3ARS|A Chain A, Crystal Structure Analysis Of Chitinase A From Vibrio Harveyi With Novel Inhibitors - Apo Structure Of Mutant W275g Length = 584 Back     alignment and structure
>pdb|3GVU|A Chain A, The Crystal Structure Of Human Abl2 In Complex With Gleevec Length = 292 Back     alignment and structure
>pdb|1E15|A Chain A, Chitinase B From Serratia Marcescens Length = 499 Back     alignment and structure
>pdb|1E6N|B Chain B, Chitinase B From Serratia Marcescens Inactive Mutant E144q In Complex With N-Acetylglucosamine-Pentamer Length = 499 Back     alignment and structure
>pdb|1UR9|A Chain A, Interactions Of A Family 18 Chitinase With The Designed Inhibitor Hm508, And Its Degradation Product, Chitobiono-Delta-Lactone Length = 499 Back     alignment and structure
>pdb|1OGB|A Chain A, Chitinase B From Serratia Marcescens Mutant D142n Length = 499 Back     alignment and structure
>pdb|1H0G|A Chain A, Complex Of A Chitinase With The Natural Product Cyclopentapeptide Argadin From Clonostachys Length = 499 Back     alignment and structure
>pdb|1E6Z|A Chain A, Chitinase B From Serratia Marcescens Wildtype In Complex With Catalytic Intermediate Length = 498 Back     alignment and structure
>pdb|3B9A|A Chain A, Crystal Structure Of Vibrio Harveyi Chitinase A Complexed With Hexasaccharide Length = 584 Back     alignment and structure
>pdb|3B8S|A Chain A, Crystal Structure Of Wild-Type Chitinase A From Vibrio Harveyi Length = 584 Back     alignment and structure
>pdb|1GOI|A Chain A, Crystal Structure Of The D140n Mutant Of Chitinase B From Serratia Marcescens At 1.45 A Resolution Length = 499 Back     alignment and structure
>pdb|4F0I|A Chain A, Crystal Structure Of Apo Trka Length = 300 Back     alignment and structure
>pdb|4GT5|A Chain A, Crystal Structure Of The Inactive Trka Kinase Domain Length = 306 Back     alignment and structure
>pdb|3DK7|A Chain A, Crystal Structure Of Mutant Abl Kinase Domain In Complex With Small Molecule Fragment Length = 277 Back     alignment and structure
>pdb|4AOJ|A Chain A, Human Trka In Complex With The Inhibitor Az-23 Length = 329 Back     alignment and structure
>pdb|1OPK|A Chain A, Structural Basis For The Auto-Inhibition Of C-Abl Tyrosine Kinase Length = 495 Back     alignment and structure
>pdb|1OPL|A Chain A, Structural Basis For The Auto-Inhibition Of C-Abl Tyrosine Kinase Length = 537 Back     alignment and structure
>pdb|3QRJ|A Chain A, The Crystal Structure Of Human Abl1 Kinase Domain T315i Mutant In Complex With Dcc-2036 Length = 277 Back     alignment and structure
>pdb|3DK3|A Chain A, Crystal Structure Of Mutant Abl Kinase Domain In Complex With Small Molecule Fragment Length = 293 Back     alignment and structure
>pdb|3QRI|A Chain A, The Crystal Structure Of Human Abl1 Kinase Domain In Complex With Dcc- 2036 Length = 277 Back     alignment and structure
>pdb|2HYY|A Chain A, Human Abl Kinase Domain In Complex With Imatinib (Sti571, Glivec) Length = 273 Back     alignment and structure
>pdb|2HZI|A Chain A, Abl Kinase Domain In Complex With Pd180970 Length = 277 Back     alignment and structure
>pdb|3OY3|A Chain A, Crystal Structure Of Abl T315i Mutant Kinase Domain Bound With A Dfg- Out Inhibitor Ap24589 Length = 284 Back     alignment and structure
>pdb|2Z60|A Chain A, Crystal Structure Of The T315i Mutant Of Abl Kinase Bound With Ppy-A Length = 288 Back     alignment and structure
>pdb|2HZ0|A Chain A, Abl Kinase Domain In Complex With Nvp-Aeg082 Length = 270 Back     alignment and structure
>pdb|2GQG|A Chain A, X-Ray Crystal Structure Of Dasatinib (Bms-354825) Bound To Activated Abl Kinase Domain Length = 278 Back     alignment and structure
>pdb|2XA4|A Chain A, Inhibitors Of Jak2 Kinase Domain Length = 298 Back     alignment and structure
>pdb|2V7A|A Chain A, Crystal Structure Of The T315i Abl Mutant In Complex With The Inhibitor Pha-739358 Length = 286 Back     alignment and structure
>pdb|2E2B|A Chain A, Crystal Structure Of The C-Abl Kinase Domain In Complex With Inno-406 Length = 293 Back     alignment and structure
>pdb|1FPU|A Chain A, Crystal Structure Of Abl Kinase Domain In Complex With A Small Molecule Inhibitor Length = 293 Back     alignment and structure
>pdb|2HIW|A Chain A, Crystal Structure Of Inactive Conformation Abl Kinase Catalytic Domain Complexed With Type Ii Inhibitor Length = 287 Back     alignment and structure
>pdb|2W1I|A Chain A, Structure Determination Of Aurora Kinase In Complex With Inhibitor Length = 326 Back     alignment and structure
>pdb|2G1T|A Chain A, A Src-Like Inactive Conformation In The Abl Tyrosine Kinase Domain Length = 287 Back     alignment and structure
>pdb|3PYY|A Chain A, Discovery And Characterization Of A Cell-Permeable, Small-Molecule C- Abl Kinase Activator That Binds To The Myristoyl Binding Site Length = 298 Back     alignment and structure
>pdb|3E62|A Chain A, Fragment Based Discovery Of Jak-2 Inhibitors Length = 293 Back     alignment and structure
>pdb|2G2F|A Chain A, A Src-Like Inactive Conformation In The Abl Tyrosine Kinase Domain Length = 287 Back     alignment and structure
>pdb|3OXZ|A Chain A, Crystal Structure Of Abl Kinase Domain Bound With A Dfg-Out Inhibitor Ap24534 Length = 284 Back     alignment and structure
>pdb|3TJC|A Chain A, Co-Crystal Structure Of Jak2 With Thienopyridine 8 Length = 298 Back     alignment and structure
>pdb|4E4M|A Chain A, Jak2 Kinase (Jh1 Domain) In Complex With Compound 30 Length = 302 Back     alignment and structure
>pdb|4BBE|A Chain A, Aminoalkylpyrimidine Inhibitor Complexes With Jak2 Length = 298 Back     alignment and structure
>pdb|4AQC|A Chain A, Triazolopyridine-Based Inhibitor Of Janus Kinase 2 Length = 301 Back     alignment and structure
>pdb|3RVG|A Chain A, Crystals Structure Of Jak2 With A 1-Amino-5h-Pyrido[4,3-B]indol-4- Carboxamide Inhibitor Length = 303 Back     alignment and structure
>pdb|4HGE|A Chain A, Jak2 Kinase (Jh1 Domain) In Complex With Compound 8 Length = 300 Back     alignment and structure
>pdb|2QOH|A Chain A, Crystal Structure Of Abl Kinase Bound With Ppy-a Length = 288 Back     alignment and structure
>pdb|2F4J|A Chain A, Structure Of The Kinase Domain Of An Imatinib-Resistant Abl Mutant In Complex With The Aurora Kinase Inhibitor Vx-680 Length = 287 Back     alignment and structure
>pdb|3Q32|A Chain A, Structure Of Janus Kinase 2 With A Pyrrolotriazine Inhibitor Length = 301 Back     alignment and structure
>pdb|3LPB|A Chain A, Crystal Structure Of Jak2 Complexed With A Potent 2,8-Diaryl Quinoxaline Inhibitor Length = 295 Back     alignment and structure
>pdb|2B7A|A Chain A, The Structural Basis Of Janus Kinase 2 Inhibition By A Potent And Specific Pan-Janus Kinase Inhibitor Length = 293 Back     alignment and structure
>pdb|3UGC|A Chain A, Structural Basis Of Jak2 Inhibition By The Type Ii Inhibtor Nvp-Bbt594 Length = 295 Back     alignment and structure
>pdb|3IO7|A Chain A, 2-Aminopyrazolo[1,5-A]pyrimidines As Potent And Selective Inhibitors Of Jak2 Length = 313 Back     alignment and structure
>pdb|3JY9|A Chain A, Janus Kinase 2 Inhibitors Length = 311 Back     alignment and structure
>pdb|4ASZ|A Chain A, Crystal Structure Of Apo Trkb Kinase Domain Length = 299 Back     alignment and structure
>pdb|3DK6|A Chain A, Crystal Structure Of Mutant Abl Kinase Domain In Complex With Small Molecule Fragment Length = 293 Back     alignment and structure
>pdb|3BBT|B Chain B, Crystal Structure Of The Erbb4 Kinase In Complex With Lapatinib Length = 328 Back     alignment and structure
>pdb|4E6D|A Chain A, Jak2 Kinase (Jh1 Domain) Triple Mutant In Complex With Compound 7 Length = 298 Back     alignment and structure
>pdb|2R4B|A Chain A, Erbb4 Kinase Domain Complexed With A Thienopyrimidine Inhibitor Length = 321 Back     alignment and structure
>pdb|4GT4|A Chain A, Structure Of Unliganded, Inactive Ror2 Kinase Domain Length = 308 Back     alignment and structure
>pdb|1KFW|A Chain A, Structure Of Catalytic Domain Of Psychrophilic Chitinase B From Arthrobacter Tad20 Length = 435 Back     alignment and structure
>pdb|3ZZW|A Chain A, Crystal Structure Of The Kinase Domain Of Ror2 Length = 289 Back     alignment and structure
>pdb|3V5Q|A Chain A, Discovery Of A Selective Trk Inhibitor With Efficacy In Rodent Cancer Tumor Models Length = 297 Back     alignment and structure
>pdb|4F1M|A Chain A, Crystal Structure Of The G1179s Roco4 Kinase Domain Bound To Appcp From D. Discoideum Length = 287 Back     alignment and structure
>pdb|4F1O|A Chain A, Crystal Structure Of The L1180t Mutant Roco4 Kinase Domain From D. Discoideum Bound To Appcp Length = 287 Back     alignment and structure
>pdb|4F0F|A Chain A, Crystal Structure Of The Roco4 Kinase Domain Bound To Appcp From D. Discoideum Length = 287 Back     alignment and structure
>pdb|4FNW|A Chain A, Crystal Structure Of The Apo F1174l Anaplastic Lymphoma Kinase Catalytic Domain Length = 327 Back     alignment and structure
>pdb|2YJR|A Chain A, Structure Of F1174l Mutant Anaplastic Lymphoma Kinase Length = 342 Back     alignment and structure
>pdb|4FOB|A Chain A, Crystal Structure Of Human Anaplastic Lymphoma Kinase In Complex With Acyliminobenzimidazole Inhibitor 1 Length = 353 Back     alignment and structure
>pdb|4FNX|A Chain A, Crystal Structure Of The Apo R1275q Anaplastic Lymphoma Kinase Catalytic Domain Length = 327 Back     alignment and structure
>pdb|4FNZ|A Chain A, Crystal Structure Of Human Anaplastic Lymphoma Kinase In Complex With Piperidine-Carboxamide Inhibitor 2 Length = 327 Back     alignment and structure
>pdb|4DCE|A Chain A, Crystal Structure Of Human Anaplastic Lymphoma Kinase In Complex With A Piperidine-Carboxamide Inhibitor Length = 333 Back     alignment and structure
>pdb|2QOO|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596f:y602f:y742f Triple Mutant Length = 373 Back     alignment and structure
>pdb|2QOK|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596f:y602f:s768a Triple Mutant Length = 373 Back     alignment and structure
>pdb|2QOI|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596f:y602f Double Mutant Length = 373 Back     alignment and structure
>pdb|2GSF|A Chain A, The Human Epha3 Receptor Tyrosine Kinase And Juxtamembrane Region Length = 373 Back     alignment and structure
>pdb|2QOF|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596f Mutant Length = 373 Back     alignment and structure
>pdb|2QOD|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y602f Mutant Length = 373 Back     alignment and structure
>pdb|2YHV|A Chain A, Structure Of L1196m Mutant Anaplastic Lymphoma Kinase Length = 342 Back     alignment and structure
>pdb|2QOL|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596:y602:s768g Triple Mutant Length = 373 Back     alignment and structure
>pdb|3FXX|A Chain A, Human Epha3 Kinase And Juxtamembrane Region Bound To Substrate Kqwdnye[ptyr]iw Length = 371 Back     alignment and structure
>pdb|3L9P|A Chain A, Crystal Structure Of The Anaplastic Lymphoma Kinase Catalytic Domain Length = 367 Back     alignment and structure
>pdb|2YFX|A Chain A, Structure Of L1196m Mutant Anaplastic Lymphoma Kinase In Complex With Crizotinib Length = 327 Back     alignment and structure
>pdb|3AOX|A Chain A, X-Ray Crystal Structure Of Human Anaplastic Lymphoma Kinase In Complex With Ch5424802 Length = 344 Back     alignment and structure
>pdb|2XB7|A Chain A, Structure Of Human Anaplastic Lymphoma Kinase In Complex With Nvp- Tae684 Length = 315 Back     alignment and structure
>pdb|2XP2|A Chain A, Structure Of The Human Anaplastic Lymphoma Kinase In Complex With Crizotinib (Pf-02341066) Length = 327 Back     alignment and structure
>pdb|3LCT|A Chain A, Crystal Structure Of The Anaplastic Lymphoma Kinase Catalytic Domain Length = 344 Back     alignment and structure
>pdb|2YJS|A Chain A, Structure Of C1156y Mutant Anaplastic Lymphoma Kinase Length = 342 Back     alignment and structure
>pdb|2QOC|A Chain A, Human Epha3 Kinase Domain, Phosphorylated, Amp-Pnp Bound Structure Length = 344 Back     alignment and structure
>pdb|3KEX|A Chain A, Crystal Structure Of The Catalytically Inactive Kinase Domain Of The Human Epidermal Growth Factor Receptor 3 (Her3) Length = 325 Back     alignment and structure
>pdb|3OMV|A Chain A, Crystal Structure Of C-Raf (Raf-1) Length = 307 Back     alignment and structure
>pdb|3LMG|A Chain A, Crystal Structure Of The Erbb3 Kinase Domain In Complex With Amp-Pnp Length = 344 Back     alignment and structure
>pdb|3DZQ|A Chain A, Human Epha3 Kinase Domain In Complex With Inhibitor Awl-Ii- 38.3 Length = 361 Back     alignment and structure
>pdb|1LUF|A Chain A, Crystal Structure Of The Musk Tyrosine Kinase: Insights Into Receptor Autoregulation Length = 343 Back     alignment and structure
>pdb|2R2P|A Chain A, Kinase Domain Of Human Ephrin Type-A Receptor 5 (Epha5) Length = 295 Back     alignment and structure
>pdb|2VWU|A Chain A, Ephb4 Kinase Domain Inhibitor Complex Length = 302 Back     alignment and structure
>pdb|1MQB|A Chain A, Crystal Structure Of Ephrin A2 (Epha2) Receptor Protein Kinase Length = 333 Back     alignment and structure
>pdb|4AW5|A Chain A, Complex Of The Ephb4 Kinase Domain With An Oxindole Inhibitor Length = 291 Back     alignment and structure
>pdb|3II5|A Chain A, The Complex Of Wild-Type B-Raf With Pyrazolo Pyrimidine Inhibitor Length = 306 Back     alignment and structure
>pdb|3IDP|A Chain A, B-Raf V600e Kinase Domain In Complex With An Aminoisoquinoline Inhibitor Length = 300 Back     alignment and structure
>pdb|3D4Q|A Chain A, Pyrazole-Based Inhibitors Of B-Raf Kinase Length = 307 Back     alignment and structure
>pdb|4G9R|A Chain A, B-Raf V600e Kinase Domain Bound To A Type Ii Dihydroquinazoline Inhibitor Length = 307 Back     alignment and structure
>pdb|2P0C|A Chain A, Catalytic Domain Of The Proto-Oncogene Tyrosine-Protein Kina Length = 313 Back     alignment and structure
>pdb|3QOK|A Chain A, Crystal Structure Of Putative Chitinase Ii From Klebsiella Pneumoniae Length = 420 Back     alignment and structure
>pdb|4DBN|A Chain A, Crystal Structure Of The Kinase Domain Of Human B-Raf With A [1, 3]thiazolo[5,4-B]pyridine Derivative Length = 284 Back     alignment and structure
>pdb|4H58|A Chain A, Braf In Complex With Compound 3 Length = 275 Back     alignment and structure
>pdb|3Q96|A Chain A, B-Raf Kinase Domain In Complex With A Tetrahydronaphthalene Inhibitor Length = 282 Back     alignment and structure
>pdb|2FB8|A Chain A, Structure Of The B-Raf Kinase Domain Bound To Sb-590885 Length = 281 Back     alignment and structure
>pdb|4EOQ|A Chain A, Thr 160 Phosphorylated Cdk2 Wt - Human Cyclin A3 Complex With Atp Length = 301 Back     alignment and structure
>pdb|4BCQ|A Chain A, Structure Of Cdk2 In Complex With Cyclin A And A 2-amino-4- Heteroaryl-pyrimidine Inhibitor Length = 301 Back     alignment and structure
>pdb|3COH|A Chain A, Crystal Structure Of Aurora-A In Complex With A Pentacyclic Inhibitor Length = 268 Back     alignment and structure
>pdb|4EOS|A Chain A, Thr 160 Phosphorylated Cdk2 Wt - Human Cyclin A3 Complex With The Inhibitor Ro3306 Length = 300 Back     alignment and structure
>pdb|4EOK|A Chain A, Thr 160 Phosphorylated Cdk2 H84s, Q85m, K89d - Human Cyclin A3 Complex With The Inhibitor Nu6102 Length = 300 Back     alignment and structure
>pdb|3BHT|A Chain A, Structure Of Phosphorylated Thr160 Cdk2CYCLIN A IN COMPLEX WITH THE Inhibitor Meriolin 3 Length = 300 Back     alignment and structure
>pdb|3EZR|A Chain A, Cdk-2 With Indazole Inhibitor 17 Bound At Its Active Site Length = 300 Back     alignment and structure
>pdb|1UWH|A Chain A, The Complex Of Wild Type B-Raf And Bay439006 Length = 276 Back     alignment and structure
>pdb|4EOJ|A Chain A, Thr 160 Phosphorylated Cdk2 H84s, Q85m, K89d - Human Cyclin A3 Complex With Atp Length = 302 Back     alignment and structure
>pdb|4EOP|A Chain A, Thr 160 Phosphorylated Cdk2 Q131e - Human Cyclin A3 Complex With The Inhibitor Ro3306 Length = 300 Back     alignment and structure
>pdb|1UWJ|A Chain A, The Complex Of Mutant V599e B-raf And Bay439006 Length = 276 Back     alignment and structure
>pdb|3C4C|A Chain A, B-Raf Kinase In Complex With Plx4720 Length = 280 Back     alignment and structure
>pdb|4EOO|A Chain A, Thr 160 Phosphorylated Cdk2 Q131e - Human Cyclin A3 Complex With Atp Length = 299 Back     alignment and structure
>pdb|2JGZ|A Chain A, Crystal Structure Of Phospho-Cdk2 In Complex With Cyclin B Length = 289 Back     alignment and structure
>pdb|1OGU|A Chain A, Structure Of Human Thr160-phospho Cdk2/cyclin A Complexed With A 2-arylamino-4-cyclohexylmethyl-5-nitroso-6- aminopyrimidine Inhibitor Length = 302 Back     alignment and structure
>pdb|4EOI|A Chain A, Thr 160 Phosphorylated Cdk2 K89d, Q131e - Human Cyclin A3 Complex With The Inhibitor Ro3306 Length = 299 Back     alignment and structure
>pdb|1QMZ|A Chain A, Phosphorylated Cdk2-Cyclyin A-Substrate Peptide Complex Length = 299 Back     alignment and structure
>pdb|4EON|A Chain A, Thr 160 Phosphorylated Cdk2 H84s, Q85m, Q131e - Human Cyclin A3 Complex With The Inhibitor Ro3306 Length = 300 Back     alignment and structure
>pdb|4EOM|A Chain A, Thr 160 Phosphorylated Cdk2 H84s, Q85m, Q131e - Human Cyclin A3 Complex With Atp Length = 301 Back     alignment and structure
>pdb|2QON|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596f:y602f:y742a Triple Mutant Length = 373 Back     alignment and structure
>pdb|2IW6|A Chain A, Structure Of Human Thr160-Phospho Cdk2-Cyclin A Complexed With A Bisanilinopyrimidine Inhibitor Length = 302 Back     alignment and structure
>pdb|1E9H|A Chain A, Thr 160 Phosphorylated Cdk2-Human Cyclin A3 Complex With The Inhibitor Indirubin-5-Sulphonate Bound Length = 297 Back     alignment and structure
>pdb|1GZ8|A Chain A, Human Cyclin Dependent Kinase 2 Complexed With The Inhibitor 2-Amino-6-(3'-Methyl-2'-Oxo)butoxypurine Length = 299 Back     alignment and structure
>pdb|1H1P|A Chain A, Structure Of Human Thr160-Phospho Cdk2CYCLIN A COMPLEXED With The Inhibitor Nu2058 Length = 303 Back     alignment and structure
>pdb|3OG7|A Chain A, B-Raf Kinase V600e Oncogenic Mutant In Complex With Plx4032 Length = 289 Back     alignment and structure
>pdb|2QO7|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Dephosphorylated, Amp-Pnp Bound Length = 373 Back     alignment and structure
>pdb|1W98|A Chain A, The Structural Basis Of Cdk2 Activation By Cyclin E Length = 298 Back     alignment and structure
>pdb|1OIT|A Chain A, Imidazopyridines: A Potent And Selective Class Of Cyclin-dependent Kinase Inhibitors Identified Through Structure-based Hybridisation Length = 299 Back     alignment and structure
>pdb|2W17|A Chain A, Cdk2 In Complex With The Imidazole Pyrimidine Amide, Compound (S)-8b Length = 299 Back     alignment and structure
>pdb|1FIN|A Chain A, Cyclin A-Cyclin-Dependent Kinase 2 Complex Length = 298 Back     alignment and structure
>pdb|3PJ8|A Chain A, Structure Of Cdk2 In Complex With A Pyrazolo[4,3-D]pyrimidine Bioisostere Of Roscovitine Length = 299 Back     alignment and structure
>pdb|4FK3|A Chain A, B-Raf Kinase V600e Oncogenic Mutant In Complex With Plx3203 Length = 292 Back     alignment and structure
>pdb|4I3Z|A Chain A, Structure Of Pcdk2CYCLINA BOUND TO ADP AND 2 MAGNESIUM IONS Length = 296 Back     alignment and structure
>pdb|1VYW|A Chain A, Structure Of Cdk2CYCLIN A WITH PNU-292137 Length = 309 Back     alignment and structure
>pdb|1PF8|A Chain A, Crystal Structure Of Human Cyclin-dependent Kinase 2 Complexed With A Nucleoside Inhibitor Length = 298 Back     alignment and structure
>pdb|3QHR|A Chain A, Structure Of A Pcdk2CYCLINA TRANSITION-State Mimic Length = 298 Back     alignment and structure
>pdb|1JST|A Chain A, Phosphorylated Cyclin-Dependent Kinase-2 Bound To Cyclin A Length = 298 Back     alignment and structure
>pdb|4ERW|A Chain A, Cdk2 In Complex With Staurosporine Length = 306 Back     alignment and structure
>pdb|3PXF|A Chain A, Cdk2 In Complex With Two Molecules Of 8-Anilino-1-Naphthalene Sulfonate Length = 306 Back     alignment and structure
>pdb|3D14|A Chain A, Crystal Structure Of Mouse Aurora A (Asn186->gly, Lys240->arg, Met302- >leu) In Complex With 1-{5-[2-(Thieno[3,2-D]pyrimidin-4-Ylamino)- Ethyl]- Thiazol-2-Yl}-3-(3-Trifluoromethyl-Phenyl)-Urea Length = 272 Back     alignment and structure
>pdb|3A4O|X Chain X, Lyn Kinase Domain Length = 286 Back     alignment and structure
>pdb|3DAJ|A Chain A, Crystal Structure Of Aurora A Complexed With An Inhibitor Discovered Through Site-Directed Dynamic Tethering Length = 272 Back     alignment and structure
>pdb|3W2O|A Chain A, Egfr Kinase Domain T790m/l858r Mutant With Tak-285 Length = 331 Back     alignment and structure
>pdb|3H0Y|A Chain A, Aurora A In Complex With A Bisanilinopyrimidine Length = 268 Back     alignment and structure
>pdb|3QBN|A Chain A, Structure Of Human Aurora A In Complex With A Diaminopyrimidine Length = 281 Back     alignment and structure
>pdb|2QOB|A Chain A, Human Epha3 Kinase Domain, Base Structure Length = 344 Back     alignment and structure
>pdb|2IW8|A Chain A, Structure Of Human Thr160-Phospho Cdk2-Cyclin A F82h-L83v- H84d Mutant With An O6-Cyclohexylmethylguanine Inhibitor Length = 302 Back     alignment and structure
>pdb|1FMK|A Chain A, Crystal Structure Of Human Tyrosine-Protein Kinase C-Src Length = 452 Back     alignment and structure
>pdb|3IKA|A Chain A, Crystal Structure Of Egfr 696-1022 T790m Mutant Covalently Binding To Wz4002 Length = 331 Back     alignment and structure
>pdb|2H8H|A Chain A, Src Kinase In Complex With A Quinazoline Inhibitor Length = 535 Back     alignment and structure
>pdb|3LAU|A Chain A, Crystal Structure Of Aurora2 Kinase In Complex With A Gsk3beta Inhibitor Length = 287 Back     alignment and structure
>pdb|1Y57|A Chain A, Structure Of Unphosphorylated C-Src In Complex With An Inhibitor Length = 452 Back     alignment and structure
>pdb|3O50|A Chain A, Crystal Structure Of Benzamide 9 Bound To Auroraa Length = 267 Back     alignment and structure
>pdb|2JIV|A Chain A, Crystal Structure Of Egfr Kinase Domain T790m Mutation In Compex With Hki-272 Length = 328 Back     alignment and structure
>pdb|1OL6|A Chain A, Structure Of Unphosphorylated D274n Mutant Of Aurora-a Length = 282 Back     alignment and structure
>pdb|4G5P|A Chain A, Crystal Structure Of Egfr Kinase T790m In Complex With Bibw2992 Length = 330 Back     alignment and structure
>pdb|2ZV7|A Chain A, Lyn Tyrosine Kinase Domain, Apo Form Length = 279 Back     alignment and structure
>pdb|4I21|A Chain A, Crystal Structure Of L858r + T790m Egfr Kinase Domain In Complex With Mig6 Peptide Length = 329 Back     alignment and structure
>pdb|3UNZ|A Chain A, Aurora A In Complex With Rpm1679 Length = 279 Back     alignment and structure
>pdb|3FDN|A Chain A, Structure-Based Drug Design Of Novel Aurora Kinase A Inhibitors: Structure Basis For Potency And Specificity Length = 279 Back     alignment and structure
>pdb|2JIU|A Chain A, Crystal Structure Of Egfr Kinase Domain T790m Mutation In Complex With Aee788 Length = 328 Back     alignment and structure
>pdb|4I24|A Chain A, Structure Of T790m Egfr Kinase Domain Co-crystallized With Dacomitinib Length = 329 Back     alignment and structure
>pdb|4I1Z|A Chain A, Crystal Structure Of The Monomeric (v948r) Form Of The Gefitinib/erlotinib Resistant Egfr Kinase Domain L858r+t790m Length = 329 Back     alignment and structure
>pdb|2C6E|A Chain A, Aurora A Kinase Activated Mutant (T287d) In Complex With A 5-Aminopyrimidinyl Quinazoline Inhibitor Length = 283 Back     alignment and structure
>pdb|3E5A|A Chain A, Crystal Structure Of Aurora A In Complex With Vx-680 And Tpx2 Length = 268 Back     alignment and structure
>pdb|2DWB|A Chain A, Aurora-A Kinase Complexed With Amppnp Length = 285 Back     alignment and structure
>pdb|3R21|A Chain A, Design, Synthesis, And Biological Evaluation Of Pyrazolopyridine- Sulfonamides As Potent Multiple-Mitotic Kinase (Mmk) Inhibitors (Part I) Length = 271 Back     alignment and structure
>pdb|2C6D|A Chain A, Aurora A Kinase Activated Mutant (T287d) In Complex With Adpnp Length = 275 Back     alignment and structure
>pdb|1GII|A Chain A, Human Cyclin Dependent Kinase 2 Complexed With The Cdk4 Inhibitor Length = 298 Back     alignment and structure
>pdb|2XNG|A Chain A, Structure Of Aurora-A Bound To A Selective Imidazopyrazine Inhibitor Length = 283 Back     alignment and structure
>pdb|2WTV|A Chain A, Aurora-A Inhibitor Structure Length = 285 Back     alignment and structure
>pdb|2JIT|A Chain A, Crystal Structure Of Egfr Kinase Domain T790m Mutation Length = 327 Back     alignment and structure
>pdb|2X6D|A Chain A, Aurora-A Bound To An Inhibitor Length = 285 Back     alignment and structure
>pdb|1MQ4|A Chain A, Crystal Structure Of Aurora-A Protein Kinase Length = 272 Back     alignment and structure
>pdb|3NRM|A Chain A, Imidazo[1,2-A]pyrazine-Based Aurora Kinase Inhibitors Length = 283 Back     alignment and structure
>pdb|2W1D|A Chain A, Structure Determination Of Aurora Kinase In Complex With Inhibitor Length = 275 Back     alignment and structure
>pdb|3GBZ|A Chain A, Structure Of The Cmgc Cdk Kinase From Giardia Lamblia Length = 329 Back     alignment and structure
>pdb|2W1C|A Chain A, Structure Determination Of Aurora Kinase In Complex With Inhibitor Length = 275 Back     alignment and structure
>pdb|2J50|A Chain A, Structure Of Aurora-2 In Complex With Pha-739358 Length = 280 Back     alignment and structure
>pdb|1OL5|A Chain A, Structure Of Aurora-A 122-403, Phosphorylated On Thr287, Thr288 And Bound To Tpx2 1-43 Length = 282 Back     alignment and structure
>pdb|3HA6|A Chain A, Crystal Structure Of Aurora A In Complex With Tpx2 And Compound 10 Length = 268 Back     alignment and structure
>pdb|2XNE|A Chain A, Structure Of Aurora-A Bound To An Imidazopyrazine Inhibitor Length = 272 Back     alignment and structure
>pdb|2WTW|A Chain A, Aurora-A Inhibitor Structure (2nd Crystal Form) Length = 285 Back     alignment and structure
>pdb|1MUO|A Chain A, Crystal Structure Of Aurora-2, An Oncogenic Serine- Threonine Kinase Length = 297 Back     alignment and structure
>pdb|2XRU|A Chain A, Aurora-A T288e Complexed With Pha-828300 Length = 280 Back     alignment and structure
>pdb|1M14|A Chain A, Tyrosine Kinase Domain From Epidermal Growth Factor Receptor Length = 333 Back     alignment and structure
>pdb|2BMC|A Chain A, Aurora-2 T287d T288d Complexed With Pha-680632 Length = 306 Back     alignment and structure
>pdb|3BEL|A Chain A, X-Ray Structure Of Egfr In Complex With Oxime Inhibitor Length = 315 Back     alignment and structure
>pdb|4HJO|A Chain A, Crystal Structure Of The Inactive Egfr Tyrosine Kinase Domain With Erlotinib Length = 337 Back     alignment and structure
>pdb|4I20|A Chain A, Crystal Structure Of Monomeric (v948r) Primary Oncogenic Mutant L858r Egfr Kinase Domain Length = 329 Back     alignment and structure
>pdb|1KSW|A Chain A, Structure Of Human C-Src Tyrosine Kinase (Thr338gly Mutant) In Complex With N6-Benzyl Adp Length = 452 Back     alignment and structure
>pdb|3MIY|A Chain A, X-Ray Crystal Structure Of Itk Complexed With Sunitinib Length = 266 Back     alignment and structure
>pdb|2GS7|A Chain A, Crystal Structure Of The Inactive Egfr Kinase Domain In Complex With Amp-Pnp Length = 330 Back     alignment and structure
>pdb|4I23|A Chain A, Crystal Structure Of The Wild-type Egfr Kinase Domain In Complex With Dacomitinib (soaked) Length = 329 Back     alignment and structure
>pdb|4G5J|A Chain A, Crystal Structure Of Egfr Kinase In Complex With Bibw2992 Length = 330 Back     alignment and structure
>pdb|2J5E|A Chain A, Crystal Structure Of Egfr Kinase Domain In Complex With An Irreversible Inhibitor 13-Jab Length = 327 Back     alignment and structure
>pdb|2GS2|A Chain A, Crystal Structure Of The Active Egfr Kinase Domain Length = 330 Back     alignment and structure
>pdb|3VJO|A Chain A, Crystal Structure Of The Wild-Type Egfr Kinase Domain In Complex With Amppnp Length = 334 Back     alignment and structure
>pdb|2ITT|A Chain A, Crystal Structure Of Egfr Kinase Domain L858r Mutation In Complex With Aee788 Length = 327 Back     alignment and structure
>pdb|2EB3|A Chain A, Crystal Structure Of Mutated Egfr Kinase Domain (L858r) In Complex With Amppnp Length = 334 Back     alignment and structure
>pdb|3LW0|A Chain A, Igf-1rk In Complex With Ligand Msc1609119a-1 Length = 304 Back     alignment and structure
>pdb|1XKK|A Chain A, Egfr Kinase Domain Complexed With A Quinazoline Inhibitor- Gw572016 Length = 352 Back     alignment and structure
>pdb|2J5F|A Chain A, Crystal Structure Of Egfr Kinase Domain In Complex With An Irreversible Inhibitor 34-Jab Length = 327 Back     alignment and structure
>pdb|2RFD|A Chain A, Crystal Structure Of The Complex Between The Egfr Kinase Domain And A Mig6 Peptide Length = 324 Back     alignment and structure
>pdb|2J4Z|A Chain A, Structure Of Aurora-2 In Complex With Pha-680626 Length = 306 Back     alignment and structure
>pdb|3LVP|A Chain A, Crystal Structure Of Bisphosphorylated Igf1-R Kinase Domain (2p) In Complex With A Bis-Azaindole Inhibitor Length = 336 Back     alignment and structure
>pdb|1P4O|A Chain A, Structure Of Apo Unactivated Igf-1r Kinase Domain At 1.5a Resolution. Length = 322 Back     alignment and structure
>pdb|3OZ6|A Chain A, Crystal Structure Of Mapk From Cryptosporidium Parvum, Cgd2_1960 Length = 388 Back     alignment and structure
>pdb|3I81|A Chain A, Crystal Structure Of Insulin-Like Growth Factor 1 Receptor (Igf-1r-Wt) Complex With Bms-754807 [1-(4-((5-Cyclopropyl- 1h-Pyrazol-3-Yl)amino)pyrrolo[2,1-F][1,2, 4]triazin-2-Yl)-N- (6-Fluoro-3-Pyridinyl)-2-Methyl-L-Prolinamide] Length = 315 Back     alignment and structure
>pdb|1JQH|A Chain A, Igf-1 Receptor Kinase Domain Length = 308 Back     alignment and structure
>pdb|2WQE|A Chain A, Structure Of S155r Aurora-A Somatic Mutant Length = 262 Back     alignment and structure
>pdb|2ZM3|A Chain A, Complex Structure Of Insulin-Like Growth Factor Receptor And Isoquinolinedione Inhibitor Length = 308 Back     alignment and structure
>pdb|2OJ9|A Chain A, Structure Of Igf-1r Kinase Domain Complexed With A Benzimidazole Inhibitor Length = 307 Back     alignment and structure
>pdb|3DQW|A Chain A, C-Src Kinase Domain Thr338ile Mutant In Complex With Atpgs Length = 286 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query580
3aqu_A356 AT4G19810; stress response, TIM barrel, hydrolase, 6e-84
3alf_A353 Chitinase, class V; hydrolase; 1.20A {Nicotiana ta 3e-83
4ay1_A365 Chitinase-3-like protein 2; chilectin, lectin, chi 2e-67
3fy1_A395 Amcase, TSA1902, acidic mammalian chitinase; struc 1e-65
1vf8_A377 YM1, secretory protein; chitinase, CHI-lectin, str 2e-65
1wb0_A445 Chitinase 1, chitotriosidase 1; cyclopentapeptide 1e-62
2pi6_A361 Chitinase-3-like protein 1; complex, signaling pro 5e-60
3uim_A 326 Brassinosteroid insensitive 1-associated receptor; 6e-47
1jnd_A420 Imaginal DISC growth factor-2; IDGF, chitinase, in 3e-45
2qkw_B 321 Protein kinase; three-helix bundle motif, AVRPTO-P 6e-44
1w9p_A433 Chitinase; peptide inhibitors, argifin, argadin, g 9e-44
2nru_A 307 Interleukin-1 receptor-associated kinase 4; inhibi 2e-43
1ll7_A392 Chitinase 1; beta-alpha barrel, hydrolase; 2.00A { 2e-42
3g6m_A406 Chitinase, crchi1; inhibitor, caffeine, glycosidas 4e-42
1itx_A419 Chitinase A1, glycosyl hydrolase; alpha-beta (TIM) 6e-42
3qok_A420 Putative chitinase II; structural genomics, PSI-bi 9e-40
1edq_A540 Chitinase A; beta-alpha (TIM) barrel, hydrolase; 1 3e-39
1kfw_A435 Chitinase B; TIM barrel, hydrolase; 1.74A {Arthrob 5e-39
1goi_A499 Chitinase B; chitin degradation, hydrolase, glycos 2e-38
3fnd_A312 Chitinase; TIM-barrel, structural genomics, PSI-2, 2e-38
3oa5_A574 CHI1; TIM barrel, hydrolase; HET: 2PE; 1.74A {Yers 5e-37
3cz8_A319 Putative sporulation-specific glycosylase YDHD; st 5e-33
3arx_A584 Chitinase A; TIM barrel, inhibitor complex, glycos 3e-31
3soc_A 322 Activin receptor type-2A; structural genomics cons 4e-27
3bxw_B393 Chitinase domain-containing protein 1; TIM barrel, 1e-26
3sim_A275 Protein, family 18 chitinase; family 18 plant chit 7e-26
3g2f_A 336 Bone morphogenetic protein receptor type-2; kinase 1e-23
3s95_A 310 LIMK-1, LIM domain kinase 1; structural genomics, 6e-18
3p86_A 309 Serine/threonine-protein kinase CTR1; ETR1, ERS1, 4e-17
3gen_A 283 Tyrosine-protein kinase BTK; bruton'S tyrosine kin 7e-17
3dtc_A 271 Mitogen-activated protein kinase kinase kinase 9; 1e-16
4fvq_A 289 Tyrosine-protein kinase JAK2; janus protein kinase 1e-16
3kmu_A 271 ILK, integrin-linked kinase; cell adhesion, ANK re 2e-16
3lb7_A 307 RAF proto-oncogene serine/threonine-protein kinas; 2e-16
2y4i_B 319 KSR2, HKSR2, kinase suppressor of RAS 2; transfera 3e-16
4aoj_A 329 High affinity nerve growth factor receptor; transf 3e-16
3t9t_A 267 Tyrosine-protein kinase ITK/TSK; kinase domain, al 4e-16
3lxl_A 327 Tyrosine-protein kinase JAK3; TYK2, inflammation, 5e-16
2eva_A 307 TAK1 kinase - TAB1 chimera fusion protein; transfe 6e-16
3cbl_A 377 C-FES, proto-oncogene tyrosine-protein kinase FES/ 9e-16
3ugc_A 295 Tyrosine-protein kinase JAK2; small molecule inhib 1e-15
3v5q_A 297 NT-3 growth factor receptor; kinase domain, kinase 1e-15
4f0f_A 287 Serine/threonine-protein kinase ROCO4; LRRK2, ATP- 1e-15
2w1i_A 326 JAK2; chromosomal rearrangement, nucleotide-bindin 2e-15
3og7_A 289 AKAP9-BRAF fusion protein; proto-oncogene, V600E, 3e-15
3zzw_A 289 Tyrosine-protein kinase transmembrane receptor RO; 3e-15
3lxp_A 318 Non-receptor tyrosine-protein kinase TYK2; JAK3, i 4e-15
3sxs_A 268 Cytoplasmic tyrosine-protein kinase BMX; transfera 4e-15
3kfa_A 288 Tyrosine-protein kinase ABL1; CML, drug resistance 5e-15
4e5w_A 302 Tyrosine-protein kinase JAK1; kinase domain, trans 5e-15
1byg_A 278 CSK, protein (C-terminal SRC kinase); protein kina 7e-15
2yfx_A 327 Tyrosine-protein kinase receptor; nucleotide-bindi 1e-14
2qol_A 373 Ephrin receptor; receptor tyrosine kinase, juxtame 2e-14
1luf_A 343 Muscle-specific tyrosine kinase receptor MUSK; pho 2e-14
3lzb_A 327 Epidermal growth factor receptor; epidermal growth 2e-14
1u46_A 291 ACK-1, activated CDC42 kinase 1; tyrosine kinase, 3e-14
3l9p_A 367 Anaplastic lymphoma kinase; kinase domain, ATP-bin 3e-14
3kex_A 325 Receptor tyrosine-protein kinase ERBB-3; kinase do 3e-14
1mqb_A 333 Ephrin type-A receptor 2; tyrosine protein kinase, 4e-14
3pls_A 298 Macrophage-stimulating protein receptor; protein k 4e-14
3f66_A 298 Hepatocyte growth factor receptor; C-Met, protein 4e-14
2ivs_A 314 Proto-oncogene tyrosine-protein kinase receptor RE 6e-14
3kul_A 325 Ephrin type-A receptor 8; ATP-binding, kinase, nuc 6e-14
3brb_A 313 Proto-oncogene tyrosine-protein kinase MER; ATP-bi 7e-14
1opk_A 495 P150, C-ABL, proto-oncogene tyrosine-protein kinas 7e-14
1p4o_A 322 Insulin-like growth factor I receptor protein; IGF 9e-14
1u59_A 287 Tyrosine-protein kinase ZAP-70; transferase; HET: 1e-13
3c1x_A 373 Hepatocyte growth factor receptor; receptor tyrosi 1e-13
3qup_A 323 Tyrosine-protein kinase receptor TYRO3; protein ki 1e-13
1k9a_A 450 Carboxyl-terminal SRC kinase; COOH-terminal SRC ki 1e-13
3cc6_A 281 Protein tyrosine kinase 2 beta; focal adhesion kin 2e-13
3poz_A 327 Epidermal growth factor receptor; kinase domain, a 2e-13
1qpc_A 279 LCK kinase; alpha beta fold, transferase; HET: PTR 2e-13
1fvr_A 327 Tyrosine-protein kinase TIE-2; tyrosine kinase, tr 2e-13
3mdy_A 337 Bone morphogenetic protein receptor type-1B; compl 2e-13
3q4u_A 301 Activin receptor type-1; structural genomics conso 3e-13
1mp8_A 281 Focal adhesion kinase 1; tyrosine protein kinase, 3e-13
3gxj_A 303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 5e-13
1xbb_A 291 Tyrosine-protein kinase SYK; gleevec, STI-571, ima 6e-13
2j0j_A 656 Focal adhesion kinase 1; cell migration, FERM, tra 6e-13
2clq_A 295 Mitogen-activated protein kinase kinase kinase 5; 9e-13
2pvf_A 334 Fibroblast growth factor receptor 2; kinase domain 1e-12
2psq_A 370 Fibroblast growth factor receptor 2; kinase domain 2e-12
1b6c_B 342 TGF-B superfamily receptor type I; complex (isomer 2e-12
1qcf_A 454 Haematopoetic cell kinase (HCK); tyrosine kinase-i 2e-12
2h8h_A 535 Proto-oncogene tyrosine-protein kinase SRC; SRC ki 2e-12
1t46_A 313 HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcom 3e-12
2xir_A 316 Vascular endothelial growth factor receptor 2; ang 3e-12
2ozo_A 613 Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t 3e-12
2i1m_A 333 Macrophage colony-stimulating factor 1 receptor; k 3e-12
3tt0_A 382 Basic fibroblast growth factor receptor 1; kinase 3e-12
1fmk_A 452 C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros 3e-12
1rjb_A 344 FL cytokine receptor; kinase, structure, autoinhib 4e-12
3e7e_A 365 HBUB1, BUB1A, mitotic checkpoint serine/threonine- 2e-11
1edt_A271 Endo-beta-N-acetylglucosaminidase H, endo H; hydro 1e-10
3n12_A333 Chitinase A, chinctu2; zinc atoms, complex, hydrol 4e-10
2y8v_A290 CHIC, class III chitinase, putative; afchic, hydro 1e-09
1t4h_A 290 Serine/threonine-protein kinase WNK1; protein seri 2e-09
2buj_A 317 Serine/threonine-protein kinase 16; transferase, A 3e-09
2c30_A 321 Serine/threonine-protein kinase PAK 6; CRIB domain 3e-09
3fxz_A 297 Serine/threonine-protein kinase PAK 1; transferase 4e-09
3vhe_A 359 Vascular endothelial growth factor receptor 2; kin 4e-09
2j7t_A 302 Serine/threonine-protein kinase 10; transferase, A 5e-09
4g3f_A 336 NF-kappa-beta-inducing kinase; non-RD kinase, prot 9e-09
3uto_A 573 Twitchin; kinase, muscle sarcomere, transferase; H 1e-08
3dbq_A 343 Dual specificity protein kinase TTK; MPS1 structur 1e-08
3cek_A 313 Dual specificity protein kinase TTK; HMPS1, PYT, E 2e-08
1j1b_A 420 Glycogen synthase kinase-3 beta; complex, TAU, AMP 3e-08
2zmd_A 390 Dual specificity protein kinase TTK; MPS1, T686A, 3e-08
1kob_A 387 Twitchin; kinase, intrasteric regulation; 2.30A {A 4e-08
3is5_A 285 Calcium-dependent protein kinase; CDPK, structural 4e-08
3mwu_A 486 Calmodulin-domain protein kinase 1; serine/threoni 5e-08
1ua2_A 346 CAK, cell division protein kinase 7; cell cycle, p 5e-08
2a19_B 284 Interferon-induced, double-stranded RNA-activated 6e-08
3lij_A 494 Calcium/calmodulin dependent protein kinase with A 6e-08
3a7i_A 303 MST3 kinase, serine/threonine kinase 24 (STE20 hom 6e-08
3niz_A 311 Rhodanese family protein; structural genomics, str 7e-08
2vwi_A 303 Serine/threonine-protein kinase OSR1; STE kinase, 7e-08
1ob3_A 288 PFPK5, cell division control protein 2 homolog; tr 9e-08
2wqm_A 310 Serine/threonine-protein kinase NEK7; ATP-binding, 1e-07
3gni_B 389 Strad alpha; kinase fold, pseudokinase, alpha heli 1e-07
2r3i_A 299 Cell division protein kinase 2; serine/threonine-p 1e-07
1u5q_A 348 Serine/threonine protein kinase TAO2; transferase; 1e-07
3f3z_A 277 Calcium/calmodulin-dependent protein kinase with d 1e-07
4aaa_A 331 Cyclin-dependent kinase-like 2; transferase, phosp 2e-07
3com_A 314 Serine/threonine-protein kinase 4; MST1, STE20-lik 2e-07
3o0g_A 292 Cell division protein kinase 5; kinase activator c 2e-07
4euu_A 319 Serine/threonine-protein kinase TBK1; ATP binding, 2e-07
3gbz_A 329 Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide- 2e-07
1zy4_A 303 Serine/threonine-protein kinase GCN2; translation 2e-07
4agu_A 311 Cyclin-dependent kinase-like 1; transferase, phosp 2e-07
3nyv_A 484 Calmodulin-domain protein kinase 1; serine/threoni 3e-07
2pmi_A 317 Negative RE, cyclin-dependent protein kinase PHO85 3e-07
2wei_A 287 Calmodulin-domain protein kinase 1, putative; nucl 4e-07
4eut_A 396 Serine/threonine-protein kinase TBK1; ATP binding, 4e-07
4e7w_A 394 Glycogen synthase kinase 3; GSK3, PTyr195, transfe 5e-07
4apc_A 350 Serine/threonine-protein kinase NEK1; transferase; 5e-07
2x4f_A 373 Myosin light chain kinase family member 4; LUNG, b 7e-07
3hko_A 345 Calcium/calmodulin-dependent protein kinase with d 1e-06
1x8b_A 289 WEE1HU, WEE1-like protein kinase; cell cycle, tran 1e-06
3c0i_A 351 Peripheral plasma membrane protein CASK; neurexin, 2e-06
1tki_A 321 Titin; serine kinase, muscle, autoinhibition; 2.00 2e-06
3mtl_A 324 Cell division protein kinase 16; pctaire1, indirub 2e-06
2rku_A 294 Serine/threonine-protein kinase PLK1; structure of 3e-06
4g31_A 299 Eukaryotic translation initiation factor 2-alpha; 3e-06
2owb_A 335 Serine/threonine-protein kinase PLK1; catalytic do 3e-06
2jam_A 304 Calcium/calmodulin-dependent protein kinase type 1 4e-06
3e3p_A 360 Protein kinase, putative glycogen synthase kinase; 5e-06
3fdn_A 279 Serine/threonine-protein kinase 6; aurora kinase i 5e-06
3qa8_A 676 MGC80376 protein; kinase ubiquitin-like domain, ph 6e-06
3rgf_A 405 Cyclin-dependent kinase 8; protein kinase complex, 6e-06
3kk8_A 284 Calcium/calmodulin dependent protein kinase II; AT 6e-06
2x7f_A 326 TRAF2 and NCK-interacting protein kinase; serine/t 7e-06
3bhy_A 283 Death-associated protein kinase 3; death associate 7e-06
3soa_A 444 Calcium/calmodulin-dependent protein kinase type a 8e-06
2bdw_A 362 Hypothetical protein K11E8.1D; kinase, calmodulin 8e-06
2a2a_A 321 Death-associated protein kinase 2; autoinhibition, 9e-06
3q5i_A 504 Protein kinase; CDPK, malaria, phosphotransferase, 9e-06
3mi9_A 351 Cell division protein kinase 9; P-TEFB, HIV-1, pro 9e-06
2yab_A 361 Death-associated protein kinase 2; apoptosis, tran 1e-05
2y0a_A 326 Death-associated protein kinase 1; transferase, ca 1e-05
1nar_A290 Narbonin; plant SEED protein; 1.80A {Vicia narbone 1e-05
2ebn_A289 Endo-beta-N-acetylglucosaminidase F1; hydrolase(gl 1e-05
3ebv_A302 Chinitase A; chitinase A, CHIA, glycosidase, struc 2e-05
2w5a_A 279 Serine/threonine-protein kinase NEK2; Ser/Thr prot 2e-05
3rp9_A 458 Mitogen-activated protein kinase; structural genom 2e-05
3ian_A321 Chitinase; structural genomics, hydrolase, glycosi 3e-05
3i6u_A 419 CDS1, serine/threonine-protein kinase CHK2; Ser/Th 3e-05
2ycf_A 322 Serine/threonine-protein kinase CHK2; transferase, 4e-05
3q60_A 371 ROP5B; pseudokinase, transferase; HET: ATP; 1.72A 5e-05
3pg1_A 362 Mitogen-activated protein kinase, putative (MAP K 5e-05
3ll6_A 337 Cyclin G-associated kinase; transferase, protein k 5e-05
3p23_A 432 Serine/threonine-protein kinase/endoribonuclease; 5e-05
3g33_A 308 Cell division protein kinase 4; Ser/Thr protein ki 6e-05
3cok_A 278 Serine/threonine-protein kinase PLK4; POLO-like ki 7e-05
3qd2_B 332 Eukaryotic translation initiation factor 2-alpha; 9e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 9e-04
1blx_A 326 Cyclin-dependent kinase 6; inhibitor protein, cycl 1e-04
2vgo_A 284 Serine/threonine-protein kinase 12-A; nucleotide-b 1e-04
3eb0_A 383 Putative uncharacterized protein; kinase cryptospo 1e-04
2ac3_A 316 MAP kinase-interacting serine/threonine kinase 2; 2e-04
2qr7_A 342 Ribosomal protein S6 kinase alpha-3; kinase domain 2e-04
2rio_A 434 Serine/threonine-protein kinase/endoribonuclease I 2e-04
2i6l_A 320 Mitogen-activated protein kinase 6; MAPK6, ERK3, e 2e-04
3n9x_A 432 Phosphotransferase; malaria kinase, structural gen 2e-04
2w4o_A 349 Calcium/calmodulin-dependent protein kinase type I 3e-04
2pzi_A 681 Probable serine/threonine-protein kinase PKNG; ATP 3e-04
3nsz_A 330 CK II alpha, casein kinase II subunit alpha; inhib 4e-04
2vuw_A 336 Serine/threonine-protein kinase haspin; cell cycle 5e-04
3uqc_A 286 Probable conserved transmembrane protein; structur 5e-04
3qyz_A 364 Mitogen-activated protein kinase 1; transferase, s 5e-04
2y7j_A 365 Phosphorylase B kinase gamma catalytic chain, test 6e-04
3lm5_A 327 Serine/threonine-protein kinase 17B; STK17B, serin 8e-04
>3aqu_A AT4G19810; stress response, TIM barrel, hydrolase, chitin; HET: FLC; 2.01A {Arabidopsis thaliana} Length = 356 Back     alignment and structure
 Score =  265 bits (679), Expect = 6e-84
 Identities = 132/358 (36%), Positives = 208/358 (58%), Gaps = 12/358 (3%)

Query: 24  KPWIRVGYLNLSEVSTISGINYDLFTHLICSSADINSTTYQLSLSLPSDENQIAKFADTV 83
           +  ++  Y   +    ++ I+  LFTHL C+ AD+NS T Q+++S  +++ + + F  TV
Sbjct: 2   QTVVKASYWFPASEFPVTDIDSSLFTHLFCAFADLNSQTNQVTVS-SANQPKFSTFTQTV 60

Query: 84  KKKNPSITTILSIGQGKDTNYSIYSSMVRNSSHRKSFIDSSIRIARLYGFRGLDFAWTAP 143
           +++NPS+ T+LSIG G   + + Y+SM  N + RKSFIDSSIR+AR YGF GLD  W  P
Sbjct: 61  QRRNPSVKTLLSIG-GGIADKTAYASMASNPTSRKSFIDSSIRVARSYGFHGLDLDWEYP 119

Query: 144 NTSTDMFNIGLLFDEWRIAATKLDAKNSTRQQSLLILTARFRYSPP--ANSYLLNSIQRN 201
           +++T+M N G L  EWR A   + A+ S+  +  L+L A   YS    +  Y ++++  +
Sbjct: 120 SSATEMTNFGTLLREWRSA---VVAEASSSGKPRLLLAAAVFYSNNYYSVLYPVSAVASS 176

Query: 202 LNWIHAVTASYYEPVSTNFTAPPAALYGSISGRFARSTDQVLKAWIERGLSADKLVMCLP 261
           L+W++ +   +Y P  +  T PPAAL+   +     S D   ++WI+ GL A K V+  P
Sbjct: 177 LDWVNLMAYDFYGPGWSRVTGPPAALFDPSNAGP--SGDAGTRSWIQAGLPAKKAVLGFP 234

Query: 262 FYGYAWTLVKPEDNGIGAAAAGPALYDSGLVTYKKIKNHIKTYGPDVQVMYNSTYEVNYF 321
           +YGYAW L     +   A   G A+   G + Y +I+  I   G     +YNST   +Y 
Sbjct: 235 YYGYAWRLTNANSHSYYAPTTGAAISPDGSIGYGQIRKFIVDNG--ATTVYNSTVVGDYC 292

Query: 322 STGTVWFGFDDVEAVRAKIAYAKEKRLLGYYAWQVSFDDHDWLLSQAAAQKDSITSAS 379
             GT W G+DD +++  K+ YAK++ LLGY++W V  DD +  LS+AA+Q    T+A+
Sbjct: 293 YAGTNWIGYDDNQSIVTKVRYAKQRGLLGYFSWHVGADD-NSGLSRAASQAWDATTAT 349


>3alf_A Chitinase, class V; hydrolase; 1.20A {Nicotiana tabacum} PDB: 3alg_A* Length = 353 Back     alignment and structure
>4ay1_A Chitinase-3-like protein 2; chilectin, lectin, chitooligosaccharide, pseudochitinase, HY; HET: NAG; 1.95A {Homo sapiens} Length = 365 Back     alignment and structure
>3fy1_A Amcase, TSA1902, acidic mammalian chitinase; structure, crystallography, asthma,inhibitor, chitin degradation, methylallosamidin; HET: NA1 NAA AMI; 1.70A {Homo sapiens} PDB: 3fxy_A* 3rm4_A* 3rm8_A* 3rm9_A* 3rme_A* 2ybt_A* 2ybu_A* Length = 395 Back     alignment and structure
>1vf8_A YM1, secretory protein; chitinase, CHI-lectin, structural plasticity, functional versatility, immune system; 1.31A {Mus musculus} SCOP: c.1.8.5 d.26.3.1 PDB: 1e9l_A Length = 377 Back     alignment and structure
>1wb0_A Chitinase 1, chitotriosidase 1; cyclopentapeptide inhibitors, chitinase inhibitors, carbohyd metabolism, chitin degradation, chitin-binding; HET: VR0 MEA; 1.65A {Homo sapiens} SCOP: c.1.8.5 d.26.3.1 PDB: 1waw_A* 1guv_A 1lg2_A 1lg1_A 1lq0_A 1hki_A* 1hkj_A* 1hkm_A* 1hkk_A* Length = 445 Back     alignment and structure
>2pi6_A Chitinase-3-like protein 1; complex, signaling protein; HET: NAG MAN; 1.65A {Ovis aries} SCOP: c.1.8.5 d.26.3.1 PDB: 2dpe_A* 1sr0_A* 1zl1_A* 1zbk_A* 2dsu_A* 2dsv_A* 2dsw_A* 2fdm_A* 2g41_A* 2g8z_A* 2dt1_A* 1zbv_A* 1zu8_A* 2aos_A* 2b31_A* 1zbw_A* 2dt0_A* 2dsz_A* 2dt2_A* 2dt3_A* ... Length = 361 Back     alignment and structure
>3uim_A Brassinosteroid insensitive 1-associated receptor; kinase, protein kinase, transferase; HET: SEP TPO ANP; 2.20A {Arabidopsis thaliana} PDB: 3tl8_A* Length = 326 Back     alignment and structure
>1jnd_A Imaginal DISC growth factor-2; IDGF, chitinase, insulin recep heparin, hormone-growth factor complex; HET: NAG BMA MAN; 1.30A {Drosophila melanogaster} SCOP: c.1.8.5 d.26.3.1 PDB: 1jne_A* Length = 420 Back     alignment and structure
>2qkw_B Protein kinase; three-helix bundle motif, AVRPTO-PTO duplex, layered beta- sheets, transferas; HET: SEP TPO; 3.20A {Solanum pimpinellifolium} PDB: 3hgk_A* Length = 321 Back     alignment and structure
>1w9p_A Chitinase; peptide inhibitors, argifin, argadin, glycosidase, hydrolase; 1.7A {Aspergillus fumigatus} SCOP: c.1.8.5 d.26.3.1 PDB: 1w9u_A* 1w9v_A* 2a3a_A* 2a3b_A* 2a3c_A* 2a3e_A* 2iuz_A* 3ch9_A 3chc_A* 3chd_A* 3che_A* 3chf_A* 1wno_A* Length = 433 Back     alignment and structure
>2nru_A Interleukin-1 receptor-associated kinase 4; inhibitor, IRAK, transferase; HET: TPO SEP T12; 2.00A {Homo sapiens} PDB: 2nry_A* 2oib_A* 2oic_A* 2oid_A* 2o8y_A* Length = 307 Back     alignment and structure
>1ll7_A Chitinase 1; beta-alpha barrel, hydrolase; 2.00A {Coccidioides immitis} SCOP: c.1.8.5 d.26.3.1 PDB: 1d2k_A 1ll4_A* 1ll6_A Length = 392 Back     alignment and structure
>3g6m_A Chitinase, crchi1; inhibitor, caffeine, glycosidase, hydrolas hydrolase inhibitor complex; HET: CFF; 1.65A {Bionectria ochroleuca} PDB: 3g6l_A* Length = 406 Back     alignment and structure
>1itx_A Chitinase A1, glycosyl hydrolase; alpha-beta (TIM) barrel; 1.10A {Bacillus circulans} SCOP: c.1.8.5 d.26.3.1 Length = 419 Back     alignment and structure
>3qok_A Putative chitinase II; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, glycosyl hydrolases family 18; 2.60A {Klebsiella pneumoniae subsp} Length = 420 Back     alignment and structure
>1edq_A Chitinase A; beta-alpha (TIM) barrel, hydrolase; 1.55A {Serratia marcescens} SCOP: b.1.18.2 c.1.8.5 d.26.3.1 PDB: 1ffq_A* 1ffr_A* 1ehn_A* 1ctn_A 1k9t_A* 1eib_A* 2wlz_A* 2wly_A* 2wm0_A* 2wk2_A* 1nh6_A* 1x6l_A 1rd6_A 1x6n_A* Length = 540 Back     alignment and structure
>1kfw_A Chitinase B; TIM barrel, hydrolase; 1.74A {Arthrobacter SP} SCOP: c.1.8.5 d.26.3.1 Length = 435 Back     alignment and structure
>1goi_A Chitinase B; chitin degradation, hydrolase, glycosidase; 1.45A {Serratia marcescens} SCOP: b.72.2.1 c.1.8.5 d.26.3.1 PDB: 1o6i_A* 1e6r_A* 1e15_A 1gpf_A* 1ur8_A* 1w1p_A* 1w1t_A* 1w1v_A* 1w1y_A* 1e6p_A 1e6n_A 1h0g_A* 1h0i_A* 1ogb_A 1ogg_A* 1e6z_A* 1ur9_A* Length = 499 Back     alignment and structure
>3fnd_A Chitinase; TIM-barrel, structural genomics, PSI-2, P structure initiative, NEW YORK SGX research center for STRU genomics, nysgxrc; 1.90A {Bacteroides thetaiotaomicron} PDB: 3co4_A Length = 312 Back     alignment and structure
>3oa5_A CHI1; TIM barrel, hydrolase; HET: 2PE; 1.74A {Yersinia} PDB: 4a5q_A Length = 574 Back     alignment and structure
>3cz8_A Putative sporulation-specific glycosylase YDHD; structural genomics, uncharacterized protein, protein struct initiative, PSI-2; 2.20A {Bacillus subtilis subsp} Length = 319 Back     alignment and structure
>3arx_A Chitinase A; TIM barrel, inhibitor complex, glycosidase, hydrolase, hydro hydrolase inhibitor complex; HET: POY; 1.16A {Vibrio harveyi} PDB: 3aro_A* 3arp_A* 3arr_A* 3arv_A* 3arw_A* 3arq_A* 3ary_A* 3arz_A* 3b8s_A 3b9e_A 3b9a_A* 3b9d_A 3as2_A* 3ars_A* 3art_A* 3as0_A* 3as1_A* 3aru_A* 3as3_A* Length = 584 Back     alignment and structure
>3soc_A Activin receptor type-2A; structural genomics consortium, SGC, transferase, protein KI; HET: GVD; 1.95A {Homo sapiens} PDB: 3q4t_A* 2qlu_A* Length = 322 Back     alignment and structure
>3bxw_B Chitinase domain-containing protein 1; TIM barrel, lysosome, secreted, hydrolase; 2.70A {Homo sapiens} Length = 393 Back     alignment and structure
>3sim_A Protein, family 18 chitinase; family 18 plant chitinase, TIM barrel, chitin binding, glyco hydrolase, hydrolase; 2.10A {Crocus vernus} Length = 275 Back     alignment and structure
>3g2f_A Bone morphogenetic protein receptor type-2; kinase, structural genomics, structural genomics consortium, ATP-binding, disease mutation; HET: ADP; 2.35A {Homo sapiens} Length = 336 Back     alignment and structure
>3s95_A LIMK-1, LIM domain kinase 1; structural genomics, structural genomics consortium, SGC, PR kinase, transferase-antibiotic complex; HET: STU GOL; 1.65A {Homo sapiens} Length = 310 Back     alignment and structure
>3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* Length = 309 Back     alignment and structure
>3gen_A Tyrosine-protein kinase BTK; bruton'S tyrosine kinase, 4-amino-5-(4-phenoxyphenyl)-5H- pyrrolo[3, 2-D]pyrimidin-7-YL-cyclopentane, TEC-family; HET: B43; 1.60A {Homo sapiens} PDB: 3k54_A* 3pj2_A* 3piy_A* 3piz_A* 3pj1_A* 3pix_A* 3pj3_A* 3p08_A 3ocs_A* 3oct_A* 1k2p_A Length = 283 Back     alignment and structure
>3dtc_A Mitogen-activated protein kinase kinase kinase 9; mixed-lineage kinase, MLK family, MLK1 and MLK3 subtype selective inhibitors; HET: VIN; 2.60A {Homo sapiens} Length = 271 Back     alignment and structure
>4fvq_A Tyrosine-protein kinase JAK2; janus protein kinase, pseudokinase, ATP binding, phosphoryla transferase; HET: ATP; 1.75A {Homo sapiens} PDB: 4fvp_A* 4fvr_A* Length = 289 Back     alignment and structure
>3kmu_A ILK, integrin-linked kinase; cell adhesion, ANK repeat, ATP-binding, cell junction, cell membrane, integrin-binding protein, membrane, nucleotide- binding; 1.80A {Homo sapiens} PDB: 3kmw_A* 3rep_A* Length = 271 Back     alignment and structure
>2y4i_B KSR2, HKSR2, kinase suppressor of RAS 2; transferase, KSR1; HET: ATP; 3.46A {Homo sapiens} Length = 319 Back     alignment and structure
>4aoj_A High affinity nerve growth factor receptor; transferase, inhibitor; HET: V4Z; 2.75A {Homo sapiens} Length = 329 Back     alignment and structure
>3t9t_A Tyrosine-protein kinase ITK/TSK; kinase domain, alpha/beta, ATP binding, phosphorylation, intracellular, transferase-transferase inhibitor complex; HET: IAQ; 1.65A {Homo sapiens} PDB: 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 1sm2_A* 1snu_A* 1snx_A 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Length = 267 Back     alignment and structure
>3lxl_A Tyrosine-protein kinase JAK3; TYK2, inflammation, cancer, PAN inhibitor, ATP-binding mutation, membrane, nucleotide-binding, phosphoprot SCID; HET: IZA; 1.74A {Homo sapiens} PDB: 3lxk_A* 3pjc_A* 1yvj_A* Length = 327 Back     alignment and structure
>2eva_A TAK1 kinase - TAB1 chimera fusion protein; transferase/transferase activator complex; HET: ADN; 2.00A {Homo sapiens} Length = 307 Back     alignment and structure
>3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* Length = 377 Back     alignment and structure
>3ugc_A Tyrosine-protein kinase JAK2; small molecule inhibitor, ATP binding, transferase-transfera inhibitor complex; HET: 046; 1.34A {} PDB: 3krr_A* 3lpb_A* 4aqc_A* 3q32_A* 3rvg_A* 3tjc_A* 3tjd_A* 2b7a_A* 3fup_A* 3e64_A* 3e62_A* 3e63_A* 2xa4_A* 3iok_A* 3io7_A* 3kck_A* 3jy9_A* Length = 295 Back     alignment and structure
>3v5q_A NT-3 growth factor receptor; kinase domain, kinase, phosphorylation, transferase-transfer inhibitor complex; HET: 0F4; 2.20A {Homo sapiens} Length = 297 Back     alignment and structure
>4f0f_A Serine/threonine-protein kinase ROCO4; LRRK2, ATP-binding, nucleotide serine/threonine-protein kinase, transferase, signaling Pro; HET: ACP; 1.80A {Dictyostelium discoideum} PDB: 4f0g_A 4f1t_A* 4f1m_A* 4f1o_A* Length = 287 Back     alignment and structure
>2w1i_A JAK2; chromosomal rearrangement, nucleotide-binding, tyrosine-protein kinase, proto-oncogene, phosphoprotein, disease mutation, SH2 domain; HET: PTR L0I; 2.60A {Homo sapiens} Length = 326 Back     alignment and structure
>3og7_A AKAP9-BRAF fusion protein; proto-oncogene, V600E, kinase, transferase; HET: 032; 2.45A {Homo sapiens} PDB: 3c4c_A* 3c4d_A* 3idp_A* 3ii5_A* 3d4q_A* 3ppj_A* 3ppk_A* 3prf_A* 3pri_A* 3psb_A* 3psd_A* 3q4c_A* 3skc_A* 3tv4_A* 3tv6_A* 2fb8_A* 4dbn_A* 1uwj_A* 1uwh_A* 3q96_A* Length = 289 Back     alignment and structure
>3zzw_A Tyrosine-protein kinase transmembrane receptor RO; transferase, neurotrophic tyrosine kinase, receptor-related NTRKR2; 2.90A {Homo sapiens} Length = 289 Back     alignment and structure
>3lxp_A Non-receptor tyrosine-protein kinase TYK2; JAK3, inflammation, cancer, PAN inhibitor, ATP-binding nucleotide-binding, phosphoprotein, SH2 domain; HET: PTR IZA; 1.65A {Homo sapiens} PDB: 3lxn_A* 3nz0_A* 3nyx_A* Length = 318 Back     alignment and structure
>3sxs_A Cytoplasmic tyrosine-protein kinase BMX; transferase-transferase inhibitor complex; HET: PP2; 1.89A {Homo sapiens} PDB: 3sxr_A* Length = 268 Back     alignment and structure
>3kfa_A Tyrosine-protein kinase ABL1; CML, drug resistance, inhibitor, ATP-binding, nucleotide-binding, oncogene, TRAN; HET: B91; 1.22A {Mus musculus} PDB: 2qoh_A* 3kf4_A* 3k5v_A* 1fpu_A* 1m52_A* 1iep_A* 2hzn_A* 1opj_A* 3ms9_A* 3mss_A* 3ik3_A* 2z60_A* 2e2b_A* 3pyy_A* 3oxz_A* 2g1t_A* 3ue4_A* 3oy3_A* 2hiw_A* 2v7a_A* ... Length = 288 Back     alignment and structure
>4e5w_A Tyrosine-protein kinase JAK1; kinase domain, transferase-transferase inhibit complex; HET: PTR 0NT; 1.86A {Homo sapiens} PDB: 4e4l_A* 4e4n_A* 3eyg_A* 3eyh_A* Length = 302 Back     alignment and structure
>1byg_A CSK, protein (C-terminal SRC kinase); protein kinase, phosphorylation, staurosporine, transferase; HET: STU; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 3d7u_A 3d7t_A* Length = 278 Back     alignment and structure
>2yfx_A Tyrosine-protein kinase receptor; nucleotide-binding, transferase; HET: VGH; 1.70A {Homo sapiens} PDB: 2xp2_A* 3aox_A* 2yhv_A 3lcs_A* 3lct_A* 4dce_A* 2xba_A* 2xb7_A* Length = 327 Back     alignment and structure
>2qol_A Ephrin receptor; receptor tyrosine kinase, juxtamembrane segment, structural genomics, mutant, structural genomics consortium, SGC, ATP- binding; 1.07A {Homo sapiens} PDB: 2qok_A 2qoi_A 2qoo_A 2qof_A 2qod_A 2qo9_A* 2gsf_A 2qo7_A* 2qo2_A* 2qoq_A* 2qon_A* 3fxx_A* 3fy2_A 2qoc_A* 2qob_A* 3dzq_A* 2r2p_A 2hel_A 2rei_A 3dko_A* ... Length = 373 Back     alignment and structure
>1luf_A Muscle-specific tyrosine kinase receptor MUSK; phosphorylation, signal transduction, MASS spectrometry, transferase; 2.05A {Rattus norvegicus} SCOP: d.144.1.7 Length = 343 Back     alignment and structure
>3lzb_A Epidermal growth factor receptor; epidermal growth factor kinase domain, multitargeted small M kinase inhibitor; HET: ITI; 2.70A {Homo sapiens} Length = 327 Back     alignment and structure
>1u46_A ACK-1, activated CDC42 kinase 1; tyrosine kinase, transferase; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 1u4d_A* 1u54_A* 3eqr_A* 3eqp_B* Length = 291 Back     alignment and structure
>3l9p_A Anaplastic lymphoma kinase; kinase domain, ATP-binding, glycoprotein, membrane, nucleotide-binding, phosphoprotein, proto-oncogene; 1.80A {Homo sapiens} Length = 367 Back     alignment and structure
>3kex_A Receptor tyrosine-protein kinase ERBB-3; kinase domain, inactive kinase, HER3, ATP-binding, cell membrane, membrane, nucleotide-binding; HET: ANP; 2.80A {Homo sapiens} PDB: 3lmg_A* Length = 325 Back     alignment and structure
>1mqb_A Ephrin type-A receptor 2; tyrosine protein kinase, transferase; HET: ANP; 2.30A {Homo sapiens} SCOP: d.144.1.7 Length = 333 Back     alignment and structure
>3pls_A Macrophage-stimulating protein receptor; protein kinase, CIS autophosphorylation conformation, recept tyrosine kinase, AMP-PNP, unphosphorylated; HET: ANP; 2.24A {Homo sapiens} Length = 298 Back     alignment and structure
>3f66_A Hepatocyte growth factor receptor; C-Met, protein kinase, quinoxaline, alternative splicing, ATP-binding, chromosomal rearrangement; HET: IHX; 1.40A {Homo sapiens} PDB: 3i5n_A* 3u6h_A* 3u6i_A* 3ccn_A* 2rfn_A* 2rfs_A* 3cd8_A* 3efj_A* 3efk_A* 3lq8_A* 3zxz_A* 2wkm_A* 2wgj_A* 3zze_A* 3q6w_A* 3r7o_A* 3q6u_A* 3cth_A* 3ce3_A* 3ctj_A* ... Length = 298 Back     alignment and structure
>2ivs_A Proto-oncogene tyrosine-protein kinase receptor RET; nucleotide-binding, hirschsprung disease, phosphorylation, disease mutation; HET: ACK; 2.00A {Homo sapiens} PDB: 2ivt_A* 2ivu_A* 2x2k_A* 2x2l_A* 2x2m_A* 2ivv_A* Length = 314 Back     alignment and structure
>3kul_A Ephrin type-A receptor 8; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase; HET: PTR; 2.15A {Homo sapiens} Length = 325 Back     alignment and structure
>3brb_A Proto-oncogene tyrosine-protein kinase MER; ATP-binding, disease mutation, glycoprotein, nucleot binding, phosphorylation, receptor; HET: ADP; 1.90A {Homo sapiens} PDB: 3bpr_A* 2p0c_A* Length = 313 Back     alignment and structure
>1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Length = 495 Back     alignment and structure
>1p4o_A Insulin-like growth factor I receptor protein; IGF-1R, kinase domain, hormone-growth factor complex; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 1m7n_A 3lvp_A* 3lw0_A* 1jqh_A* 2zm3_A* 3f5p_A* 3i81_A* 2oj9_A* 3nw5_A* 3nw6_A* 3nw7_A* 3o23_A* 3qqu_A* 3d94_A* 1k3a_A* 2z8c_A* 1ir3_A* 1gag_A* 1irk_A 3bu3_A* ... Length = 322 Back     alignment and structure
>1u59_A Tyrosine-protein kinase ZAP-70; transferase; HET: STU; 2.30A {Homo sapiens} SCOP: d.144.1.7 Length = 287 Back     alignment and structure
>3c1x_A Hepatocyte growth factor receptor; receptor tyrosine kinase, signal transduction, GRB2, SHC, ATP-binding, glycoprotein, membrane; HET: CKK; 2.17A {Homo sapiens} SCOP: d.144.1.7 Length = 373 Back     alignment and structure
>3qup_A Tyrosine-protein kinase receptor TYRO3; protein kinase inhibitor, receptor tyrosine kinase, spirocyc kinase domain, phosphotransfer, GAS6 ligand; HET: LUN; 1.90A {Mus musculus} Length = 323 Back     alignment and structure
>1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Length = 450 Back     alignment and structure
>3cc6_A Protein tyrosine kinase 2 beta; focal adhesion kinase, structural genomics, structural genom consortium, SGC, ATP-binding, membrane; 1.60A {Homo sapiens} PDB: 3fzs_A* 3et7_A 3fzo_A* 3fzr_A* 3fzp_A* 3fzt_A* 3h3c_A* Length = 281 Back     alignment and structure
>3poz_A Epidermal growth factor receptor; kinase domain, anti-oncogene, ATP-binding, cell cycle, disea mutation, glycoprotein, membrane, nucleotide-binding; HET: 03P; 1.50A {Homo sapiens} PDB: 2itx_A* 2ity_A* 2j5f_A* 2j6m_A* 2itw_A* 1m14_A 1m17_A* 3vjo_A* 2gs6_A* 2gs2_A* 2rf9_A 1xkk_A* 2eb2_A 3gop_A 2eb3_A* 2itn_A* 2ito_A* 2itp_A* 2itq_A* 2jiu_A* ... Length = 327 Back     alignment and structure
>1qpc_A LCK kinase; alpha beta fold, transferase; HET: PTR ANP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1qpe_A* 1qpj_A* 2pl0_A* 3kxz_A* 3ac1_A* 2zm4_A* 2zyb_A* 2zm1_A* 3ac2_A* 3ac3_A* 3ac4_A* 3ac5_A* 3ac8_A* 3acj_A* 3ack_A* 3ad4_A* 3ad5_A* 3ad6_A* 3kmm_A* 1qpd_A* ... Length = 279 Back     alignment and structure
>1fvr_A Tyrosine-protein kinase TIE-2; tyrosine kinase, transferase; 2.20A {Homo sapiens} SCOP: d.144.1.7 PDB: 2oo8_X* 2osc_A* 2p4i_A* 3l8p_A* 2wqb_A* Length = 327 Back     alignment and structure
>3mdy_A Bone morphogenetic protein receptor type-1B; complex (isomerase-protein kinase), receptor serine/threonin structural genomics consortium, SGC; HET: LDN; 2.05A {Homo sapiens} Length = 337 Back     alignment and structure
>3q4u_A Activin receptor type-1; structural genomics consortium, SGC, protein kinase, transfe; HET: LDN FLC; 1.82A {Homo sapiens} PDB: 3mtf_A* 3oom_A* 4dym_A* 3h9r_A* 3my0_A* Length = 301 Back     alignment and structure
>1mp8_A Focal adhesion kinase 1; tyrosine protein kinase, transferase; HET: ADP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 2ijm_A* 2etm_A* 3pxk_A* 2jkq_A* 2j0m_B* 2jkm_A* 2j0l_A* 3bz3_A* 2jko_A* 2jkk_A* Length = 281 Back     alignment and structure
>1xbb_A Tyrosine-protein kinase SYK; gleevec, STI-571, imatinib, spleen typrosine kinase, active conformation, structural genomics, structural genomix; HET: STI; 1.57A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xba_A* 1xbc_A* 3fqe_A* 3fqh_A* 3fqs_A* 3emg_A* 3srv_A* 4dfl_A* 4dfn_A* 3vf8_A* 3vf9_A* Length = 291 Back     alignment and structure
>2j0j_A Focal adhesion kinase 1; cell migration, FERM, transferase, integrin signaling; HET: 4ST; 2.80A {Gallus gallus} PDB: 2j0k_A* Length = 656 Back     alignment and structure
>2clq_A Mitogen-activated protein kinase kinase kinase 5; transferase, metal-binding, apoptosis; HET: STU; 2.3A {Homo sapiens} Length = 295 Back     alignment and structure
>2pvf_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; HET: PTR ACP; 1.80A {Homo sapiens} PDB: 3cly_A* 2pzr_A* 2pzp_A* 2pvy_A* 2pz5_A* 2q0b_A* 2pwl_A* 2py3_A* 3ri1_A* 1gjo_A 1oec_A* 3b2t_A* 3gql_A* 3gqi_A* 1fgk_A 1fgi_A* 1agw_A 2fgi_A* 3js2_A* 3ky2_A ... Length = 334 Back     alignment and structure
>2psq_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xr0_A Length = 370 Back     alignment and structure
>1b6c_B TGF-B superfamily receptor type I; complex (isomerase/protein kinase), receptor serine/threonine kinase; 2.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1ias_A 2x7o_A* 3faa_A* 3kcf_A* Length = 342 Back     alignment and structure
>1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Length = 454 Back     alignment and structure
>2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Length = 535 Back     alignment and structure
>1t46_A HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcoma viral oncogene homolog; kinase, structure, inhibitor, STI-571, gleevec, transferase activator; HET: STI; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1pkg_A* 1t45_A 3g0e_A* 3g0f_A* Length = 313 Back     alignment and structure
>2xir_A Vascular endothelial growth factor receptor 2; angiogenesis, nucleotide-binding, inhibitor, phosphorylation receptor, transferase, transmembrane; HET: 00J; 1.50A {Homo sapiens} PDB: 1vr2_A* 1ywn_A* 3vnt_A* 3c7q_A* 2oh4_A* 3u6j_A* 3efl_A* 2p2i_A* 3cjf_A* 3cjg_A* 3ewh_A* 2qu5_A* 2qu6_A* 2rl5_A* 3b8q_A* 3b8r_A* 2p2h_A* 3cp9_A* 3cpb_A* 3cpc_A* ... Length = 316 Back     alignment and structure
>2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} Length = 613 Back     alignment and structure
>2i1m_A Macrophage colony-stimulating factor 1 receptor; kinase domain, kinase inhibitor complex, transferase; HET: 5CN; 1.80A {Homo sapiens} PDB: 3bea_A* 3lcd_A* 2i0y_A* 2i0v_A* 3dpk_A* 3krj_A* 3krl_A* 2ogv_A 3lco_A* Length = 333 Back     alignment and structure
>3tt0_A Basic fibroblast growth factor receptor 1; kinase domain, transferase, transferase-transferase inhibito; HET: 07J; 2.80A {Homo sapiens} Length = 382 Back     alignment and structure
>1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Length = 452 Back     alignment and structure
>1rjb_A FL cytokine receptor; kinase, structure, autoinhibition, juxtamembrane domain, transferase; 2.10A {Homo sapiens} SCOP: d.144.1.7 Length = 344 Back     alignment and structure
>3e7e_A HBUB1, BUB1A, mitotic checkpoint serine/threonine-protein kinas; spindle assembly checkpoint, mitosis, kinase, activation, KE CDC20, ATP-binding; HET: ATP; 2.31A {Homo sapiens} Length = 365 Back     alignment and structure
>1edt_A Endo-beta-N-acetylglucosaminidase H, endo H; hydrolase (glucosidase); 1.90A {Streptomyces plicatus} SCOP: c.1.8.5 PDB: 1c90_A 1c8x_A 1c91_A 1c3f_A 1c92_A 1c8y_A 1c93_A Length = 271 Back     alignment and structure
>3n12_A Chitinase A, chinctu2; zinc atoms, complex, hydrolase; 1.20A {Bacillus cereus} PDB: 3n11_A 3n15_A* 3n13_A* 3n17_A* 3n18_A* 3n1a_A* Length = 333 Back     alignment and structure
>2y8v_A CHIC, class III chitinase, putative; afchic, hydrolase; 1.99A {Aspergillus fumigatus} Length = 290 Back     alignment and structure
>1t4h_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase; 1.80A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 3fpq_A Length = 290 Back     alignment and structure
>2buj_A Serine/threonine-protein kinase 16; transferase, ATP-binding, lipoprotein, myristate, PA phosphorylation; HET: STU; 2.6A {Homo sapiens} Length = 317 Back     alignment and structure
>2c30_A Serine/threonine-protein kinase PAK 6; CRIB domain, ATP-binding, transferase, nucleotide-binding; HET: SEP; 1.6A {Homo sapiens} PDB: 2f57_A* 2j0i_A* 2cdz_A* 2q0n_A* 2x4z_A* 2bva_A* Length = 321 Back     alignment and structure
>3fxz_A Serine/threonine-protein kinase PAK 1; transferase, ATP-binding, phosphorylation, allosteric enzyme, alternative splicing, apoptosis, cell junction; HET: TPO FLL; 1.64A {Homo sapiens} PDB: 3fy0_A* 4daw_A* 3q52_A* 3q53_A* 1yhw_A 1f3m_C 1yhv_A 2hy8_1* 3q4z_A* Length = 297 Back     alignment and structure
>3vhe_A Vascular endothelial growth factor receptor 2; kinase domain, kinase, transferase-transferase inhibitor COM; HET: 42Q; 1.55A {Homo sapiens} PDB: 1y6a_A* 1y6b_A* 3vid_A* 3hng_A* Length = 359 Back     alignment and structure
>2j7t_A Serine/threonine-protein kinase 10; transferase, ATP-binding, cell cycle progression, phosphorylation, disease mutation, nucleotide- binding; HET: 274; 2.0A {Homo sapiens} PDB: 4aot_A* 3zz2_A* 2j51_A* 2jfl_A* 2jfm_A* 2uv2_A* Length = 302 Back     alignment and structure
>4g3f_A NF-kappa-beta-inducing kinase; non-RD kinase, protein serine/threonine kinase, S based drug design, MAP3K14, transferase; HET: 0WB; 1.64A {Mus musculus} PDB: 4g3g_A* 4g3c_A 4dn5_A* Length = 336 Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Length = 573 Back     alignment and structure
>3dbq_A Dual specificity protein kinase TTK; MPS1 structure, kinase activation, phosphorylation, ATP- binding, nucleotide-binding, phosphoprotein; 2.70A {Homo sapiens} Length = 343 Back     alignment and structure
>3cek_A Dual specificity protein kinase TTK; HMPS1, PYT, ESK, phosphotyros picked threonine kinase, SGC, structural genomics consortiu binding; HET: 7PE; 2.30A {Homo sapiens} PDB: 3gfw_A* 3h9f_A* 2x9e_A* 3hmp_A* 3hmn_A* 3hmo_A* Length = 313 Back     alignment and structure
>1j1b_A Glycogen synthase kinase-3 beta; complex, TAU, AMPPNP, transferase; HET: ANP; 1.80A {Homo sapiens} SCOP: d.144.1.7 PDB: 1i09_A* 1j1c_A* 2jld_A* 3m1s_A* 3pup_A* 3du8_A* 1pyx_A* 1q41_A* 1q3w_A* 1q3d_A* 1q4l_A* 3q3b_A* 1q5k_A* 3i4b_A* 3l1s_A* 1r0e_A* 3zrk_A* 3zrl_A* 3zrm_A* 4dit_A* ... Length = 420 Back     alignment and structure
>2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A* Length = 390 Back     alignment and structure
>1kob_A Twitchin; kinase, intrasteric regulation; 2.30A {Aplysia californica} SCOP: d.144.1.7 Length = 387 Back     alignment and structure
>3is5_A Calcium-dependent protein kinase; CDPK, structural genomics, parasitology, structural genomics consortium, SGC, ATP-binding, nucleotide-binding; HET: ANP; 2.55A {Toxoplasma gondii} Length = 285 Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Length = 486 Back     alignment and structure
>1ua2_A CAK, cell division protein kinase 7; cell cycle, phosphorylation, protein-protein interaction, PR kinase, cell cycle, transferase; HET: TPO ATP; 3.02A {Homo sapiens} SCOP: d.144.1.7 Length = 346 Back     alignment and structure
>2a19_B Interferon-induced, double-stranded RNA-activated kinase; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Homo sapiens} PDB: 2a1a_B* Length = 284 Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Length = 494 Back     alignment and structure
>3a7i_A MST3 kinase, serine/threonine kinase 24 (STE20 homolog, yeast); two-LOBE protein kinase fold, ATP-binding, nucleotid binding, transferase; HET: TPO ADE; 1.45A {Homo sapiens} PDB: 3a7g_A* 3a7h_A* 3a7f_A* 3a7j_A* 3ckw_A 3ckx_A* 3ggf_A* 2xik_A* Length = 303 Back     alignment and structure
>3niz_A Rhodanese family protein; structural genomics, structural genomics consortium, SGC, phosphotransferase, cyclin dependent kinase; HET: ADP; 2.40A {Cryptosporidium parvum} PDB: 2qkr_A* Length = 311 Back     alignment and structure
>2vwi_A Serine/threonine-protein kinase OSR1; STE kinase, hypertension, transferase; HET: ANP; 2.15A {Homo sapiens} PDB: 3dak_A* Length = 303 Back     alignment and structure
>1ob3_A PFPK5, cell division control protein 2 homolog; transferase, serine/threonine-protein kinase, ATP-binding, phosphorylation, CDK; 1.9A {Plasmodium falciparum} SCOP: d.144.1.7 PDB: 1v0p_A* 1v0o_A* 1v0b_A Length = 288 Back     alignment and structure
>2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A* Length = 310 Back     alignment and structure
>3gni_B Strad alpha; kinase fold, pseudokinase, alpha helical repeat protein, ADA protein, ATP-binding, cell cycle, kinase, nucleotide-bindin nucleus; HET: ATP CIT; 2.35A {Homo sapiens} PDB: 2wtk_B* Length = 389 Back     alignment and structure
>2r3i_A Cell division protein kinase 2; serine/threonine-protein kinase, cell cycle, inhibition, cyclin-dependent kinase, cancer, ATP-binding; HET: SCF; 1.28A {Homo sapiens} PDB: 2r3j_A* 2r3k_A* 2r3l_A* 2r3m_A* 2r3n_A* 2r3o_A* 2r3p_A* 2r3q_A* 1jvp_P* 1buh_A 1ckp_A* 1di8_A* 1dm2_A* 1f5q_A 1fin_A* 1fq1_B* 1fvt_A* 1fvv_A* 1g5s_A* 1gih_A* ... Length = 299 Back     alignment and structure
>1u5q_A Serine/threonine protein kinase TAO2; transferase; HET: SEP; 2.10A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 1u5r_A* 2gcd_A* Length = 348 Back     alignment and structure
>3f3z_A Calcium/calmodulin-dependent protein kinase with domain and 4 calmodulin like EF...; calcium dependent protein kinase; HET: SEP DRK; 1.84A {Cryptosporidium parvum iowa II} PDB: 2qg5_A* Length = 277 Back     alignment and structure
>4aaa_A Cyclin-dependent kinase-like 2; transferase, phospho-mimetic; HET: DKI; 1.53A {Homo sapiens} Length = 331 Back     alignment and structure
>3com_A Serine/threonine-protein kinase 4; MST1, STE20-like kinase, PSI, structural genomics, protein structure initiative; HET: TPO; 2.20A {Homo sapiens} Length = 314 Back     alignment and structure
>3o0g_A Cell division protein kinase 5; kinase activator complex, kinase inhibitor complex, transferase-transferase activator complex; HET: 3O0; 1.95A {Homo sapiens} PDB: 1unh_A* 1ung_A* 1unl_A* 1h4l_A Length = 292 Back     alignment and structure
>4euu_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: SEP BX7; 1.80A {Homo sapiens} Length = 319 Back     alignment and structure
>3gbz_A Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; 1.85A {Giardia lamblia} PDB: 3gc0_A* Length = 329 Back     alignment and structure
>1zy4_A Serine/threonine-protein kinase GCN2; translation regulator, signal transduction, acid starvation, starvation stress response; 1.95A {Saccharomyces cerevisiae} PDB: 1zy5_A* 1zyd_A* 1zyc_A* 1zxe_A Length = 303 Back     alignment and structure
>4agu_A Cyclin-dependent kinase-like 1; transferase, phospho-mimetic; HET: D15; 2.40A {Homo sapiens} Length = 311 Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Length = 484 Back     alignment and structure
>2pmi_A Negative RE, cyclin-dependent protein kinase PHO85; cyclin-dependent kinase, signaling protein,transfera cycle complex; HET: MES AGS; 2.90A {Saccharomyces cerevisiae} PDB: 2pk9_A* Length = 317 Back     alignment and structure
>2wei_A Calmodulin-domain protein kinase 1, putative; nucleotide-binding, serine/threonine-protein kinase, CGD3_920, transferase; HET: VGG; 1.65A {Cryptosporidium parvum iowa II} PDB: 3dfa_A 3ma6_A* Length = 287 Back     alignment and structure
>4eut_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: BX7; 2.60A {Homo sapiens} Length = 396 Back     alignment and structure
>4e7w_A Glycogen synthase kinase 3; GSK3, PTyr195, transferase; HET: PTR; 3.30A {Ustilago maydis} Length = 394 Back     alignment and structure
>4apc_A Serine/threonine-protein kinase NEK1; transferase; 2.10A {Homo sapiens} Length = 350 Back     alignment and structure
>2x4f_A Myosin light chain kinase family member 4; LUNG, breast cancer, transferase, serine/threonine-protein kinase, nucleotide-binding; HET: 16X 1PE; 2.67A {Homo sapiens} Length = 373 Back     alignment and structure
>3hko_A Calcium/calmodulin-dependent protein kinase with domain and 2 calmodulin-like EF...; structural genomics, protist parasite; HET: ANP; 1.80A {Cryptosporidium parvum iowa II} Length = 345 Back     alignment and structure
>1x8b_A WEE1HU, WEE1-like protein kinase; cell cycle, transferase; HET: 824; 1.81A {Homo sapiens} PDB: 3bi6_A* 3biz_A* 3cqe_A* 3cr0_A* 2in6_A* 2io6_A* 2z2w_A* Length = 289 Back     alignment and structure
>3c0i_A Peripheral plasma membrane protein CASK; neurexin, Ca2+/calmodulin dependent protein kinase, Mg synaptic plasticity, pseudokinase, maguk; HET: 3AM; 1.85A {Homo sapiens} PDB: 3c0h_A* 3c0g_A* 3mfr_A* 3mfs_A* 3mft_A 3mfu_A* 3tac_A Length = 351 Back     alignment and structure
>1tki_A Titin; serine kinase, muscle, autoinhibition; 2.00A {Homo sapiens} SCOP: d.144.1.7 Length = 321 Back     alignment and structure
>3mtl_A Cell division protein kinase 16; pctaire1, indirubin, structural genomics, structural consortium, SGC, transferase; HET: FEF; 2.40A {Homo sapiens} Length = 324 Back     alignment and structure
>2rku_A Serine/threonine-protein kinase PLK1; structure of PLK1, selectivity residues, POLO-like K structure based drug design, ATP-binding; HET: R78 TLA SRT TAR; 1.95A {Homo sapiens} PDB: 2v5q_A 2yac_A* 4a4l_A* 4a4o_A* 3kb7_A* 3d5w_A* 3d5u_A* 3d5v_A 3db8_A* 3dbc_A* 3dbd_A* 3d5x_A* 3db6_A* 3dbe_A* 3dbf_A* Length = 294 Back     alignment and structure
>4g31_A Eukaryotic translation initiation factor 2-alpha; deletion mutant, catalytic domain, synthetic inhibitor, TRAN transferase inhibitor complex; HET: 0WH; 2.28A {Homo sapiens} PDB: 4g34_A* Length = 299 Back     alignment and structure
>2owb_A Serine/threonine-protein kinase PLK1; catalytic domain, POLO-like kinase1, transfera; HET: 626; 2.10A {Homo sapiens} PDB: 2ou7_A* 3fc2_A* 3thb_A* Length = 335 Back     alignment and structure
>2jam_A Calcium/calmodulin-dependent protein kinase type 1G; transferase, kinase, membrane, ATP-binding, prenylation, serine/threonine-protein kinase, alternative splicing; HET: J60; 1.7A {Homo sapiens} PDB: 2jc6_A* 1a06_A Length = 304 Back     alignment and structure
>3e3p_A Protein kinase, putative glycogen synthase kinase; leishmaniasis, transferase; 2.00A {Leishmania major} Length = 360 Back     alignment and structure
>3fdn_A Serine/threonine-protein kinase 6; aurora kinase inhibitors, virtual screening, X-RAY CO- crystal analysis, structure-based drug design (SBDD); HET: MMH; 1.90A {Homo sapiens} PDB: 3k5u_A* 3m11_A* 2c6e_A* 1muo_A* 2bmc_A* 2j4z_A* 1ol6_A* 3up2_A* 3unz_A* 3uo5_A* 3uo6_A* 3uod_A* 3uoh_A* 3uoj_A* 3uok_A* 3uo4_A* 3uol_A* 3up7_A* 3lau_A* 2wtv_A* ... Length = 279 Back     alignment and structure
>3qa8_A MGC80376 protein; kinase ubiquitin-like domain, phosphorylation, kinase domain ubiquitin-like domain, kinase, substrate binding; 3.60A {Xenopus laevis} PDB: 3qad_A* 3rzf_A* Length = 676 Back     alignment and structure
>3rgf_A Cyclin-dependent kinase 8; protein kinase complex, transferase,transcription; HET: BAX; 2.20A {Homo sapiens} Length = 405 Back     alignment and structure
>3kk8_A Calcium/calmodulin dependent protein kinase II; ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; HET: TPO; 1.72A {Caenorhabditis elegans} PDB: 3kk9_A* 3kl8_A 2vn9_A* 3bhh_A* Length = 284 Back     alignment and structure
>2x7f_A TRAF2 and NCK-interacting protein kinase; serine/threonine-protein kinase, phosphoprotein; HET: 824; 2.80A {Homo sapiens} Length = 326 Back     alignment and structure
>3bhy_A Death-associated protein kinase 3; death associated kinase, DAPK3, ZIP kinase, ZIPK, DAP kinase like kinase, DLK, structural genomics consortium; HET: 7CP; 1.24A {Homo sapiens} PDB: 3bqr_A* 2j90_A* 1yrp_A* 2yak_A* 2y4p_A* 3f5u_A* 1jks_A 1jkk_A* 1ig1_A* 1jkl_A 1jkt_A 3eh9_A* 3eha_A* 3f5g_A* 1p4f_A* 1wvw_A 1wvx_A* 1wvy_A* 2w4j_A* 3dgk_A ... Length = 283 Back     alignment and structure
>3soa_A Calcium/calmodulin-dependent protein kinase type alpha with A beta 7 linker; phosphorylation, cytosolic, transferase-transferase inhibitor complex; HET: DB8; 3.55A {Homo sapiens} Length = 444 Back     alignment and structure
>2bdw_A Hypothetical protein K11E8.1D; kinase, calmodulin activated, transferase; 1.80A {Caenorhabditis elegans} PDB: 2wel_A* 2v7o_A* 2vz6_A* 1cdm_B 1cm1_B 1cm4_B Length = 362 Back     alignment and structure
>2a2a_A Death-associated protein kinase 2; autoinhibition, transferase; 1.47A {Homo sapiens} PDB: 2cke_A* 1wmk_A 1z9x_A 2a27_A 2x0g_A 2xuu_A* 2w4k_A* 2xzs_A Length = 321 Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Length = 504 Back     alignment and structure
>3mi9_A Cell division protein kinase 9; P-TEFB, HIV-1, protein binding; HET: TPO; 2.10A {Homo sapiens} PDB: 3mia_A* 3blh_A* 3blq_A* 3blr_A* 3lq5_A* 3my1_A* 3tn8_A* 3tnh_A* 3tni_A* Length = 351 Back     alignment and structure
>2yab_A Death-associated protein kinase 2; apoptosis, transferase; HET: AMP; 1.90A {Mus musculus} PDB: 2yaa_A* 2ya9_A* Length = 361 Back     alignment and structure
>2y0a_A Death-associated protein kinase 1; transferase, calmodulin, esprit; HET: MES; 2.60A {Homo sapiens} Length = 326 Back     alignment and structure
>1nar_A Narbonin; plant SEED protein; 1.80A {Vicia narbonensis} SCOP: c.1.8.5 Length = 290 Back     alignment and structure
>2ebn_A Endo-beta-N-acetylglucosaminidase F1; hydrolase(glucosidase); 2.00A {Elizabethkingia meningoseptica} SCOP: c.1.8.5 Length = 289 Back     alignment and structure
>3ebv_A Chinitase A; chitinase A, CHIA, glycosidase, structural genomics, unknown function, hydrolase, PSI-2, protein structure initiative; 1.50A {Streptomyces coelicolor} Length = 302 Back     alignment and structure
>2w5a_A Serine/threonine-protein kinase NEK2; Ser/Thr protein kinase, nucleus, meiosis, mitosis, cytoplasm, metal-binding, phosphoprotein; HET: ADP; 1.55A {Homo sapiens} PDB: 2wqo_A* 2xk3_A* 2xk4_A* 2xk6_A* 2xk7_A* 2xk8_A* 2xkc_A* 2xkd_A* 2xke_A* 2xkf_A* 2xnm_A* 2xnn_A* 2xno_A* 2xnp_A* 4afe_A* 2jav_A* 2w5b_A* 2w5h_A 4a4x_A* Length = 279 Back     alignment and structure
>3rp9_A Mitogen-activated protein kinase; structural genomics, structural genomics consortium, SGC, TR; 2.40A {Toxoplasma gondii} Length = 458 Back     alignment and structure
>3ian_A Chitinase; structural genomics, hydrolase, glycosidase, PSI-2, protein structure initiative; 1.75A {Lactococcus lactis subsp} Length = 321 Back     alignment and structure
>3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A Length = 419 Back     alignment and structure
>2ycf_A Serine/threonine-protein kinase CHK2; transferase, anticancer, anticancer drug design; HET: YCF; 1.77A {Homo sapiens} PDB: 2yiq_A* 2w7x_A* 2ycq_A* 2ycs_A* 2w0j_A* 2yir_A* 2yit_A* 2wtj_A* 2cn8_A* 2wtc_A* 2wtd_A* 2wti_A* 2cn5_A* 2xbj_A* 2xm8_A* 2xm9_A* 2xk9_A* 2ycr_A* Length = 322 Back     alignment and structure
>3q60_A ROP5B; pseudokinase, transferase; HET: ATP; 1.72A {Toxoplasma gondii} PDB: 3q5z_A* Length = 371 Back     alignment and structure
>3pg1_A Mitogen-activated protein kinase, putative (MAP K protein); EPK Ser/Thr protein kinase fold, Ser/Thr protein kinase, TRA; 1.95A {Leishmania major} Length = 362 Back     alignment and structure
>3ll6_A Cyclin G-associated kinase; transferase, protein kinase, serine/threonine kinase, cyclin clathrine, membrane trafficking, structural genomics; 2.10A {Homo sapiens} Length = 337 Back     alignment and structure
>3p23_A Serine/threonine-protein kinase/endoribonuclease; kinase domain, kinase and RNAse function, ATP binding ssRNA dephosphorylated, hydrolase; HET: ADP; 2.70A {Homo sapiens} Length = 432 Back     alignment and structure
>3g33_A Cell division protein kinase 4; Ser/Thr protein kinase, cell cycle, phosphorylation, ATP-BIN cell division, disease mutation, kinase; 3.00A {Homo sapiens} Length = 308 Back     alignment and structure
>3cok_A Serine/threonine-protein kinase PLK4; POLO-like kinase 4, SAK, STK18, PSI, structural genomics, protein structure initiative; HET: ANP; 2.25A {Homo sapiens} Length = 278 Back     alignment and structure
>3qd2_B Eukaryotic translation initiation factor 2-alpha; EIF2A kinase, phosphoryalation, gene regulation; HET: TPO; 2.81A {Mus musculus} Length = 332 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1blx_A Cyclin-dependent kinase 6; inhibitor protein, cyclin-dependent kinase, cell cycle control, alpha/beta, complex (inhibitor protein/kinase); 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 1bi7_A 1bi8_A 1g3n_A 2f2c_B* 1jow_B* 2euf_B* 1xo2_B* 3nup_A* 3nux_A* 2w9z_B 2w99_B 2w96_B 2w9f_B Length = 326 Back     alignment and structure
>2vgo_A Serine/threonine-protein kinase 12-A; nucleotide-binding, serine/threonine-protein kinase, ATP-binding, transferase, coiled coil, cell division, kinase; HET: TPO AD5; 1.7A {Xenopus laevis} PDB: 2bfx_A* 2vgp_A* 3ztx_A* 2vrx_A* 2bfy_A* 4af3_A* 3dj6_A* 3d15_A* 3d2i_A* 3d2k_A* 3d14_A* 3dj5_A* 3dj7_A* 3daj_A* 1ol5_A* 1ol7_A* 2x6d_A* 2x6e_A* 2xng_A* 2dwb_A* ... Length = 284 Back     alignment and structure
>3eb0_A Putative uncharacterized protein; kinase cryptosporidium parvum, ATP-binding, kinase, nucleoti binding; HET: PTR DRK; 2.65A {Cryptosporidium parvum iowa II} Length = 383 Back     alignment and structure
>2ac3_A MAP kinase-interacting serine/threonine kinase 2; DFD motif, transferase; 2.10A {Homo sapiens} PDB: 2hw7_A* 2ac5_A* 2hw6_A Length = 316 Back     alignment and structure
>2qr7_A Ribosomal protein S6 kinase alpha-3; kinase domain, RSK2, autoinhibitory, ATP-binding, nucleotide phosphorylation, serine/threonine-protein kinase; 2.00A {Mus musculus} PDB: 2qr8_A 4d9t_A* 4d9u_A* 3rny_A 2wnt_A Length = 342 Back     alignment and structure
>2rio_A Serine/threonine-protein kinase/endoribonuclease IRE1; protein-nucleotide complex, ATP-binding, endoplasmic reticulum, glycoprotein; HET: ADP; 2.40A {Saccharomyces cerevisiae} PDB: 3lj0_A* 3lj1_A* 3lj2_A* 3fbv_A* 3sdm_A* 3sdj_A* Length = 434 Back     alignment and structure
>2i6l_A Mitogen-activated protein kinase 6; MAPK6, ERK3, extracellular signal regulated kinase 3, serine phosphorylation, threonine phosphorylation; 2.25A {Homo sapiens} Length = 320 Back     alignment and structure
>3n9x_A Phosphotransferase; malaria kinase, structural genomics, structural genomics CON SGC; 2.05A {Plasmodium berghei} PDB: 3nie_A* Length = 432 Back     alignment and structure
>2w4o_A Calcium/calmodulin-dependent protein kinase type IV; calmodulin-binding, nucleotide-binding, serine/threonine-protein kinase, ATP-binding; HET: DKI; 2.17A {Homo sapiens} Length = 349 Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Length = 681 Back     alignment and structure
>3nsz_A CK II alpha, casein kinase II subunit alpha; inhibitor, transferase-transferase inhibitor CO; HET: ANP; 1.30A {Homo sapiens} PDB: 2r7i_A 3pe1_A* 1jwh_A* 3pe2_A* 3r0t_A* 3h30_A* 3q9w_A* 3q9x_A* 3q9y_A* 3q9z_A* 3qa0_A 3bqc_A* 2rkp_A* 3c13_A* 3fwq_A 3rps_A* 3mb7_A* 3mb6_A* 3owj_A* 3owk_A* ... Length = 330 Back     alignment and structure
>2vuw_A Serine/threonine-protein kinase haspin; cell cycle, transferase, CAsp8, nucleotide binding; HET: MSE 5ID MPD; 1.80A {Homo sapiens} PDB: 3f2n_A* 3e7v_A* 3dlz_A* 3fmd_A* 3iq7_A* 2wb8_A Length = 336 Back     alignment and structure
>3uqc_A Probable conserved transmembrane protein; structural genomics, TB structural genomics consortium, TBSG fold, FHAA, transferase; 2.26A {Mycobacterium tuberculosis} PDB: 3oun_B* 3otv_A 3ouk_A Length = 286 Back     alignment and structure
>3qyz_A Mitogen-activated protein kinase 1; transferase, serine/threonine-protein kinase, ATP-binding CE phosphorylation; HET: CME Z8B SO4; 1.46A {Rattus norvegicus} PDB: 2fys_B 1erk_A* 3qyi_A* 3erk_A* 3qyw_A* 4erk_A* 2z7l_A* 2erk_A* 1gol_A* 2gph_A 3o71_A 3r63_A 3c9w_A* 2y9q_A* 3sa0_A* 1wzy_A* 2e14_A* 1tvo_A* 2ojg_A* 2oji_A* ... Length = 364 Back     alignment and structure
>2y7j_A Phosphorylase B kinase gamma catalytic chain, testis/liver isoform; transferase; HET: B49; 2.50A {Homo sapiens} PDB: 1h0t_A 1lp1_B 1q2n_A 2spz_A 3mzw_B* 1ss1_A 2jwd_A 1bdc_A 1bdd_A 1fc2_C* 2b87_A 2b88_A 1h0t_B 1lp1_A 2b87_B 2b89_A 3s1k_A Length = 365 Back     alignment and structure
>3lm5_A Serine/threonine-protein kinase 17B; STK17B, serine/threonine kinase 17B, DRAK2, DAP kinase relat apoptosis-inducing protein kinase 2; HET: QUE; 2.29A {Homo sapiens} PDB: 3lm0_A* Length = 327 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query580
3aqu_A356 AT4G19810; stress response, TIM barrel, hydrolase, 100.0
3alf_A353 Chitinase, class V; hydrolase; 1.20A {Nicotiana ta 100.0
4ay1_A365 Chitinase-3-like protein 2; chilectin, lectin, chi 100.0
3fy1_A395 Amcase, TSA1902, acidic mammalian chitinase; struc 100.0
1vf8_A377 YM1, secretory protein; chitinase, CHI-lectin, str 100.0
1wb0_A445 Chitinase 1, chitotriosidase 1; cyclopentapeptide 100.0
2pi6_A361 Chitinase-3-like protein 1; complex, signaling pro 100.0
1itx_A419 Chitinase A1, glycosyl hydrolase; alpha-beta (TIM) 100.0
3qok_A420 Putative chitinase II; structural genomics, PSI-bi 100.0
1kfw_A435 Chitinase B; TIM barrel, hydrolase; 1.74A {Arthrob 100.0
1jnd_A420 Imaginal DISC growth factor-2; IDGF, chitinase, in 100.0
3g6m_A406 Chitinase, crchi1; inhibitor, caffeine, glycosidas 100.0
1edq_A540 Chitinase A; beta-alpha (TIM) barrel, hydrolase; 1 100.0
1goi_A499 Chitinase B; chitin degradation, hydrolase, glycos 100.0
3arx_A584 Chitinase A; TIM barrel, inhibitor complex, glycos 100.0
1ll7_A392 Chitinase 1; beta-alpha barrel, hydrolase; 2.00A { 100.0
1w9p_A433 Chitinase; peptide inhibitors, argifin, argadin, g 100.0
3oa5_A574 CHI1; TIM barrel, hydrolase; HET: 2PE; 1.74A {Yers 100.0
3cz8_A319 Putative sporulation-specific glycosylase YDHD; st 100.0
3fnd_A312 Chitinase; TIM-barrel, structural genomics, PSI-2, 100.0
3bxw_B393 Chitinase domain-containing protein 1; TIM barrel, 100.0
1nar_A290 Narbonin; plant SEED protein; 1.80A {Vicia narbone 100.0
3sim_A275 Protein, family 18 chitinase; family 18 plant chit 100.0
3n12_A333 Chitinase A, chinctu2; zinc atoms, complex, hydrol 100.0
4axn_A328 Chitinase C1; hydrolase; 1.68A {Serratia marcescen 100.0
2y8v_A290 CHIC, class III chitinase, putative; afchic, hydro 100.0
3ebv_A302 Chinitase A; chitinase A, CHIA, glycosidase, struc 100.0
3ian_A321 Chitinase; structural genomics, hydrolase, glycosi 100.0
4ac1_X283 Endo-N-acetyl-beta-D-glucosaminidase; hydrolase, g 99.97
2hvm_A273 Hevamine; hydrolase, chitinase/lysozyme; 1.80A {He 99.97
2uy2_A294 Endochitinase; carbohydrate metabolism, polysaccha 99.96
2gsj_A271 Protein PPL-2; mimosoideae, chimerolectin, endochi 99.96
1edt_A271 Endo-beta-N-acetylglucosaminidase H, endo H; hydro 99.96
1eok_A290 Endo-beta-N-acetylglucosaminidase F3; alpha/beta-b 99.95
1cnv_A299 Concanavalin B; plant chitinase, chitin binding pr 99.94
2xtk_A310 CHIA1, class III chitinase CHIA1; hydrolase, GH18; 99.94
2ebn_A289 Endo-beta-N-acetylglucosaminidase F1; hydrolase(gl 99.92
1ta3_A274 XIP-1, xylanase inhibitor protein I; beta alpha ba 99.9
4asz_A 299 BDNF/NT-3 growth factors receptor; transferase, TR 99.85
4aoj_A 329 High affinity nerve growth factor receptor; transf 99.84
4gt4_A 308 Tyrosine-protein kinase transmembrane receptor RO; 99.83
3mu7_A273 XAIP-II, xylanase and alpha-amylase inhibitor prot 99.82
3poh_A451 Endo-beta-N-acetylglucosaminidase F1; TIM barrel, 99.82
2dsk_A311 Chitinase; catalytic domain, active domain, crysta 99.81
4b9d_A 350 Serine/threonine-protein kinase NEK1; transferase, 99.8
3omv_A 307 RAF proto-oncogene serine/threonine-protein kinas; 99.79
4fih_A 346 Serine/threonine-protein kinase PAK 4; kinase doma 99.79
4aw0_A 311 HPDK1, 3-phosphoinositide-dependent protein kinase 99.79
4fie_A 423 Serine/threonine-protein kinase PAK 4; kinase doma 99.78
3fpq_A 290 Serine/threonine-protein kinase WNK1; protein seri 99.77
4ase_A 353 Vascular endothelial growth factor receptor 2; tra 99.76
4g31_A 299 Eukaryotic translation initiation factor 2-alpha; 99.76
3hyh_A 275 Carbon catabolite-derepressing protein kinase; kin 99.75
4g3f_A 336 NF-kappa-beta-inducing kinase; non-RD kinase, prot 99.75
3hmm_A 303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 99.74
3ubd_A 304 Ribosomal protein S6 kinase alpha-3; kinase-inhibi 99.74
3uto_A 573 Twitchin; kinase, muscle sarcomere, transferase; H 99.7
4b99_A 398 Mitogen-activated protein kinase 7; transferase, i 99.68
3v5w_A 689 G-protein coupled receptor kinase 2; inhibitor com 99.64
2qkw_B 321 Protein kinase; three-helix bundle motif, AVRPTO-P 99.63
3s95_A 310 LIMK-1, LIM domain kinase 1; structural genomics, 99.62
4f9c_A 361 Cell division cycle 7-related protein kinase; Ser/ 99.62
3uim_A 326 Brassinosteroid insensitive 1-associated receptor; 99.61
3fxz_A 297 Serine/threonine-protein kinase PAK 1; transferase 99.61
2c30_A 321 Serine/threonine-protein kinase PAK 6; CRIB domain 99.6
3fe3_A 328 MAP/microtubule affinity-regulating kinase 3; seri 99.6
2nru_A 307 Interleukin-1 receptor-associated kinase 4; inhibi 99.6
2yab_A 361 Death-associated protein kinase 2; apoptosis, tran 99.59
3zgw_A 347 Maternal embryonic leucine zipper kinase; transfer 99.59
2qol_A 373 Ephrin receptor; receptor tyrosine kinase, juxtame 99.59
4hcu_A 269 Tyrosine-protein kinase ITK/TSK; transferase-trans 99.58
3p86_A 309 Serine/threonine-protein kinase CTR1; ETR1, ERS1, 99.58
4aw2_A 437 Serine/threonine-protein kinase MRCK alpha; transf 99.58
3qd2_B 332 Eukaryotic translation initiation factor 2-alpha; 99.58
3cbl_A 377 C-FES, proto-oncogene tyrosine-protein kinase FES/ 99.58
1o6l_A 337 RAC-beta serine/threonine protein kinase; protein 99.58
2y0a_A 326 Death-associated protein kinase 1; transferase, ca 99.57
4euu_A 319 Serine/threonine-protein kinase TBK1; ATP binding, 99.57
3kmu_A 271 ILK, integrin-linked kinase; cell adhesion, ANK re 99.57
3uqc_A 286 Probable conserved transmembrane protein; structur 99.57
3kul_A 325 Ephrin type-A receptor 8; ATP-binding, kinase, nuc 99.57
1kob_A 387 Twitchin; kinase, intrasteric regulation; 2.30A {A 99.57
1tki_A 321 Titin; serine kinase, muscle, autoinhibition; 2.00 99.57
1opk_A 495 P150, C-ABL, proto-oncogene tyrosine-protein kinas 99.56
2psq_A 370 Fibroblast growth factor receptor 2; kinase domain 99.56
3f3z_A 277 Calcium/calmodulin-dependent protein kinase with d 99.56
1fot_A 318 TPK1 delta, CAMP-dependent protein kinase type 1; 99.56
3tki_A 323 Serine/threonine-protein kinase CHK1; cell checkpo 99.56
1k9a_A 450 Carboxyl-terminal SRC kinase; COOH-terminal SRC ki 99.56
2bdw_A 362 Hypothetical protein K11E8.1D; kinase, calmodulin 99.56
3ugc_A 295 Tyrosine-protein kinase JAK2; small molecule inhib 99.56
4fvq_A 289 Tyrosine-protein kinase JAK2; janus protein kinase 99.56
1qcf_A 454 Haematopoetic cell kinase (HCK); tyrosine kinase-i 99.56
3gen_A 283 Tyrosine-protein kinase BTK; bruton'S tyrosine kin 99.56
4eqm_A 294 Protein kinase; transferase; HET: ANP; 3.00A {Stap 99.56
3uc3_A 361 Serine/threonine-protein kinase SRK2I; SNRK2, ABA 99.55
3sxs_A 268 Cytoplasmic tyrosine-protein kinase BMX; transfera 99.55
2ac3_A 316 MAP kinase-interacting serine/threonine kinase 2; 99.55
3v8s_A 410 RHO-associated protein kinase 1; dimerization, myo 99.55
2ivs_A 314 Proto-oncogene tyrosine-protein kinase receptor RE 99.55
2x4f_A 373 Myosin light chain kinase family member 4; LUNG, b 99.55
3c0i_A 351 Peripheral plasma membrane protein CASK; neurexin, 99.54
1fmk_A 452 C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros 99.54
1luf_A 343 Muscle-specific tyrosine kinase receptor MUSK; pho 99.54
3txo_A 353 PKC-L, NPKC-ETA, protein kinase C ETA type; phosph 99.54
3l9p_A 367 Anaplastic lymphoma kinase; kinase domain, ATP-bin 99.54
3a62_A 327 Ribosomal protein S6 kinase beta-1; kinase domain, 99.54
2vd5_A 412 DMPK protein; serine/threonine-protein kinase, kin 99.54
4fr4_A 384 YANK1, serine/threonine-protein kinase 32A; struct 99.54
3vhe_A 359 Vascular endothelial growth factor receptor 2; kin 99.54
3t9t_A 267 Tyrosine-protein kinase ITK/TSK; kinase domain, al 99.53
1xjd_A 345 Protein kinase C, theta type; PKC-theta, ATP, AMP, 99.53
1rdq_E 350 PKA C-alpha, CAMP-dependent protein kinase, alpha- 99.53
3gni_B 389 Strad alpha; kinase fold, pseudokinase, alpha heli 99.53
3a8x_A 345 Protein kinase C IOTA type; transferase; HET: TPO; 99.53
2w4o_A 349 Calcium/calmodulin-dependent protein kinase type I 99.53
4eut_A 396 Serine/threonine-protein kinase TBK1; ATP binding, 99.53
3soc_A 322 Activin receptor type-2A; structural genomics cons 99.53
2h8h_A 535 Proto-oncogene tyrosine-protein kinase SRC; SRC ki 99.53
2jam_A 304 Calcium/calmodulin-dependent protein kinase type 1 99.53
2a2a_A 321 Death-associated protein kinase 2; autoinhibition, 99.53
2clq_A 295 Mitogen-activated protein kinase kinase kinase 5; 99.53
3is5_A 285 Calcium-dependent protein kinase; CDPK, structural 99.53
2pmi_A 317 Negative RE, cyclin-dependent protein kinase PHO85 99.52
3bhy_A 283 Death-associated protein kinase 3; death associate 99.52
4dc2_A 396 Protein kinase C IOTA type; kinase, substrate, cel 99.52
2y94_A 476 5'-AMP-activated protein kinase catalytic subunit; 99.52
2j7t_A 302 Serine/threonine-protein kinase 10; transferase, A 99.52
3soa_A 444 Calcium/calmodulin-dependent protein kinase type a 99.52
1x8b_A 289 WEE1HU, WEE1-like protein kinase; cell cycle, tran 99.51
3niz_A 311 Rhodanese family protein; structural genomics, str 99.51
3kfa_A 288 Tyrosine-protein kinase ABL1; CML, drug resistance 99.51
3ork_A 311 Serine/threonine protein kinase; structural genomi 99.51
3hko_A 345 Calcium/calmodulin-dependent protein kinase with d 99.51
1ob3_A 288 PFPK5, cell division control protein 2 homolog; tr 99.51
3tt0_A 382 Basic fibroblast growth factor receptor 1; kinase 99.51
2pvf_A 334 Fibroblast growth factor receptor 2; kinase domain 99.51
3q5i_A 504 Protein kinase; CDPK, malaria, phosphotransferase, 99.51
3cok_A 278 Serine/threonine-protein kinase PLK4; POLO-like ki 99.51
3dtc_A 271 Mitogen-activated protein kinase kinase kinase 9; 99.51
2buj_A 317 Serine/threonine-protein kinase 16; transferase, A 99.51
2yex_A 276 Serine/threonine-protein kinase CHK1; transferase, 99.5
1qpc_A 279 LCK kinase; alpha beta fold, transferase; HET: PTR 99.5
3lij_A 494 Calcium/calmodulin dependent protein kinase with A 99.5
2eva_A 307 TAK1 kinase - TAB1 chimera fusion protein; transfe 99.5
4e5w_A 302 Tyrosine-protein kinase JAK1; kinase domain, trans 99.5
3nyv_A 484 Calmodulin-domain protein kinase 1; serine/threoni 99.5
2w1i_A 326 JAK2; chromosomal rearrangement, nucleotide-bindin 99.5
3lxl_A 327 Tyrosine-protein kinase JAK3; TYK2, inflammation, 99.5
3h4j_B 336 AMPK kdaid, SNF1-like protein kinase SSP2; ATP-bin 99.5
1rjb_A 344 FL cytokine receptor; kinase, structure, autoinhib 99.5
4ejn_A 446 RAC-alpha serine/threonine-protein kinase; AKT1, a 99.5
3kk8_A 284 Calcium/calmodulin dependent protein kinase II; AT 99.5
1p4o_A 322 Insulin-like growth factor I receptor protein; IGF 99.5
2i0e_A 353 Protein kinase C-beta II; serine/threonine protein 99.5
3eqc_A 360 Dual specificity mitogen-activated protein kinase; 99.5
3o0g_A 292 Cell division protein kinase 5; kinase activator c 99.5
4agu_A 311 Cyclin-dependent kinase-like 1; transferase, phosp 99.5
2zv2_A 298 Calcium/calmodulin-dependent protein kinase kinas; 99.5
2h6d_A 276 5'-AMP-activated protein kinase catalytic subunit 99.5
3kn6_A 325 Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1 99.49
1t46_A 313 HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcom 99.49
2rku_A 294 Serine/threonine-protein kinase PLK1; structure of 99.49
3gbz_A 329 Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide- 99.49
3qup_A 323 Tyrosine-protein kinase receptor TYRO3; protein ki 99.49
2acx_A 576 G protein-coupled receptor kinase 6; GRK, G transf 99.49
2owb_A 335 Serine/threonine-protein kinase PLK1; catalytic do 99.49
3mwu_A 486 Calmodulin-domain protein kinase 1; serine/threoni 99.49
3i6u_A 419 CDS1, serine/threonine-protein kinase CHK2; Ser/Th 99.49
2qr7_A 342 Ribosomal protein S6 kinase alpha-3; kinase domain 99.48
2h34_A 309 Serine/threonine-protein kinase PKNE; apoenzyme, t 99.48
2yfx_A 327 Tyrosine-protein kinase receptor; nucleotide-bindi 99.48
2ozo_A 613 Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t 99.48
2r5t_A 373 Serine/threonine-protein kinase SGK1; AGC protein 99.48
2wqm_A 310 Serine/threonine-protein kinase NEK7; ATP-binding, 99.48
3a7i_A 303 MST3 kinase, serine/threonine kinase 24 (STE20 hom 99.48
2eue_A 275 Carbon catabolite derepressing protein kinase; kin 99.48
4f0f_A 287 Serine/threonine-protein kinase ROCO4; LRRK2, ATP- 99.48
2wei_A 287 Calmodulin-domain protein kinase 1, putative; nucl 99.48
1u59_A 287 Tyrosine-protein kinase ZAP-70; transferase; HET: 99.48
1t4h_A 290 Serine/threonine-protein kinase WNK1; protein seri 99.48
3fdn_A 279 Serine/threonine-protein kinase 6; aurora kinase i 99.48
1phk_A 298 Phosphorylase kinase; glycogen metabolism, transfe 99.48
1mqb_A 333 Ephrin type-A receptor 2; tyrosine protein kinase, 99.48
3llt_A 360 Serine/threonine kinase-1, pflammer; lammer kinase 99.48
3lxp_A 318 Non-receptor tyrosine-protein kinase TYK2; JAK3, i 99.48
2w5a_A 279 Serine/threonine-protein kinase NEK2; Ser/Thr prot 99.47
1u5q_A 348 Serine/threonine protein kinase TAO2; transferase; 99.47
1mp8_A 281 Focal adhesion kinase 1; tyrosine protein kinase, 99.47
2vgo_A 284 Serine/threonine-protein kinase 12-A; nucleotide-b 99.47
2ycf_A 322 Serine/threonine-protein kinase CHK2; transferase, 99.47
1zy4_A 303 Serine/threonine-protein kinase GCN2; translation 99.47
2pml_X 348 PFPK7, Ser/Thr protein kinase; phosphorylati trans 99.46
1fvr_A 327 Tyrosine-protein kinase TIE-2; tyrosine kinase, tr 99.46
2i1m_A 333 Macrophage colony-stimulating factor 1 receptor; k 99.46
1xbb_A 291 Tyrosine-protein kinase SYK; gleevec, STI-571, ima 99.46
2vwi_A 303 Serine/threonine-protein kinase OSR1; STE kinase, 99.46
3c4z_A 543 Rhodopsin kinase; Ser/Thr kinase, RGS homology dom 99.46
2xir_A 316 Vascular endothelial growth factor receptor 2; ang 99.46
4aaa_A 331 Cyclin-dependent kinase-like 2; transferase, phosp 99.46
3pg1_A 362 Mitogen-activated protein kinase, putative (MAP K 99.46
3poz_A 327 Epidermal growth factor receptor; kinase domain, a 99.45
3q4u_A 301 Activin receptor type-1; structural genomics conso 99.45
2x7f_A 326 TRAF2 and NCK-interacting protein kinase; serine/t 99.45
3c1x_A 373 Hepatocyte growth factor receptor; receptor tyrosi 99.45
3e7e_A 365 HBUB1, BUB1A, mitotic checkpoint serine/threonine- 99.45
2i6l_A 320 Mitogen-activated protein kinase 6; MAPK6, ERK3, e 99.45
1vzo_A 355 Ribosomal protein S6 kinase alpha 5; protein kinas 99.45
3lb7_A 307 RAF proto-oncogene serine/threonine-protein kinas; 99.45
2izr_A 330 Casein kinase I isoform gamma-3; serine/threonine- 99.45
3dls_A 335 PAS domain-containing serine/threonine-protein KI; 99.45
3f66_A 298 Hepatocyte growth factor receptor; C-Met, protein 99.45
3gxj_A 303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 99.44
3com_A 314 Serine/threonine-protein kinase 4; MST1, STE20-lik 99.44
4fl3_A 635 Tyrosine-protein kinase SYK; transferase; HET: ANP 99.44
3brb_A 313 Proto-oncogene tyrosine-protein kinase MER; ATP-bi 99.44
3pls_A 298 Macrophage-stimulating protein receptor; protein k 99.44
3n9x_A 432 Phosphotransferase; malaria kinase, structural gen 99.44
3rp9_A 458 Mitogen-activated protein kinase; structural genom 99.44
2vuw_A 336 Serine/threonine-protein kinase haspin; cell cycle 99.44
2y7j_A 365 Phosphorylase B kinase gamma catalytic chain, test 99.44
3dbq_A 343 Dual specificity protein kinase TTK; MPS1 structur 99.44
2a19_B 284 Interferon-induced, double-stranded RNA-activated 99.43
2r3i_A 299 Cell division protein kinase 2; serine/threonine-p 99.43
3p1a_A 311 MYT1 kinase, membrane-associated tyrosine- and thr 99.43
3an0_A 340 Dual specificity mitogen-activated protein kinase; 99.43
1byg_A 278 CSK, protein (C-terminal SRC kinase); protein kina 99.43
3ll6_A 337 Cyclin G-associated kinase; transferase, protein k 99.43
3og7_A 289 AKAP9-BRAF fusion protein; proto-oncogene, V600E, 99.43
3mtl_A 324 Cell division protein kinase 16; pctaire1, indirub 99.43
2zmd_A 390 Dual specificity protein kinase TTK; MPS1, T686A, 99.42
3lm5_A 327 Serine/threonine-protein kinase 17B; STK17B, serin 99.42
3cc6_A 281 Protein tyrosine kinase 2 beta; focal adhesion kin 99.42
1ua2_A 346 CAK, cell division protein kinase 7; cell cycle, p 99.42
1b6c_B 342 TGF-B superfamily receptor type I; complex (isomer 99.42
2wtk_C 305 Serine/threonine-protein kinase 11; transferase-me 99.41
3nsz_A 330 CK II alpha, casein kinase II subunit alpha; inhib 99.41
3kex_A 325 Receptor tyrosine-protein kinase ERBB-3; kinase do 99.41
3mdy_A 337 Bone morphogenetic protein receptor type-1B; compl 99.41
1nxk_A 400 MAP kinase-activated protein kinase 2; MK2, phosph 99.41
3lzb_A 327 Epidermal growth factor receptor; epidermal growth 99.4
1cm8_A 367 Phosphorylated MAP kinase P38-gamma; phosphorylati 99.4
3eb0_A 383 Putative uncharacterized protein; kinase cryptospo 99.4
3m2w_A 299 MAP kinase-activated protein kinase 2; small molec 99.39
3pfq_A 674 PKC-B, PKC-beta, protein kinase C beta type; phosp 99.39
3fme_A 290 Dual specificity mitogen-activated protein kinase; 99.39
3g33_A 308 Cell division protein kinase 4; Ser/Thr protein ki 99.39
3mi9_A 351 Cell division protein kinase 9; P-TEFB, HIV-1, pro 99.39
3ttj_A 464 Mitogen-activated protein kinase 10; JNK3, protein 99.39
3byv_A 377 Rhoptry kinase; malaria, transferase, structural g 99.38
3oz6_A 388 Mitogen-activated protein kinase 1, serine/threon 99.38
3qa8_A 676 MGC80376 protein; kinase ubiquitin-like domain, ph 99.38
2j0j_A 656 Focal adhesion kinase 1; cell migration, FERM, tra 99.38
2xrw_A 371 Mitogen-activated protein kinase 8; transcription, 99.38
1u46_A 291 ACK-1, activated CDC42 kinase 1; tyrosine kinase, 99.38
2y4i_B 319 KSR2, HKSR2, kinase suppressor of RAS 2; transfera 99.38
2pzi_A 681 Probable serine/threonine-protein kinase PKNG; ATP 99.37
1csn_A 298 Casein kinase-1; phosphotransferase; HET: ATP; 2.0 99.37
2v62_A 345 Serine/threonine-protein kinase VRK2; transferase, 99.37
2iwi_A 312 Serine/threonine-protein kinase PIM-2; nucleotide- 99.37
2b9h_A 353 MAP kinase FUS3, mitogen-activated protein kinase 99.36
2fst_X 367 Mitogen-activated protein kinase 14; active mutant 99.36
3qyz_A 364 Mitogen-activated protein kinase 1; transferase, s 99.36
3op5_A 364 Serine/threonine-protein kinase VRK1; adenosine tr 99.36
3cek_A 313 Dual specificity protein kinase TTK; HMPS1, PYT, E 99.36
4exu_A 371 Mitogen-activated protein kinase 13; P38 kinase, t 99.35
3g2f_A 336 Bone morphogenetic protein receptor type-2; kinase 99.34
2jii_A 352 Serine/threonine-protein kinase VRK3 molecule: VA 99.34
3coi_A 353 Mitogen-activated protein kinase 13; P38D, P38delt 99.34
1blx_A 326 Cyclin-dependent kinase 6; inhibitor protein, cycl 99.33
3fhr_A 336 MAP kinase-activated protein kinase 3; kinase-inhi 99.33
3e3p_A 360 Protein kinase, putative glycogen synthase kinase; 99.32
3kvw_A 429 DYRK2, dual specificity tyrosine-phosphorylation-r 99.32
1wak_A 397 Serine/threonine-protein kinase SPRK1; SRPK, trans 99.32
3aln_A 327 Dual specificity mitogen-activated protein kinase; 99.32
4e7w_A 394 Glycogen synthase kinase 3; GSK3, PTyr195, transfe 99.31
3rgf_A 405 Cyclin-dependent kinase 8; protein kinase complex, 99.3
1z57_A 339 Dual specificity protein kinase CLK1; protein tyro 99.3
3uzp_A 296 CKI-delta, CKID, casein kinase I isoform delta; CK 99.3
2rio_A 434 Serine/threonine-protein kinase/endoribonuclease I 99.28
3a99_A 320 Proto-oncogene serine/threonine-protein kinase PI; 99.28
3p23_A 432 Serine/threonine-protein kinase/endoribonuclease; 99.28
1j1b_A 420 Glycogen synthase kinase-3 beta; complex, TAU, AMP 99.27
4hgt_A 296 Casein kinase I isoform delta; CK1D, inhibitor, tr 99.27
2dyl_A 318 Dual specificity mitogen-activated protein kinase 99.26
1q8y_A 373 SR protein kinase; transferase; HET: ADP ADE; 2.05 99.26
3sv0_A 483 Casein kinase I-like; typical kinase domain fold, 99.25
2eu9_A 355 Dual specificity protein kinase CLK3; kinase domai 99.23
2vx3_A 382 Dual specificity tyrosine-phosphorylation- regula 99.22
3q60_A 371 ROP5B; pseudokinase, transferase; HET: ATP; 1.72A 99.2
3en9_A540 Glycoprotease, O-sialoglycoprotein endopeptidase/p 99.15
1zar_A282 RIO2 kinase; serine kinase, winged-helix, RIO doma 99.07
4azs_A 569 Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15 99.0
3dzo_A 413 Rhoptry kinase domain; parasitic disease, transfer 98.74
1zth_A258 RIO1 serine protein kinase; ribosome biogenesis, r 98.7
4gyi_A 397 RIO2 kinase; protein kinase, ADP complex, phosphoa 98.42
3tm0_A 263 Aminoglycoside 3'-phosphotransferase; protein kina 97.85
2vtf_A626 Endo-beta-N-acetylglucosaminidase; hydrolase, fami 97.42
2w91_A653 Endo-beta-N-acetylglucosaminidase D; hydrolase, N- 97.41
3d1u_A 288 Putative fructosamine-3-kinase; YP_290396.1, struc 97.15
1nd4_A 264 Aminoglycoside 3'-phosphotransferase; protein kina 97.06
3dxp_A 359 Putative acyl-COA dehydrogenase; protein kinase-li 96.77
3r70_A 320 Aminoglycoside phosphotransferase; structural geno 95.43
4gkh_A 272 Aminoglycoside 3'-phosphotransferase APHA1-IAB; py 94.45
3tdw_A 306 Gentamicin resistance protein; kinase, phosphoryl 94.45
3ats_A 357 Putative uncharacterized protein; hypothetical pro 93.37
3sg8_A 304 APH(2'')-ID; antibiotic resistance enzyme, transfe 93.37
3f7w_A 288 Putative fructosamine-3-kinase; YP_290396.1, struc 93.28
3jr1_A 312 Putative fructosamine-3-kinase; YP_719053.1, struc 93.27
2olc_A 397 MTR kinase, methylthioribose kinase; kinase ADP-2H 92.26
3ovc_A 362 Hygromycin-B 4-O-kinase; aminoglycoside phosphotra 91.28
3gdb_A 937 Endo-D, putative uncharacterized protein SPR0440; 90.82
2k1k_A38 Ephrin type-A receptor 1; EPHA1, receptor tyrosine 84.29
2wnw_A447 Activated by transcription factor SSRB; hydrolase, 80.98
>3aqu_A AT4G19810; stress response, TIM barrel, hydrolase, chitin; HET: FLC; 2.01A {Arabidopsis thaliana} Back     alignment and structure
Probab=100.00  E-value=3.6e-67  Score=531.30  Aligned_cols=337  Identities=38%  Similarity=0.705  Sum_probs=294.4

Q ss_pred             CcEEEEEecCCCCCcCCCCCCCCCcEEEEeeEEeeCCceEEeeCCCccHHHHHHHHHHHHhhCCCceEEEEecCCCCccc
Q 008036           25 PWIRVGYLNLSEVSTISGINYDLFTHLICSSADINSTTYQLSLSLPSDENQIAKFADTVKKKNPSITTILSIGQGKDTNY  104 (580)
Q Consensus        25 ~~~~vgY~~~~~~~~~~~i~~~~~thii~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~lk~~~~~~kvllsigg~~~~~~  104 (580)
                      ..+++|||-....+.+++||+++||||+|+|+.++++++++...+. ++..+.++++.+|++||++|+++|||||.. ++
T Consensus         3 ~~~~~gY~~~~~~~~~~~i~~~~~THi~yaF~~i~~~~~~v~~~~~-~~~~~~~~~~~lk~~~~~lkvllsiGGw~~-~~   80 (356)
T 3aqu_A            3 TVVKASYWFPASEFPVTDIDSSLFTHLFCAFADLNSQTNQVTVSSA-NQPKFSTFTQTVQRRNPSVKTLLSIGGGIA-DK   80 (356)
T ss_dssp             CCEEEEEECGGGCCCGGGSCGGGCSEEEEEEEEEETTTTEEECCTT-THHHHHHHHHHHTTTCTTCEEEEEEECTTS-CH
T ss_pred             ceEEEEEEeCCCCCCHHHCCcccCCEEEEEEEEecCCCCEEEeCCc-cHHHHHHHHHHHHhhCCCceEEEEECCCCC-Cc
Confidence            4689999922237899999999999999999999998778877653 356788888889999999999999999874 45


Q ss_pred             ccccccccChhHHHHHHHHHHHHHHHcCCCeeeeeecCCCCCCCCchhhhhHHHHHHHHhhhhhhccccccceEEEEeec
Q 008036          105 SIYSSMVRNSSHRKSFIDSSIRIARLYGFRGLDFAWTAPNTSTDMFNIGLLFDEWRIAATKLDAKNSTRQQSLLILTARF  184 (580)
Q Consensus       105 ~~f~~~~~~~~~r~~fi~~i~~~~~~~~~DGidiDwE~p~~~~~~~~~~~~~~~l~~~l~~~~~~~~~~~~~~~~~~~~~  184 (580)
                      ..|+.+++++++|++||+++++++++|||||||||||||+.++|+.+|+.|+++||.+|++..+..+   +..+.+++++
T Consensus        81 ~~f~~~~~~~~~r~~fi~siv~~~~~~~fDGiDiDwE~p~~~~d~~n~~~ll~eLr~~l~~~~~~~g---~~~~~Ls~av  157 (356)
T 3aqu_A           81 TAYASMASNPTSRKSFIDSSIRVARSYGFHGLDLDWEYPSSATEMTNFGTLLREWRSAVVAEASSSG---KPRLLLAAAV  157 (356)
T ss_dssp             HHHHHHHHSHHHHHHHHHHHHHHHHHHTCSEEEEECSCCCSHHHHHHHHHHHHHHHHHHHHHHHHHC---SCCCEEEEEE
T ss_pred             chHHHHhcCHHHHHHHHHHHHHHHHHhCCCeEEEEEeecCChhHHHHHHHHHHHHHHHHHHhhhhcC---CCceEEEEec
Confidence            7799999999999999999999999999999999999997778999999999999999986544332   2234555555


Q ss_pred             ccCC--CCCccchHHHhhhcceeeeeeccCcCC-CCCCCCCCCCCCCCCCCCCCccCHHHHHHHHHHcCCCCCceeEecc
Q 008036          185 RYSP--PANSYLLNSIQRNLNWIHAVTASYYEP-VSTNFTAPPAALYGSISGRFARSTDQVLKAWIERGLSADKLVMCLP  261 (580)
Q Consensus       185 ~~~~--~~~~~~~~~l~~~vD~i~vm~yd~~~~-~~~~~~~~~a~l~~~~~~~~~~~v~~~v~~~~~~gvp~~Kl~lGip  261 (580)
                      +..+  ....|+++++.+++||||||+||+||+ |. ..++|++|+++...  ...+++.+|++|++.|+|++||+||+|
T Consensus       158 ~~~~~~~~~~~d~~~l~~~vD~inlMtYD~~g~~w~-~~~g~~apl~~~~~--~~~~v~~~v~~~~~~gvp~~KlvlGip  234 (356)
T 3aqu_A          158 FYSNNYYSVLYPVSAVASSLDWVNLMAYDFYGPGWS-RVTGPPAALFDPSN--AGPSGDAGTRSWIQAGLPAKKAVLGFP  234 (356)
T ss_dssp             ESSSEETTEECCHHHHHHHCSEEEEECCCCCCTTTC-SBCCCTTCSCCTTC--SSCCHHHHHHHHHHTTCCGGGEEEEEE
T ss_pred             cCCchhhhccCCHHHHhhhccEEEEEeeecccCCCC-CCcCCCCcCCCCCC--CCccHHHHHHHHHHcCCCHHHEEEEec
Confidence            5332  235699999999999999999999998 76 57999999986543  256999999999999999999999999


Q ss_pred             ccceeeeecCCCCCCCCCCCCCCCCCCCccccHHHHHHHhhhcCCCeEEeecCceeEEEeecCCEEEecCCHHHHHHHHH
Q 008036          262 FYGYAWTLVKPEDNGIGAAAAGPALYDSGLVTYKKIKNHIKTYGPDVQVMYNSTYEVNYFSTGTVWFGFDDVEAVRAKIA  341 (580)
Q Consensus       262 ~yG~~~~~~~~~~~~~~~~~~g~~~~~~g~~~y~~i~~~~~~~~~~~~~~~d~~~~~~~~~~~~~wi~ydd~~Si~~K~~  341 (580)
                      +|||.|++.++.++++++|..|+++..+|.++|.|||+.+...+  ++..||+.+..||...+++||+|||++|+++|++
T Consensus       235 ~YGr~~~~~~~~~~~~~~p~~g~~~~~~g~~~y~ei~~~l~~~g--~~~~~D~~~~~~y~y~~~~~v~ydd~~Si~~K~~  312 (356)
T 3aqu_A          235 YYGYAWRLTNANSHSYYAPTTGAAISPDGSIGYGQIRKFIVDNG--ATTVYNSTVVGDYCYAGTNWIGYDDNQSIVTKVR  312 (356)
T ss_dssp             SEEEEEEESCTTCCSTTCBEEEECSSTTCEEEHHHHHHHHHHHT--CEEEEETTTTEEEEEETTEEEEECCHHHHHHHHH
T ss_pred             cceeeeEecCCcCCCCCCCCCCCCCCCCCeeeHHHHHHHHhcCC--CeEEEchhhceEEEEeCCEEEEeCCHHHHHHHHH
Confidence            99999999999999999999999888899999999999988776  8999999999999988899999999999999999


Q ss_pred             HhhhcCCceEEEEEeccCCchhhHHHhhhhc
Q 008036          342 YAKEKRLLGYYAWQVSFDDHDWLLSQAAAQK  372 (580)
Q Consensus       342 ~~~~~gLgGv~~W~l~~Dd~~~~~~~~~~~~  372 (580)
                      |++++||||+|+|+|++|| .|.+++++.+.
T Consensus       313 ~~~~~gLgGv~~W~l~~Dd-~~~ll~a~~~~  342 (356)
T 3aqu_A          313 YAKQRGLLGYFSWHVGADD-NSGLSRAASQA  342 (356)
T ss_dssp             HHHHTTCCEEEEECGGGSS-TTHHHHHHHHH
T ss_pred             HHHhCCCCeEEEEeccCCC-CchHHHHHHHH
Confidence            9999999999999999987 78888888753



>3alf_A Chitinase, class V; hydrolase; 1.20A {Nicotiana tabacum} PDB: 3alg_A* Back     alignment and structure
>4ay1_A Chitinase-3-like protein 2; chilectin, lectin, chitooligosaccharide, pseudochitinase, HY; HET: NAG; 1.95A {Homo sapiens} Back     alignment and structure
>3fy1_A Amcase, TSA1902, acidic mammalian chitinase; structure, crystallography, asthma,inhibitor, chitin degradation, methylallosamidin; HET: NA1 NAA AMI; 1.70A {Homo sapiens} PDB: 3fxy_A* 3rm4_A* 3rm8_A* 3rm9_A* 3rme_A* 2ybt_A* 2ybu_A* Back     alignment and structure
>1vf8_A YM1, secretory protein; chitinase, CHI-lectin, structural plasticity, functional versatility, immune system; 1.31A {Mus musculus} SCOP: c.1.8.5 d.26.3.1 PDB: 1e9l_A Back     alignment and structure
>1wb0_A Chitinase 1, chitotriosidase 1; cyclopentapeptide inhibitors, chitinase inhibitors, carbohyd metabolism, chitin degradation, chitin-binding; HET: VR0 MEA; 1.65A {Homo sapiens} SCOP: c.1.8.5 d.26.3.1 PDB: 1waw_A* 1guv_A 1lg2_A 1lg1_A 1lq0_A 1hki_A* 1hkj_A* 1hkm_A* 1hkk_A* Back     alignment and structure
>2pi6_A Chitinase-3-like protein 1; complex, signaling protein; HET: NAG MAN; 1.65A {Ovis aries} SCOP: c.1.8.5 d.26.3.1 PDB: 2dpe_A* 1sr0_A* 1zl1_A* 1zbk_A* 2dsu_A* 2dsv_A* 2dsw_A* 2fdm_A* 2g41_A* 2g8z_A* 2dt1_A* 1zbv_A* 1zu8_A* 2aos_A* 2b31_A* 1zbw_A* 2dt0_A* 2dsz_A* 2dt2_A* 2dt3_A* ... Back     alignment and structure
>1itx_A Chitinase A1, glycosyl hydrolase; alpha-beta (TIM) barrel; 1.10A {Bacillus circulans} SCOP: c.1.8.5 d.26.3.1 Back     alignment and structure
>3qok_A Putative chitinase II; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, glycosyl hydrolases family 18; 2.60A {Klebsiella pneumoniae subsp} Back     alignment and structure
>1kfw_A Chitinase B; TIM barrel, hydrolase; 1.74A {Arthrobacter SP} SCOP: c.1.8.5 d.26.3.1 Back     alignment and structure
>1jnd_A Imaginal DISC growth factor-2; IDGF, chitinase, insulin recep heparin, hormone-growth factor complex; HET: NAG BMA MAN; 1.30A {Drosophila melanogaster} SCOP: c.1.8.5 d.26.3.1 PDB: 1jne_A* Back     alignment and structure
>3g6m_A Chitinase, crchi1; inhibitor, caffeine, glycosidase, hydrolas hydrolase inhibitor complex; HET: CFF; 1.65A {Bionectria ochroleuca} PDB: 3g6l_A* Back     alignment and structure
>1edq_A Chitinase A; beta-alpha (TIM) barrel, hydrolase; 1.55A {Serratia marcescens} SCOP: b.1.18.2 c.1.8.5 d.26.3.1 PDB: 1ffq_A* 1ffr_A* 1ehn_A* 1ctn_A 1k9t_A* 1eib_A* 2wlz_A* 2wly_A* 2wm0_A* 2wk2_A* 1nh6_A* 1x6l_A 1rd6_A 1x6n_A* Back     alignment and structure
>1goi_A Chitinase B; chitin degradation, hydrolase, glycosidase; 1.45A {Serratia marcescens} SCOP: b.72.2.1 c.1.8.5 d.26.3.1 PDB: 1o6i_A* 1e6r_A* 1e15_A 1gpf_A* 1ur8_A* 1w1p_A* 1w1t_A* 1w1v_A* 1w1y_A* 1e6p_A 1e6n_A 1h0g_A* 1h0i_A* 1ogb_A 1ogg_A* 1e6z_A* 1ur9_A* Back     alignment and structure
>3arx_A Chitinase A; TIM barrel, inhibitor complex, glycosidase, hydrolase, hydro hydrolase inhibitor complex; HET: POY; 1.16A {Vibrio harveyi} PDB: 3aro_A* 3arp_A* 3arr_A* 3arv_A* 3arw_A* 3arq_A* 3ary_A* 3arz_A* 3b8s_A 3b9e_A 3b9a_A* 3b9d_A 3as2_A* 3ars_A* 3art_A* 3as0_A* 3as1_A* 3aru_A* 3as3_A* Back     alignment and structure
>1ll7_A Chitinase 1; beta-alpha barrel, hydrolase; 2.00A {Coccidioides immitis} SCOP: c.1.8.5 d.26.3.1 PDB: 1d2k_A 1ll4_A* 1ll6_A Back     alignment and structure
>1w9p_A Chitinase; peptide inhibitors, argifin, argadin, glycosidase, hydrolase; 1.7A {Aspergillus fumigatus} SCOP: c.1.8.5 d.26.3.1 PDB: 1w9u_A* 1w9v_A* 2a3a_A* 2a3b_A* 2a3c_A* 2a3e_A* 2iuz_A* 3ch9_A 3chc_A* 3chd_A* 3che_A* 3chf_A* 1wno_A* Back     alignment and structure
>3oa5_A CHI1; TIM barrel, hydrolase; HET: 2PE; 1.74A {Yersinia} PDB: 4a5q_A Back     alignment and structure
>3cz8_A Putative sporulation-specific glycosylase YDHD; structural genomics, uncharacterized protein, protein struct initiative, PSI-2; 2.20A {Bacillus subtilis subsp} Back     alignment and structure
>3fnd_A Chitinase; TIM-barrel, structural genomics, PSI-2, P structure initiative, NEW YORK SGX research center for STRU genomics, nysgxrc; 1.90A {Bacteroides thetaiotaomicron} PDB: 3co4_A Back     alignment and structure
>3bxw_B Chitinase domain-containing protein 1; TIM barrel, lysosome, secreted, hydrolase; 2.70A {Homo sapiens} Back     alignment and structure
>1nar_A Narbonin; plant SEED protein; 1.80A {Vicia narbonensis} SCOP: c.1.8.5 Back     alignment and structure
>3sim_A Protein, family 18 chitinase; family 18 plant chitinase, TIM barrel, chitin binding, glyco hydrolase, hydrolase; 2.10A {Crocus vernus} Back     alignment and structure
>3n12_A Chitinase A, chinctu2; zinc atoms, complex, hydrolase; 1.20A {Bacillus cereus} PDB: 3n11_A 3n15_A* 3n13_A* 3n17_A* 3n18_A* 3n1a_A* Back     alignment and structure
>4axn_A Chitinase C1; hydrolase; 1.68A {Serratia marcescens} Back     alignment and structure
>2y8v_A CHIC, class III chitinase, putative; afchic, hydrolase; 1.99A {Aspergillus fumigatus} Back     alignment and structure
>3ebv_A Chinitase A; chitinase A, CHIA, glycosidase, structural genomics, unknown function, hydrolase, PSI-2, protein structure initiative; 1.50A {Streptomyces coelicolor} Back     alignment and structure
>3ian_A Chitinase; structural genomics, hydrolase, glycosidase, PSI-2, protein structure initiative; 1.75A {Lactococcus lactis subsp} Back     alignment and structure
>4ac1_X Endo-N-acetyl-beta-D-glucosaminidase; hydrolase, glycoside hydrolase family 18, deglycosylation; HET: NAG; 1.30A {Hypocrea jecorina} Back     alignment and structure
>2hvm_A Hevamine; hydrolase, chitinase/lysozyme; 1.80A {Hevea brasiliensis} SCOP: c.1.8.5 PDB: 1hvq_A* 1llo_A 1kr0_A* 1kr1_A* 1kqy_A* 1kqz_A* Back     alignment and structure
>2uy2_A Endochitinase; carbohydrate metabolism, polysaccharide degradation, glycopr chitin-binding, chitin degradation, CAZY, hydrolase; 1.60A {Saccharomyces cerevisiae} PDB: 2uy3_A* 2uy4_A* 2uy5_A* Back     alignment and structure
>2gsj_A Protein PPL-2; mimosoideae, chimerolectin, endochitinase, glycosyl hydrolase family 18, equilibrium sedimentation, X-RAY; 1.73A {Parkia platycephala} Back     alignment and structure
>1edt_A Endo-beta-N-acetylglucosaminidase H, endo H; hydrolase (glucosidase); 1.90A {Streptomyces plicatus} SCOP: c.1.8.5 PDB: 1c90_A 1c8x_A 1c91_A 1c3f_A 1c92_A 1c8y_A 1c93_A Back     alignment and structure
>1eok_A Endo-beta-N-acetylglucosaminidase F3; alpha/beta-barrel, hydrolase; 1.80A {Elizabethkingia meningoseptica} SCOP: c.1.8.5 PDB: 1eom_A* Back     alignment and structure
>1cnv_A Concanavalin B; plant chitinase, chitin binding protein, SEED protein; 1.65A {Canavalia ensiformis} SCOP: c.1.8.5 Back     alignment and structure
>2xtk_A CHIA1, class III chitinase CHIA1; hydrolase, GH18; HET: AZM; 2.00A {Aspergillus fumigatus} PDB: 2xuc_A 2xvp_A 2xvn_A* Back     alignment and structure
>2ebn_A Endo-beta-N-acetylglucosaminidase F1; hydrolase(glucosidase); 2.00A {Elizabethkingia meningoseptica} SCOP: c.1.8.5 Back     alignment and structure
>1ta3_A XIP-1, xylanase inhibitor protein I; beta alpha barrel (XIP-I), beta alpha barrel (xylanase), HYD inhibitor-hydrolase complex; HET: NAG; 1.70A {Triticum aestivum} SCOP: c.1.8.5 PDB: 1om0_A* 1te1_A* Back     alignment and structure
>4asz_A BDNF/NT-3 growth factors receptor; transferase, TRKA, TRKB; 1.70A {Homo sapiens} PDB: 4at3_A* 4at4_A* 4at5_A* 3v5q_A* Back     alignment and structure
>4aoj_A High affinity nerve growth factor receptor; transferase, inhibitor; HET: V4Z; 2.75A {Homo sapiens} Back     alignment and structure
>4gt4_A Tyrosine-protein kinase transmembrane receptor RO; ATP binding, phosphorylation, transferase; 2.41A {Homo sapiens} PDB: 3zzw_A Back     alignment and structure
>3mu7_A XAIP-II, xylanase and alpha-amylase inhibitor protein; TIM barell, amylase/xylanase inhibitory protein, hydrolase I; 1.29A {Scadoxus multiflorus} SCOP: c.1.8.0 PDB: 3o9n_A 3oih_A* 3hu7_A 3m7s_A* 3d5h_A* Back     alignment and structure
>3poh_A Endo-beta-N-acetylglucosaminidase F1; TIM barrel, structural genomics, joint center for structural genomics, JCSG; 1.55A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2dsk_A Chitinase; catalytic domain, active domain, crystalline CHIT barrel, hydrolase; 1.50A {Pyrococcus furiosus} PDB: 3a4w_A* 3a4x_A* 3afb_A Back     alignment and structure
>4b9d_A Serine/threonine-protein kinase NEK1; transferase, inhibitor; HET: CK7; 1.90A {Homo sapiens} PDB: 4apc_A* Back     alignment and structure
>3omv_A RAF proto-oncogene serine/threonine-protein kinas; serine/threonine-protein kinase, transferase; HET: SM5; 4.00A {Homo sapiens} Back     alignment and structure
>4fih_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP; 1.97A {Homo sapiens} PDB: 4fig_A* 4fif_A* 4fii_A* 4fij_A* Back     alignment and structure
>4aw0_A HPDK1, 3-phosphoinositide-dependent protein kinase 1; transferase, allosteric regulation, allosteric site, phosphorylation, AGC protein kinase; HET: SEP ATP MJF; 1.43A {Homo sapiens} PDB: 3hrc_A* 3hrf_A* 4a06_A* 4a07_A* 3rcj_A* 4aw1_A* 3rwq_A* 3sc1_A* 3qd0_A* 2r7b_A* 3ion_A* 3qcq_A* 3qcs_A* 3qcx_A* 3qcy_A* 3iop_A* 3qd3_A* 3qd4_A* 3h9o_A* 1uu3_A* ... Back     alignment and structure
>4fie_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP ANP; 3.11A {Homo sapiens} Back     alignment and structure
>3fpq_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase, ATP-BIND kinase, nucleotide-binding, phosphoprotein; 1.80A {Rattus norvegicus} Back     alignment and structure
>4ase_A Vascular endothelial growth factor receptor 2; transferase, angiogenesis, signaling protein, phosphorylatio receptor, inhibitor; HET: AV9; 1.83A {Homo sapiens} PDB: 4agd_A* 4asd_A* 4agc_A* Back     alignment and structure
>4g31_A Eukaryotic translation initiation factor 2-alpha; deletion mutant, catalytic domain, synthetic inhibitor, TRAN transferase inhibitor complex; HET: 0WH; 2.28A {Homo sapiens} PDB: 4g34_A* Back     alignment and structure
>3hyh_A Carbon catabolite-derepressing protein kinase; kinase domain, transferase, ATP-binding, carbohydrate metabo kinase, membrane; 2.20A {Saccharomyces cerevisiae} PDB: 3dae_A 2fh9_A 3mn3_A Back     alignment and structure
>4g3f_A NF-kappa-beta-inducing kinase; non-RD kinase, protein serine/threonine kinase, S based drug design, MAP3K14, transferase; HET: 0WB; 1.64A {Mus musculus} PDB: 4g3g_A* 4g3c_A 4dn5_A* Back     alignment and structure
>3hmm_A TGF-beta receptor type-1; ALK5, kinase, inhibitor, quinazoline, aortic aneurysm, ATP-binding, craniosynostosis, disease mutation, disulfide bond; HET: 855; 1.70A {Homo sapiens} PDB: 1vjy_A* 3gxl_A* 3tzm_A* 2wot_A* 2wou_A* 1py5_A* 1rw8_A* Back     alignment and structure
>3ubd_A Ribosomal protein S6 kinase alpha-3; kinase-inhibitor complex, induced FIT, transferase-transfera inhibitor complex; HET: SL0; 1.53A {Mus musculus} PDB: 4el9_A* 3g51_A* 2z7q_A* 2z7r_A* 2z7s_A* Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Back     alignment and structure
>4b99_A Mitogen-activated protein kinase 7; transferase, inhibitor; HET: R4L; 2.80A {Homo sapiens} Back     alignment and structure
>3v5w_A G-protein coupled receptor kinase 2; inhibitor complex, protein kinase, beta propeller, RGS homol domain; HET: 8PR; 2.07A {Homo sapiens} PDB: 3cik_A* 3krw_A* 3krx_A* 1omw_A 1ym7_A 2bcj_A* 3uzs_A 3uzt_A 3pvu_A* 3psc_A* 3pvw_A* 1bak_A Back     alignment and structure
>2qkw_B Protein kinase; three-helix bundle motif, AVRPTO-PTO duplex, layered beta- sheets, transferas; HET: SEP TPO; 3.20A {Solanum pimpinellifolium} PDB: 3hgk_A* Back     alignment and structure
>3s95_A LIMK-1, LIM domain kinase 1; structural genomics, structural genomics consortium, SGC, PR kinase, transferase-antibiotic complex; HET: STU GOL; 1.65A {Homo sapiens} Back     alignment and structure
>4f9c_A Cell division cycle 7-related protein kinase; Ser/Thr protein kinase, transferase, phosphorylation, cell C cell division, mitosis, S phase; HET: 0SX; 2.08A {Homo sapiens} PDB: 4f99_A* 4f9b_A* 4f9a_A* Back     alignment and structure
>3uim_A Brassinosteroid insensitive 1-associated receptor; kinase, protein kinase, transferase; HET: SEP TPO ANP; 2.20A {Arabidopsis thaliana} PDB: 3ulz_A* 3tl8_A* Back     alignment and structure
>3fxz_A Serine/threonine-protein kinase PAK 1; transferase, ATP-binding, phosphorylation, allosteric enzyme, alternative splicing, apoptosis, cell junction; HET: TPO FLL; 1.64A {Homo sapiens} SCOP: d.144.1.7 PDB: 3fy0_A* 4daw_A* 3q52_A* 3q53_A* 1yhw_A 1f3m_C 1yhv_A 2hy8_1* 3q4z_A* Back     alignment and structure
>2c30_A Serine/threonine-protein kinase PAK 6; CRIB domain, ATP-binding, transferase, nucleotide-binding; HET: SEP; 1.6A {Homo sapiens} PDB: 2f57_A* 2j0i_A* 2cdz_A* 2q0n_A* 2x4z_A* 2bva_A* Back     alignment and structure
>3fe3_A MAP/microtubule affinity-regulating kinase 3; serine/threonine protein kinase, MARK;PAR-1, UBA domai TAK1;P78;MARK3, ATP-binding; 1.90A {Homo sapiens} PDB: 2qnj_A 1y8g_A* 1zmw_A 1zmu_A 1zmv_A 2wzj_A 2r0i_A 2hak_A 3iec_A Back     alignment and structure
>2nru_A Interleukin-1 receptor-associated kinase 4; inhibitor, IRAK, transferase; HET: TPO SEP T12; 2.00A {Homo sapiens} PDB: 2nry_A* 2oib_A* 2oic_A* 2oid_A* 2o8y_A* Back     alignment and structure
>2yab_A Death-associated protein kinase 2; apoptosis, transferase; HET: AMP; 1.90A {Mus musculus} PDB: 2yaa_A* 2ya9_A* Back     alignment and structure
>2qol_A Ephrin receptor; receptor tyrosine kinase, juxtamembrane segment, structural genomics, mutant, structural genomics consortium, SGC, ATP- binding; 1.07A {Homo sapiens} PDB: 2qok_A 2qoi_A 2qoo_A 2qof_A 2qod_A 2qo9_A* 2gsf_A 2qo7_A* 2qo2_A* 2qoq_A* 2qon_A* 3fxx_A* 3fy2_A 2qoc_A* 2qob_A* 3dzq_A* 2r2p_A 2hel_A 2rei_A 3dko_A* ... Back     alignment and structure
>4hcu_A Tyrosine-protein kinase ITK/TSK; transferase-transferase inhibitor complex; HET: 13L; 1.43A {Homo sapiens} PDB: 4hct_A* 4hcv_A* 3t9t_A* 1sm2_A* 1snu_A* 1snx_A 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Back     alignment and structure
>3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* Back     alignment and structure
>4aw2_A Serine/threonine-protein kinase MRCK alpha; transferase, CDC42BPA; HET: 22E; 1.70A {Rattus norvegicus} PDB: 3tku_A* 3qfv_A* Back     alignment and structure
>3qd2_B Eukaryotic translation initiation factor 2-alpha; EIF2A kinase, phosphoryalation, gene regulation; HET: TPO; 2.81A {Mus musculus} Back     alignment and structure
>3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* Back     alignment and structure
>1o6l_A RAC-beta serine/threonine protein kinase; protein kinase, transferase, serine/threonine-protein kinase; HET: TPO ANP; 1.6A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jdo_A* 2jdr_A* 2uw9_A* 2x37_A* 2x39_A* 2xh5_A* 3d0e_A* 3e87_A* 3e88_A* 3e8d_A* 1o6k_A* 1mrv_A 1mry_A 1gzn_A 1gzk_A 1gzo_A 3qkl_A* 3ocb_A* 3ow4_A* 3qkk_A* ... Back     alignment and structure
>2y0a_A Death-associated protein kinase 1; transferase, calmodulin, esprit; HET: MES; 2.60A {Homo sapiens} Back     alignment and structure
>4euu_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: SEP BX7; 1.80A {Homo sapiens} Back     alignment and structure
>3kmu_A ILK, integrin-linked kinase; cell adhesion, ANK repeat, ATP-binding, cell junction, cell membrane, integrin-binding protein, membrane, nucleotide- binding; 1.80A {Homo sapiens} SCOP: d.144.1.0 PDB: 3kmw_A* 3rep_A* Back     alignment and structure
>3uqc_A Probable conserved transmembrane protein; structural genomics, TB structural genomics consortium, TBSG fold, FHAA, transferase; 2.26A {Mycobacterium tuberculosis} PDB: 3oun_B* 3otv_A 3ouk_A Back     alignment and structure
>3kul_A Ephrin type-A receptor 8; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase; HET: PTR; 2.15A {Homo sapiens} Back     alignment and structure
>1kob_A Twitchin; kinase, intrasteric regulation; 2.30A {Aplysia californica} SCOP: d.144.1.7 Back     alignment and structure
>1tki_A Titin; serine kinase, muscle, autoinhibition; 2.00A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Back     alignment and structure
>2psq_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xr0_A Back     alignment and structure
>3f3z_A Calcium/calmodulin-dependent protein kinase with domain and 4 calmodulin like EF...; calcium dependent protein kinase; HET: SEP DRK; 1.84A {Cryptosporidium parvum iowa II} PDB: 2qg5_A* Back     alignment and structure
>1fot_A TPK1 delta, CAMP-dependent protein kinase type 1; open conformation, transferase; HET: TPO; 2.80A {Saccharomyces cerevisiae} SCOP: d.144.1.7 Back     alignment and structure
>3tki_A Serine/threonine-protein kinase CHK1; cell checkpoint, transferase-transferase inhib complex; HET: S25; 1.60A {Homo sapiens} PDB: 2qhm_A* 2r0u_A* 3tkh_A* 2qhn_A* 2hy0_A* 2hog_A* 2hxq_A* 2hxl_A* 3f9n_A* Back     alignment and structure
>1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Back     alignment and structure
>2bdw_A Hypothetical protein K11E8.1D; kinase, calmodulin activated, transferase; 1.80A {Caenorhabditis elegans} PDB: 2wel_A* 2v7o_A* 2vz6_A* 1cdm_B 1cm1_B 1cm4_B Back     alignment and structure
>3ugc_A Tyrosine-protein kinase JAK2; small molecule inhibitor, ATP binding, transferase-transfera inhibitor complex; HET: 046; 1.34A {} PDB: 3krr_A* 3lpb_A* 4aqc_A* 4e4m_A* 4f08_A* 4f09_A* 3q32_A* 3rvg_A* 4hge_A* 3tjc_A* 3tjd_A* 4bbe_A* 4bbf_A* 2b7a_A* 3fup_A* 3e64_A* 3e62_A* 3e63_A* 2xa4_A* 3iok_A* ... Back     alignment and structure
>4fvq_A Tyrosine-protein kinase JAK2; janus protein kinase, pseudokinase, ATP binding, phosphoryla transferase; HET: ATP; 1.75A {Homo sapiens} PDB: 4fvp_A* 4fvr_A* Back     alignment and structure
>1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Back     alignment and structure
>3gen_A Tyrosine-protein kinase BTK; bruton'S tyrosine kinase, 4-amino-5-(4-phenoxyphenyl)-5H- pyrrolo[3, 2-D]pyrimidin-7-YL-cyclopentane, TEC-family; HET: B43; 1.60A {Homo sapiens} PDB: 3k54_A* 3pj2_A* 3piy_A* 3piz_A* 3pj1_A* 3pix_A* 3pj3_A* 3p08_A 3ocs_A* 3oct_A* 1k2p_A Back     alignment and structure
>4eqm_A Protein kinase; transferase; HET: ANP; 3.00A {Staphylococcus aureus subsp} Back     alignment and structure
>3uc3_A Serine/threonine-protein kinase SRK2I; SNRK2, ABA signaling, transferase; 1.90A {Arabidopsis thaliana} PDB: 3zut_A 3zuu_A 3uc4_A 3ujg_A 3udb_A Back     alignment and structure
>3sxs_A Cytoplasmic tyrosine-protein kinase BMX; transferase-transferase inhibitor complex; HET: PP2; 1.89A {Homo sapiens} SCOP: d.144.1.7 PDB: 3sxr_A* Back     alignment and structure
>2ac3_A MAP kinase-interacting serine/threonine kinase 2; DFD motif, transferase; 2.10A {Homo sapiens} PDB: 2hw7_A* 2ac5_A* 2hw6_A Back     alignment and structure
>3v8s_A RHO-associated protein kinase 1; dimerization, myosin, transferase, inhibitor, transf transferase inhibitor complex; HET: 0HD; 2.29A {Homo sapiens} PDB: 3twj_A* 3tv7_A* 2etr_A* 2esm_A* 2eto_A* 2etk_A* 3d9v_A* 3ncz_A* 3ndm_A* 2v55_A* 2f2u_A* 2h9v_A* Back     alignment and structure
>2ivs_A Proto-oncogene tyrosine-protein kinase receptor RET; nucleotide-binding, hirschsprung disease, phosphorylation, disease mutation; HET: ACK; 2.00A {Homo sapiens} PDB: 2ivt_A* 2ivu_A* 2x2k_A* 2x2l_A* 2x2m_A* 2ivv_A* Back     alignment and structure
>2x4f_A Myosin light chain kinase family member 4; LUNG, breast cancer, transferase, serine/threonine-protein kinase, nucleotide-binding; HET: 16X 1PE; 2.67A {Homo sapiens} Back     alignment and structure
>3c0i_A Peripheral plasma membrane protein CASK; neurexin, Ca2+/calmodulin dependent protein kinase, Mg synaptic plasticity, pseudokinase, maguk; HET: 3AM; 1.85A {Homo sapiens} PDB: 3c0h_A* 3c0g_A* 3mfr_A* 3mfs_A* 3mft_A 3mfu_A* 3tac_A Back     alignment and structure
>1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Back     alignment and structure
>1luf_A Muscle-specific tyrosine kinase receptor MUSK; phosphorylation, signal transduction, MASS spectrometry, transferase; 2.05A {Rattus norvegicus} SCOP: d.144.1.7 Back     alignment and structure
>3txo_A PKC-L, NPKC-ETA, protein kinase C ETA type; phosphotransferase, transferase-transferase inhibito; HET: TPO 07U; 2.05A {Homo sapiens} Back     alignment and structure
>3l9p_A Anaplastic lymphoma kinase; kinase domain, ATP-binding, glycoprotein, membrane, nucleotide-binding, phosphoprotein, proto-oncogene; 1.80A {Homo sapiens} Back     alignment and structure
>3a62_A Ribosomal protein S6 kinase beta-1; kinase domain, inactive, active, ribosomal S6 kinase, activation, alternative initiation, ATP-binding; HET: TPO STU; 2.35A {Homo sapiens} PDB: 3a61_A* 3a60_A* Back     alignment and structure
>2vd5_A DMPK protein; serine/threonine-protein kinase, kinase, transferase, ATP-BI nucleotide-binding, cardiac contractility, muscle different; HET: BI8; 2.80A {Homo sapiens} Back     alignment and structure
>4fr4_A YANK1, serine/threonine-protein kinase 32A; structural genomics, structural genomics consortium, SGC, TR; HET: STU; 2.29A {Homo sapiens} Back     alignment and structure
>3vhe_A Vascular endothelial growth factor receptor 2; kinase domain, kinase, transferase-transferase inhibitor COM; HET: 42Q; 1.55A {Homo sapiens} PDB: 1y6a_A* 1y6b_A* 3vhk_A* 3vid_A* 3hng_A* Back     alignment and structure
>3t9t_A Tyrosine-protein kinase ITK/TSK; kinase domain, alpha/beta, ATP binding, phosphorylation, intracellular, transferase-transferase inhibitor complex; HET: IAQ; 1.65A {Homo sapiens} PDB: 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 1sm2_A* 1snu_A* 1snx_A 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Back     alignment and structure
>1xjd_A Protein kinase C, theta type; PKC-theta, ATP, AMP,, transferase; HET: TPO SEP STU; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jed_A* Back     alignment and structure
>1rdq_E PKA C-alpha, CAMP-dependent protein kinase, alpha-catalytic SU; CAMP-dependent protein kinase,catalytic mechanism, ATP hydro two nucleotide states; HET: TPO SEP ADP ATP; 1.26A {Mus musculus} SCOP: d.144.1.7 PDB: 2erz_E* 3fjq_E* 1bkx_A* 1atp_E* 1fmo_E* 1j3h_A* 1jlu_E* 1bx6_A* 1re8_A* 1rej_A* 1rek_A* 2cpk_E* 2qcs_A* 2qvs_E* 1l3r_E* 3idb_A* 3idc_A* 3o7l_D* 3ow3_A* 3tnp_C* ... Back     alignment and structure
>3gni_B Strad alpha; kinase fold, pseudokinase, alpha helical repeat protein, ADA protein, ATP-binding, cell cycle, kinase, nucleotide-bindin nucleus; HET: ATP CIT; 2.35A {Homo sapiens} PDB: 2wtk_B* Back     alignment and structure
>3a8x_A Protein kinase C IOTA type; transferase; HET: TPO; 2.00A {Homo sapiens} PDB: 3a8w_A* 1zrz_A* Back     alignment and structure
>2w4o_A Calcium/calmodulin-dependent protein kinase type IV; calmodulin-binding, nucleotide-binding, serine/threonine-protein kinase, ATP-binding; HET: DKI; 2.17A {Homo sapiens} Back     alignment and structure
>4eut_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: BX7; 2.60A {Homo sapiens} Back     alignment and structure
>3soc_A Activin receptor type-2A; structural genomics consortium, SGC, transferase, protein KI; HET: GVD; 1.95A {Homo sapiens} PDB: 3q4t_A* 4asx_A* 2qlu_A* Back     alignment and structure
>2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Back     alignment and structure
>2jam_A Calcium/calmodulin-dependent protein kinase type 1G; transferase, kinase, membrane, ATP-binding, prenylation, serine/threonine-protein kinase, alternative splicing; HET: J60; 1.7A {Homo sapiens} PDB: 2jc6_A* 1a06_A Back     alignment and structure
>2a2a_A Death-associated protein kinase 2; autoinhibition, transferase; 1.47A {Homo sapiens} PDB: 2cke_A* 1wmk_A 1z9x_A 2a27_A 2x0g_A 2xuu_A* 2w4k_A* 2xzs_A Back     alignment and structure
>2clq_A Mitogen-activated protein kinase kinase kinase 5; transferase, metal-binding, apoptosis; HET: STU; 2.3A {Homo sapiens} Back     alignment and structure
>3is5_A Calcium-dependent protein kinase; CDPK, structural genomics, parasitology, structural genomics consortium, SGC, ATP-binding, nucleotide-binding; HET: ANP; 2.55A {Toxoplasma gondii} Back     alignment and structure
>2pmi_A Negative RE, cyclin-dependent protein kinase PHO85; cyclin-dependent kinase, signaling protein,transfera cycle complex; HET: MES AGS; 2.90A {Saccharomyces cerevisiae} PDB: 2pk9_A* Back     alignment and structure
>3bhy_A Death-associated protein kinase 3; death associated kinase, DAPK3, ZIP kinase, ZIPK, DAP kinase like kinase, DLK, structural genomics consortium; HET: 7CP; 1.24A {Homo sapiens} PDB: 3bqr_A* 2j90_A* 1yrp_A* 2yak_A* 2y4p_A* 3f5u_A* 1jks_A 1jkk_A* 1ig1_A* 1jkl_A 1jkt_A 3eh9_A* 3eha_A* 3f5g_A* 1p4f_A* 1wvw_A 1wvx_A* 1wvy_A* 2w4j_A* 3dgk_A ... Back     alignment and structure
>4dc2_A Protein kinase C IOTA type; kinase, substrate, cell polarity, atypical PKC, trans transferase substrate complex; HET: TPO ADE; 2.40A {Mus musculus} Back     alignment and structure
>2y94_A 5'-AMP-activated protein kinase catalytic subunit; transferase, nucleotide-binding, staurosporine-binding, serine/threonine-protein kinase; HET: TPO STU AMP; 3.24A {Rattus norvegicus} Back     alignment and structure
>2j7t_A Serine/threonine-protein kinase 10; transferase, ATP-binding, cell cycle progression, phosphorylation, disease mutation, nucleotide- binding; HET: 274; 2.0A {Homo sapiens} PDB: 4aot_A* 3zz2_A* 2j51_A* 2jfl_A* 2jfm_A* 2uv2_A* Back     alignment and structure
>3soa_A Calcium/calmodulin-dependent protein kinase type alpha with A beta 7 linker; phosphorylation, cytosolic, transferase-transferase inhibitor complex; HET: DB8; 3.55A {Homo sapiens} Back     alignment and structure
>1x8b_A WEE1HU, WEE1-like protein kinase; cell cycle, transferase; HET: 824; 1.81A {Homo sapiens} PDB: 3bi6_A* 3biz_A* 3cqe_A* 3cr0_A* 2in6_A* 2io6_A* 2z2w_A* Back     alignment and structure
>3niz_A Rhodanese family protein; structural genomics, structural genomics consortium, SGC, phosphotransferase, cyclin dependent kinase; HET: ADP; 2.40A {Cryptosporidium parvum} SCOP: d.144.1.7 PDB: 2qkr_A* Back     alignment and structure
>3kfa_A Tyrosine-protein kinase ABL1; CML, drug resistance, inhibitor, ATP-binding, nucleotide-binding, oncogene, TRAN; HET: B91; 1.22A {Mus musculus} SCOP: d.144.1.7 PDB: 2qoh_A* 3kf4_A* 3k5v_A* 1fpu_A* 1m52_A* 1iep_A* 2hzn_A* 1opj_A* 3ms9_A* 3mss_A* 3ik3_A* 2z60_A* 2e2b_A* 3pyy_A* 3oxz_A* 2g1t_A* 3ue4_A* 3oy3_A* 2hiw_A* 2v7a_A* ... Back     alignment and structure
>3ork_A Serine/threonine protein kinase; structural genomics, TB structural genomics consortium, TBSG domain, signal transduction; HET: AGS; 1.60A {Mycobacterium tuberculosis} PDB: 3ori_A* 3orl_A* 3oro_A* 3orp_A* 3ort_A* 3f61_A* 1mru_A* 3f69_A* 3orm_A* 1o6y_A* 2fum_A* Back     alignment and structure
>3hko_A Calcium/calmodulin-dependent protein kinase with domain and 2 calmodulin-like EF...; structural genomics, protist parasite; HET: ANP; 1.80A {Cryptosporidium parvum iowa II} Back     alignment and structure
>1ob3_A PFPK5, cell division control protein 2 homolog; transferase, serine/threonine-protein kinase, ATP-binding, phosphorylation, CDK; 1.9A {Plasmodium falciparum} SCOP: d.144.1.7 PDB: 1v0p_A* 1v0o_A* 1v0b_A Back     alignment and structure
>3tt0_A Basic fibroblast growth factor receptor 1; kinase domain, transferase, transferase-transferase inhibito; HET: 07J; 2.80A {Homo sapiens} Back     alignment and structure
>2pvf_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; HET: PTR ACP; 1.80A {Homo sapiens} PDB: 3cly_A* 2pzr_A* 2pzp_A* 2pvy_A* 2pz5_A* 2q0b_A* 2pwl_A* 2py3_A* 3ri1_A* 1gjo_A 1oec_A* 3b2t_A* 3gql_A* 3gqi_A* 1fgk_A 1fgi_A* 1agw_A 2fgi_A* 3js2_A* 3ky2_A ... Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Back     alignment and structure
>3cok_A Serine/threonine-protein kinase PLK4; POLO-like kinase 4, SAK, STK18, PSI, structural genomics, protein structure initiative; HET: ANP; 2.25A {Homo sapiens} Back     alignment and structure
>3dtc_A Mitogen-activated protein kinase kinase kinase 9; mixed-lineage kinase, MLK family, MLK1 and MLK3 subtype selective inhibitors; HET: VIN; 2.60A {Homo sapiens} SCOP: d.144.1.0 Back     alignment and structure
>2buj_A Serine/threonine-protein kinase 16; transferase, ATP-binding, lipoprotein, myristate, PA phosphorylation; HET: STU; 2.6A {Homo sapiens} Back     alignment and structure
>2yex_A Serine/threonine-protein kinase CHK1; transferase, cell cycle; HET: YEX; 1.30A {Homo sapiens} PDB: 2x8e_A* 2ydk_A* 2ydj_A* 2yer_A* 2ydi_A* 1nvq_A* 1nvr_A* 1nvs_A* 2wmq_A* 2wmr_A* 2wms_A* 2wmt_A* 2wmu_A* 2wmv_A* 2wmw_A* 2wmx_A* 2x8d_A* 2x8i_A* 2xey_A* 2xez_A* ... Back     alignment and structure
>1qpc_A LCK kinase; alpha beta fold, transferase; HET: PTR ANP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1qpe_A* 1qpj_A* 2pl0_A* 3kxz_A* 3ac1_A* 2zm4_A* 2zyb_A* 2zm1_A* 3ac2_A* 3ac3_A* 3ac4_A* 3ac5_A* 3ac8_A* 3acj_A* 3ack_A* 3ad4_A* 3ad5_A* 3ad6_A* 3kmm_A* 1qpd_A* ... Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Back     alignment and structure
>2eva_A TAK1 kinase - TAB1 chimera fusion protein; transferase/transferase activator complex; HET: ADN; 2.00A {Homo sapiens} Back     alignment and structure
>4e5w_A Tyrosine-protein kinase JAK1; kinase domain, transferase-transferase inhibit complex; HET: PTR 0NT; 1.86A {Homo sapiens} PDB: 4e4l_A* 4e4n_A* 4ehz_A* 4ei4_A* 4fk6_A* 3eyg_A* 3eyh_A* Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Back     alignment and structure
>2w1i_A JAK2; chromosomal rearrangement, nucleotide-binding, tyrosine-protein kinase, proto-oncogene, phosphoprotein, disease mutation, SH2 domain; HET: PTR L0I; 2.60A {Homo sapiens} Back     alignment and structure
>3lxl_A Tyrosine-protein kinase JAK3; TYK2, inflammation, cancer, PAN inhibitor, ATP-binding mutation, membrane, nucleotide-binding, phosphoprot SCID; HET: IZA; 1.74A {Homo sapiens} PDB: 3lxk_A* 4hvd_A* 4hvg_A* 4hvh_A* 4hvi_A* 3pjc_A* 1yvj_A* Back     alignment and structure
>3h4j_B AMPK kdaid, SNF1-like protein kinase SSP2; ATP-binding, nucleotide-binding, phosphoprotei serine/threonine-protein kinase, transferase; 2.80A {Schizosaccharomyces pombe} Back     alignment and structure
>1rjb_A FL cytokine receptor; kinase, structure, autoinhibition, juxtamembrane domain, transferase; 2.10A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* Back     alignment and structure
>3kk8_A Calcium/calmodulin dependent protein kinase II; ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; HET: TPO; 1.72A {Caenorhabditis elegans} PDB: 3kk9_A* 3kl8_A 2vn9_A* 3bhh_A* Back     alignment and structure
>1p4o_A Insulin-like growth factor I receptor protein; IGF-1R, kinase domain, hormone-growth factor complex; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 1m7n_A 3lvp_A* 3lw0_A* 1jqh_A* 2zm3_A* 3f5p_A* 3i81_A* 2oj9_A* 3nw5_A* 3nw6_A* 3nw7_A* 3o23_A* 3qqu_A* 3d94_A* 1k3a_A* 2z8c_A* 1ir3_A* 1gag_A* 1irk_A 3bu3_A* ... Back     alignment and structure
>2i0e_A Protein kinase C-beta II; serine/threonine protein kinase, transferase; HET: TPO SEP PDS; 2.60A {Homo sapiens} PDB: 3iw4_A* Back     alignment and structure
>3eqc_A Dual specificity mitogen-activated protein kinase; MEK1 kinase, ATP-binding, disease mutation, nucleoti binding, phosphoprotein; HET: 3BM AGS; 1.80A {Homo sapiens} PDB: 3eqd_A* 3eqf_A* 3eqg_A* 3eqh_A* 3eqi_A* 2y4i_C* 3eqb_A* 2p55_A* 1s9j_A* 3dy7_A* 3e8n_A* 3v01_A* 3v04_A* 3dv3_A* 3mbl_A* 3pp1_A* 3orn_A* 3os3_A* 3sls_A* 1s9i_A* ... Back     alignment and structure
>3o0g_A Cell division protein kinase 5; kinase activator complex, kinase inhibitor complex, transferase-transferase activator complex; HET: 3O0; 1.95A {Homo sapiens} SCOP: d.144.1.7 PDB: 1unh_A* 1ung_A* 1unl_A* 1h4l_A Back     alignment and structure
>4agu_A Cyclin-dependent kinase-like 1; transferase, phospho-mimetic; HET: D15; 2.40A {Homo sapiens} Back     alignment and structure
>2zv2_A Calcium/calmodulin-dependent protein kinase kinas; beta, camkk2, E.C.2.7.11.17, phosphorylation, AMPKK, metabolism, binding, calmodulin-binding; HET: 609; 2.40A {Homo sapiens} Back     alignment and structure
>2h6d_A 5'-AMP-activated protein kinase catalytic subunit alpha-2; ATP-binding, cholesterol biosynthesis, fatty acid biosynthesis;kinase, lipid synthesis; 1.85A {Homo sapiens} PDB: 3aqv_A* 2yza_A* Back     alignment and structure
>3kn6_A Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1, MSK, ATP-binding, metal-binding, NUCL binding, serine/threonine-protein kinase, transferase; 2.00A {Homo sapiens} PDB: 3kn5_A Back     alignment and structure
>1t46_A HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcoma viral oncogene homolog; kinase, structure, inhibitor, STI-571, gleevec, transferase activator; HET: STI; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1pkg_A* 1t45_A 3g0e_A* 3g0f_A* Back     alignment and structure
>2rku_A Serine/threonine-protein kinase PLK1; structure of PLK1, selectivity residues, POLO-like K structure based drug design, ATP-binding; HET: R78 TLA SRT TAR; 1.95A {Homo sapiens} PDB: 2v5q_A 2yac_A* 4a4l_A* 4a4o_A* 3kb7_A* 3d5w_A* 3d5u_A* 3d5v_A 3db8_A* 3dbc_A* 3dbd_A* 3d5x_A* 3db6_A* 3dbe_A* 3dbf_A* Back     alignment and structure
>3gbz_A Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; 1.85A {Giardia lamblia} PDB: 3gc0_A* Back     alignment and structure
>3qup_A Tyrosine-protein kinase receptor TYRO3; protein kinase inhibitor, receptor tyrosine kinase, spirocyc kinase domain, phosphotransfer, GAS6 ligand; HET: LUN; 1.90A {Mus musculus} Back     alignment and structure
>2acx_A G protein-coupled receptor kinase 6; GRK, G transferase; HET: ANP; 2.60A {Homo sapiens} PDB: 3nyn_A* 3nyo_A* Back     alignment and structure
>2owb_A Serine/threonine-protein kinase PLK1; catalytic domain, POLO-like kinase1, transfera; HET: 626; 2.10A {Homo sapiens} PDB: 2ou7_A* 3fc2_A* 3thb_A* Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Back     alignment and structure
>3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A Back     alignment and structure
>2qr7_A Ribosomal protein S6 kinase alpha-3; kinase domain, RSK2, autoinhibitory, ATP-binding, nucleotide phosphorylation, serine/threonine-protein kinase; 2.00A {Mus musculus} PDB: 2qr8_A 4d9t_A* 4d9u_A* 3rny_A 2wnt_A Back     alignment and structure
>2h34_A Serine/threonine-protein kinase PKNE; apoenzyme, transferase; 2.80A {Mycobacterium tuberculosis} Back     alignment and structure
>2yfx_A Tyrosine-protein kinase receptor; nucleotide-binding, transferase; HET: VGH; 1.70A {Homo sapiens} PDB: 2xp2_A* 3aox_A* 2yhv_A 3lcs_A* 3lct_A* 4dce_A* 2xba_A* 2xb7_A* Back     alignment and structure
>2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} Back     alignment and structure
>2r5t_A Serine/threonine-protein kinase SGK1; AGC protein kinase, apoptosis, ATP-binding, cytoplasm, endoplasmic reticulum, nucleotide-binding, nucleus; HET: ANP; 1.90A {Homo sapiens} PDB: 3hdm_A* 3hdn_A* Back     alignment and structure
>2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A* Back     alignment and structure
>3a7i_A MST3 kinase, serine/threonine kinase 24 (STE20 homolog, yeast); two-LOBE protein kinase fold, ATP-binding, nucleotid binding, transferase; HET: TPO ADE; 1.45A {Homo sapiens} PDB: 3a7g_A* 3a7h_A* 3a7f_A* 3a7j_A* 3ckw_A 3ckx_A* 3ggf_A* 2xik_A* Back     alignment and structure
>4f0f_A Serine/threonine-protein kinase ROCO4; LRRK2, ATP-binding, nucleotide serine/threonine-protein kinase, transferase, signaling Pro; HET: ACP; 1.80A {Dictyostelium discoideum} PDB: 4f0g_A 4f1t_A* 4f1m_A* 4f1o_A* Back     alignment and structure
>2wei_A Calmodulin-domain protein kinase 1, putative; nucleotide-binding, serine/threonine-protein kinase, CGD3_920, transferase; HET: VGG; 1.65A {Cryptosporidium parvum iowa II} PDB: 3dfa_A 3ma6_A* Back     alignment and structure
>1u59_A Tyrosine-protein kinase ZAP-70; transferase; HET: STU; 2.30A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>1t4h_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase; 1.80A {Rattus norvegicus} PDB: 3fpq_A Back     alignment and structure
>3fdn_A Serine/threonine-protein kinase 6; aurora kinase inhibitors, virtual screening, X-RAY CO- crystal analysis, structure-based drug design (SBDD); HET: MMH; 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 3k5u_A* 3m11_A* 2c6e_A* 1muo_A* 2bmc_A* 2j4z_A* 1ol6_A* 3up2_A* 3unz_A* 3uo5_A* 3uo6_A* 3uod_A* 3uoh_A* 3uoj_A* 3uok_A* 3uo4_A* 3uol_A* 3up7_A* 4dea_A* 4deb_A* ... Back     alignment and structure
>1phk_A Phosphorylase kinase; glycogen metabolism, transferase, serine/threonine-protein, ATP-binding, calmodulin-binding; HET: ATP; 2.20A {Oryctolagus cuniculus} SCOP: d.144.1.7 PDB: 1ql6_A* 2phk_A* Back     alignment and structure
>1mqb_A Ephrin type-A receptor 2; tyrosine protein kinase, transferase; HET: ANP; 2.30A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3llt_A Serine/threonine kinase-1, pflammer; lammer kinase, malaria, structural GE structural genomics consortium, SGC, transferase; HET: ANP; 2.50A {Plasmodium falciparum 3D7} Back     alignment and structure
>3lxp_A Non-receptor tyrosine-protein kinase TYK2; JAK3, inflammation, cancer, PAN inhibitor, ATP-binding nucleotide-binding, phosphoprotein, SH2 domain; HET: PTR IZA; 1.65A {Homo sapiens} PDB: 3lxn_A* 3nz0_A* 3nyx_A* 4e20_A* 4e1z_A* Back     alignment and structure
>2w5a_A Serine/threonine-protein kinase NEK2; Ser/Thr protein kinase, nucleus, meiosis, mitosis, cytoplasm, metal-binding, phosphoprotein; HET: ADP; 1.55A {Homo sapiens} PDB: 2wqo_A* 2xk3_A* 2xk4_A* 2xk6_A* 2xk7_A* 2xk8_A* 2xkc_A* 2xkd_A* 2xke_A* 2xkf_A* 2xnm_A* 2xnn_A* 2xno_A* 2xnp_A* 4afe_A* 2jav_A* 2w5b_A* 2w5h_A 4a4x_A* Back     alignment and structure
>1u5q_A Serine/threonine protein kinase TAO2; transferase; HET: SEP; 2.10A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 1u5r_A* 2gcd_A* Back     alignment and structure
>1mp8_A Focal adhesion kinase 1; tyrosine protein kinase, transferase; HET: ADP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 2ijm_A* 2etm_A* 3pxk_A* 2jkq_A* 2j0m_B* 2jkm_A* 2j0l_A* 3bz3_A* 2jko_A* 2jkk_A* Back     alignment and structure
>2vgo_A Serine/threonine-protein kinase 12-A; nucleotide-binding, serine/threonine-protein kinase, ATP-binding, transferase, coiled coil, cell division, kinase; HET: TPO AD5; 1.7A {Xenopus laevis} PDB: 2bfx_A* 2vgp_A* 3ztx_A* 2vrx_A* 2bfy_A* 4af3_A* 3dj6_A* 3d15_A* 3d2i_A* 3d2k_A* 3d14_A* 3dj5_A* 3dj7_A* 3daj_A* 1ol5_A* 1ol7_A* 2x6d_A* 2x6e_A* 2xng_A* 2dwb_A* ... Back     alignment and structure
>2ycf_A Serine/threonine-protein kinase CHK2; transferase, anticancer, anticancer drug design; HET: YCF; 1.77A {Homo sapiens} PDB: 2yiq_A* 2w7x_A* 2ycq_A* 2ycs_A* 2w0j_A* 2yir_A* 2yit_A* 2wtj_A* 2cn8_A* 2wtc_A* 2wtd_A* 2wti_A* 2cn5_A* 2xbj_A* 2xm8_A* 2xm9_A* 2xk9_A* 2ycr_A* Back     alignment and structure
>1zy4_A Serine/threonine-protein kinase GCN2; translation regulator, signal transduction, acid starvation, starvation stress response; 1.95A {Saccharomyces cerevisiae} PDB: 1zy5_A* 1zyd_A* 1zyc_A* 1zxe_A Back     alignment and structure
>2pml_X PFPK7, Ser/Thr protein kinase; phosphorylati transferase, transferase; HET: ANP; 2.60A {Plasmodium falciparum} PDB: 2pmn_X* 2pmo_X* Back     alignment and structure
>1fvr_A Tyrosine-protein kinase TIE-2; tyrosine kinase, transferase; 2.20A {Homo sapiens} SCOP: d.144.1.7 PDB: 2oo8_X* 2osc_A* 2p4i_A* 3l8p_A* 2wqb_A* Back     alignment and structure
>2i1m_A Macrophage colony-stimulating factor 1 receptor; kinase domain, kinase inhibitor complex, transferase; HET: 5CN; 1.80A {Homo sapiens} PDB: 3bea_A* 3lcd_A* 2i0y_A* 2i0v_A* 3dpk_A* 3krj_A* 3krl_A* 2ogv_A 3lco_A* Back     alignment and structure
>1xbb_A Tyrosine-protein kinase SYK; gleevec, STI-571, imatinib, spleen typrosine kinase, active conformation, structural genomics, structural genomix; HET: STI; 1.57A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xba_A* 1xbc_A* 3fqe_A* 3fqh_A* 3fqs_A* 3emg_A* 3srv_A* 4dfl_A* 4dfn_A* 3vf8_A* 3vf9_A* Back     alignment and structure
>2vwi_A Serine/threonine-protein kinase OSR1; STE kinase, hypertension, transferase; HET: ANP; 2.15A {Homo sapiens} PDB: 3dak_A* Back     alignment and structure
>3c4z_A Rhodopsin kinase; Ser/Thr kinase, RGS homology domain, G protein coupled recep kinase, GRK, GRK1, P-loop, autophosphoryl ADP, ATP-binding; HET: ADP; 1.84A {Bos taurus} PDB: 3c4x_A* 3c4y_A 3c4w_A* 3c50_A* 3c51_A* 3qc9_A* 2i94_B Back     alignment and structure
>2xir_A Vascular endothelial growth factor receptor 2; angiogenesis, nucleotide-binding, inhibitor, phosphorylation receptor, transferase, transmembrane; HET: 00J; 1.50A {Homo sapiens} PDB: 1vr2_A* 1ywn_A* 3vnt_A* 3c7q_A* 2oh4_A* 3u6j_A* 3efl_A* 2p2i_A* 3cjf_A* 3cjg_A* 3ewh_A* 2qu5_A* 2qu6_A* 2rl5_A* 3b8q_A* 3b8r_A* 2p2h_A* 3cp9_A* 3cpb_A* 3cpc_A* ... Back     alignment and structure
>4aaa_A Cyclin-dependent kinase-like 2; transferase, phospho-mimetic; HET: DKI; 1.53A {Homo sapiens} PDB: 4bbm_A* Back     alignment and structure
>3pg1_A Mitogen-activated protein kinase, putative (MAP K protein); EPK Ser/Thr protein kinase fold, Ser/Thr protein kinase, TRA; 1.95A {Leishmania major} PDB: 3uib_A* Back     alignment and structure
>3poz_A Epidermal growth factor receptor; kinase domain, anti-oncogene, ATP-binding, cell cycle, disea mutation, glycoprotein, membrane, nucleotide-binding; HET: 03P; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 2itx_A* 2ity_A* 2j5f_A* 2j6m_A* 2itw_A* 1m14_A 1m17_A* 3vjo_A* 2gs6_A* 2gs2_A* 2rf9_A 4g5j_A* 1xkk_A* 2eb2_A 3gop_A 2eb3_A* 2itn_A* 2ito_A* 2itp_A* 2itq_A* ... Back     alignment and structure
>3q4u_A Activin receptor type-1; structural genomics consortium, SGC, protein kinase, transfe; HET: LDN FLC; 1.82A {Homo sapiens} PDB: 3mtf_A* 3oom_A* 4dym_A* 3h9r_A* 3my0_A* Back     alignment and structure
>2x7f_A TRAF2 and NCK-interacting protein kinase; serine/threonine-protein kinase, phosphoprotein; HET: 824; 2.80A {Homo sapiens} Back     alignment and structure
>3c1x_A Hepatocyte growth factor receptor; receptor tyrosine kinase, signal transduction, GRB2, SHC, ATP-binding, glycoprotein, membrane; HET: CKK; 2.17A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3e7e_A HBUB1, BUB1A, mitotic checkpoint serine/threonine-protein kinas; spindle assembly checkpoint, mitosis, kinase, activation, KE CDC20, ATP-binding; HET: ATP; 2.31A {Homo sapiens} Back     alignment and structure
>2i6l_A Mitogen-activated protein kinase 6; MAPK6, ERK3, extracellular signal regulated kinase 3, serine phosphorylation, threonine phosphorylation; 2.25A {Homo sapiens} Back     alignment and structure
>1vzo_A Ribosomal protein S6 kinase alpha 5; protein kinase, transferase, phosphorylation, serine/threonine protein kinase; 1.8A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2izr_A Casein kinase I isoform gamma-3; serine/threonine-protein kinase, transferase, ATP- binding, phosphorylation, nucleotide-binding; HET: BRK; 1.3A {Homo sapiens} PDB: 2izs_A* 2izt_A* 2izu_A* 2chl_A* 2c47_A* 2cmw_A* Back     alignment and structure
>3dls_A PAS domain-containing serine/threonine-protein KI; PAS kinase, PASK, protein kinase, drug discovery, ATP-bindin kinase, nucleotide-binding; HET: ADP; 2.30A {Homo sapiens} Back     alignment and structure
>3f66_A Hepatocyte growth factor receptor; C-Met, protein kinase, quinoxaline, alternative splicing, ATP-binding, chromosomal rearrangement; HET: IHX; 1.40A {Homo sapiens} PDB: 3i5n_A* 3u6h_A* 3u6i_A* 4deg_A* 4deh_A* 4dei_A* 3ccn_A* 2rfn_A* 2rfs_A* 3cd8_A* 3efj_A* 3efk_A* 3lq8_A* 3zxz_A* 2wkm_A* 2wgj_A* 3zze_A* 4aoi_A* 4ap7_A* 3q6w_A* ... Back     alignment and structure
>3com_A Serine/threonine-protein kinase 4; MST1, STE20-like kinase, PSI, structural genomics, protein structure initiative; HET: TPO; 2.20A {Homo sapiens} Back     alignment and structure
>4fl3_A Tyrosine-protein kinase SYK; transferase; HET: ANP; 1.90A {Homo sapiens} PDB: 4fl2_A* 1a81_A* 1csy_A* 1csz_A* Back     alignment and structure
>3brb_A Proto-oncogene tyrosine-protein kinase MER; ATP-binding, disease mutation, glycoprotein, nucleot binding, phosphorylation, receptor; HET: ADP; 1.90A {Homo sapiens} PDB: 3bpr_A* 2p0c_A* Back     alignment and structure
>3pls_A Macrophage-stimulating protein receptor; protein kinase, CIS autophosphorylation conformation, recept tyrosine kinase, AMP-PNP, unphosphorylated; HET: ANP; 2.24A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3n9x_A Phosphotransferase; malaria kinase, structural genomics, structural genomics CON SGC; 2.05A {Plasmodium berghei} PDB: 3nie_A* Back     alignment and structure
>3rp9_A Mitogen-activated protein kinase; structural genomics, structural genomics consortium, SGC, TR; 2.40A {Toxoplasma gondii} Back     alignment and structure
>2vuw_A Serine/threonine-protein kinase haspin; cell cycle, transferase, CAsp8, nucleotide binding; HET: MSE 5ID MPD; 1.80A {Homo sapiens} PDB: 3f2n_A* 3e7v_A* 3dlz_A* 3fmd_A* 3iq7_A* 2wb8_A Back     alignment and structure
>2y7j_A Phosphorylase B kinase gamma catalytic chain, testis/liver isoform; transferase; HET: B49; 2.50A {Homo sapiens} PDB: 1h0t_A 1lp1_B 1q2n_A 2spz_A 3mzw_B* 1ss1_A 2jwd_A 1bdc_A 1bdd_A 1fc2_C* 2b87_A 2b88_A 1h0t_B 1lp1_A 2b87_B 2b89_A 3s1k_A Back     alignment and structure
>3dbq_A Dual specificity protein kinase TTK; MPS1 structure, kinase activation, phosphorylation, ATP- binding, nucleotide-binding, phosphoprotein; 2.70A {Homo sapiens} Back     alignment and structure
>2a19_B Interferon-induced, double-stranded RNA-activated kinase; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Homo sapiens} PDB: 2a1a_B* Back     alignment and structure
>2r3i_A Cell division protein kinase 2; serine/threonine-protein kinase, cell cycle, inhibition, cyclin-dependent kinase, cancer, ATP-binding; HET: SCF; 1.28A {Homo sapiens} PDB: 2r3j_A* 2r3k_A* 2r3l_A* 2r3m_A* 2r3n_A* 2r3o_A* 2r3p_A* 2r3q_A* 1jvp_P* 1buh_A 1ckp_A* 1di8_A* 1dm2_A* 1f5q_A 1fin_A* 1fq1_B* 1fvt_A* 1fvv_A* 1g5s_A* 1gih_A* ... Back     alignment and structure
>3p1a_A MYT1 kinase, membrane-associated tyrosine- and threonine-speci inhibitory kinase; structural genomics, structural genomics consortium, SGC; 1.70A {Homo sapiens} Back     alignment and structure
>1byg_A CSK, protein (C-terminal SRC kinase); protein kinase, phosphorylation, staurosporine, transferase; HET: STU; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 3d7u_A 3d7t_A* Back     alignment and structure
>3ll6_A Cyclin G-associated kinase; transferase, protein kinase, serine/threonine kinase, cyclin clathrine, membrane trafficking, structural genomics; 2.10A {Homo sapiens} Back     alignment and structure
>3og7_A AKAP9-BRAF fusion protein; proto-oncogene, V600E, kinase, transferase; HET: 032; 2.45A {Homo sapiens} SCOP: d.144.1.7 PDB: 4fk3_A* 3c4c_A* 3c4d_A* 3idp_A* 4g9r_A* 3ii5_A* 4e26_A* 3ppj_A* 3ppk_A* 3prf_A* 3pri_A* 3psb_A* 3psd_A* 3q4c_A* 3skc_A* 3tv4_A* 3tv6_A* 3d4q_A* 4e4x_A* 4g9c_A* ... Back     alignment and structure
>3mtl_A Cell division protein kinase 16; pctaire1, indirubin, structural genomics, structural consortium, SGC, transferase; HET: FEF; 2.40A {Homo sapiens} Back     alignment and structure
>2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A* Back     alignment and structure
>3lm5_A Serine/threonine-protein kinase 17B; STK17B, serine/threonine kinase 17B, DRAK2, DAP kinase relat apoptosis-inducing protein kinase 2; HET: QUE; 2.29A {Homo sapiens} PDB: 3lm0_A* Back     alignment and structure
>3cc6_A Protein tyrosine kinase 2 beta; focal adhesion kinase, structural genomics, structural genom consortium, SGC, ATP-binding, membrane; 1.60A {Homo sapiens} PDB: 3fzs_A* 3et7_A 3fzo_A* 3fzr_A* 3fzp_A* 3fzt_A* 3h3c_A* Back     alignment and structure
>1ua2_A CAK, cell division protein kinase 7; cell cycle, phosphorylation, protein-protein interaction, PR kinase, cell cycle, transferase; HET: TPO ATP; 3.02A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>1b6c_B TGF-B superfamily receptor type I; complex (isomerase/protein kinase), receptor serine/threonine kinase; 2.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1ias_A 2x7o_A* 3faa_A* 3kcf_A* Back     alignment and structure
>2wtk_C Serine/threonine-protein kinase 11; transferase-metal-binding protein complex, transferase metal protein complex, nucleus; HET: ANP; 2.65A {Homo sapiens} Back     alignment and structure
>3nsz_A CK II alpha, casein kinase II subunit alpha; inhibitor, transferase-transferase inhibitor CO; HET: ANP; 1.30A {Homo sapiens} SCOP: d.144.1.7 PDB: 2r7i_A 3pe1_A* 1jwh_A* 3pe2_A* 3r0t_A* 3h30_A* 3q9w_A* 3q9x_A* 3q9y_A* 3q9z_A* 3qa0_A 3bqc_A* 2rkp_A* 3c13_A* 3fwq_A 3rps_A* 3u9c_A* 4fbx_A* 3mb7_A* 3mb6_A* ... Back     alignment and structure
>3kex_A Receptor tyrosine-protein kinase ERBB-3; kinase domain, inactive kinase, HER3, ATP-binding, cell membrane, membrane, nucleotide-binding; HET: ANP; 2.80A {Homo sapiens} PDB: 3lmg_A* Back     alignment and structure
>3mdy_A Bone morphogenetic protein receptor type-1B; complex (isomerase-protein kinase), receptor serine/threonin structural genomics consortium, SGC; HET: LDN; 2.05A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>1nxk_A MAP kinase-activated protein kinase 2; MK2, phosphorylation, staurosporine, transfe; HET: STU; 2.70A {Homo sapiens} SCOP: d.144.1.7 PDB: 1kwp_A* 1ny3_A* 2onl_C Back     alignment and structure
>3lzb_A Epidermal growth factor receptor; epidermal growth factor kinase domain, multitargeted small M kinase inhibitor; HET: ITI; 2.70A {Homo sapiens} Back     alignment and structure
>1cm8_A Phosphorylated MAP kinase P38-gamma; phosphorylation, transferase; HET: TPO PTR ANP; 2.40A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3eb0_A Putative uncharacterized protein; kinase cryptosporidium parvum, ATP-binding, kinase, nucleoti binding; HET: PTR DRK; 2.65A {Cryptosporidium parvum iowa II} Back     alignment and structure
>3m2w_A MAP kinase-activated protein kinase 2; small molecule inhibitor, spiroazetidine-tetracycle, ATP-SIT inhibitor, novartis compound NVP-BXS169; HET: L8I; 2.41A {Homo sapiens} PDB: 3kga_A* 3m42_A* Back     alignment and structure
>3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Back     alignment and structure
>3fme_A Dual specificity mitogen-activated protein kinase; active mutant, structural genomics consortium, SCG, binding, nucleotide-binding, phosphoprotein; HET: STU; 2.26A {Homo sapiens} PDB: 3enm_A Back     alignment and structure
>3g33_A Cell division protein kinase 4; Ser/Thr protein kinase, cell cycle, phosphorylation, ATP-BIN cell division, disease mutation, kinase; 3.00A {Homo sapiens} Back     alignment and structure
>3mi9_A Cell division protein kinase 9; P-TEFB, HIV-1, protein binding; HET: TPO; 2.10A {Homo sapiens} PDB: 3mia_A* 4ec9_A* 4ec8_A* 3blh_A* 3blq_A* 3blr_A* 3lq5_A* 3my1_A* 3tn8_A* 3tnh_A* 3tni_A* 4bch_A* 4bci_A* 4bcj_A* 4bcf_A* Back     alignment and structure
>3ttj_A Mitogen-activated protein kinase 10; JNK3, protein kinase in transferase-transferase inhibitor complex; HET: JBI; 2.10A {Homo sapiens} PDB: 3tti_A* 1jnk_A* Back     alignment and structure
>3byv_A Rhoptry kinase; malaria, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} PDB: 2w1z_A Back     alignment and structure
>3oz6_A Mitogen-activated protein kinase 1, serine/threon protein kinase; structural genomics consortium, SGC, transferase; 2.37A {Cryptosporidium parvum iowa II} Back     alignment and structure
>3qa8_A MGC80376 protein; kinase ubiquitin-like domain, phosphorylation, kinase domain ubiquitin-like domain, kinase, substrate binding; 3.60A {Xenopus laevis} PDB: 3qad_A* 3rzf_A* Back     alignment and structure
>2j0j_A Focal adhesion kinase 1; cell migration, FERM, transferase, integrin signaling; HET: 4ST; 2.80A {Gallus gallus} PDB: 2j0k_A* Back     alignment and structure
>2xrw_A Mitogen-activated protein kinase 8; transcription, MAPK signaling pathways, linear binding motif; HET: ANP; 1.33A {Homo sapiens} PDB: 1ukh_A 1uki_A* 2xs0_A* 3elj_A* 2h96_A* 2gmx_A* 2g01_A* 2no3_A* 3o2m_A* 3o17_A* 3pze_A* 3g9l_X* 2p33_A* 3cgf_A* 3cgo_A* 3g90_X* 2ok1_A* 3g9n_A* 1pmn_A* 1pmq_A* ... Back     alignment and structure
>1u46_A ACK-1, activated CDC42 kinase 1; tyrosine kinase, transferase; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 1u4d_A* 1u54_A* 3eqr_A* 3eqp_B* Back     alignment and structure
>2y4i_B KSR2, HKSR2, kinase suppressor of RAS 2; transferase, KSR1; HET: ATP; 3.46A {Homo sapiens} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>1csn_A Casein kinase-1; phosphotransferase; HET: ATP; 2.00A {Schizosaccharomyces pombe} SCOP: d.144.1.7 PDB: 1eh4_A* 2csn_A* Back     alignment and structure
>2v62_A Serine/threonine-protein kinase VRK2; transferase, ATP-binding, membrane, nucleotide-binding, TRAN; 1.7A {Homo sapiens} Back     alignment and structure
>2iwi_A Serine/threonine-protein kinase PIM-2; nucleotide-binding, cancer, leukemia, transferase, ATP-binding, proto- oncogene, phosphorylation; HET: HB1; 2.80A {Homo sapiens} Back     alignment and structure
>2b9h_A MAP kinase FUS3, mitogen-activated protein kinase FUS3; transferase; HET: ADP; 1.55A {Saccharomyces cerevisiae} PDB: 2b9i_A* 2b9j_A* 2f49_A 2fa2_A 2b9f_A* 2f9g_A* Back     alignment and structure
>2fst_X Mitogen-activated protein kinase 14; active mutants, lipids, MAP kinase insertion, autophosphorylation, transferase; HET: BOG; 1.45A {Homo sapiens} PDB: 2fso_X* 2fsl_X* 2fsm_X* 2npq_A* 2bal_A* 2baj_A* 2bak_A* 2baq_A* 2qd9_A* 1ian_A* 2rg5_A* 2rg6_A* 3bv2_A* 3bv3_A* 3bx5_A* 3c5u_A* 3cg2_A* 3l8x_A* 3mvl_A* 3mvm_A* ... Back     alignment and structure
>3qyz_A Mitogen-activated protein kinase 1; transferase, serine/threonine-protein kinase, ATP-binding CE phosphorylation; HET: CME Z8B SO4; 1.46A {Rattus norvegicus} PDB: 2fys_B 1erk_A* 3qyi_A* 3erk_A* 3qyw_A* 4erk_A* 4gsb_A* 4gt3_A* 4gva_A* 2z7l_A* 2erk_A* 1gol_A* 2gph_A 3zu7_A 3zuv_A* 3o71_A 3r63_A 3c9w_A* 2y9q_A* 4fmq_A* ... Back     alignment and structure
>3op5_A Serine/threonine-protein kinase VRK1; adenosine triphosphate, amino acid sequence, binding sites, domain, models, molecular; HET: REB; 2.40A {Homo sapiens} PDB: 2lav_A 2kty_A 2kul_A Back     alignment and structure
>3cek_A Dual specificity protein kinase TTK; HMPS1, PYT, ESK, phosphotyros picked threonine kinase, SGC, structural genomics consortiu binding; HET: 7PE; 2.30A {Homo sapiens} PDB: 3gfw_A* 3h9f_A* 2x9e_A* 3hmp_A* 3hmn_A* 3hmo_A* Back     alignment and structure
>4exu_A Mitogen-activated protein kinase 13; P38 kinase, transferase; 1.70A {Homo sapiens} PDB: 4eyj_A* 4eym_A* 3coi_A Back     alignment and structure
>3g2f_A Bone morphogenetic protein receptor type-2; kinase, structural genomics, structural genomics consortium, ATP-binding, disease mutation; HET: ADP; 2.35A {Homo sapiens} Back     alignment and structure
>2jii_A Serine/threonine-protein kinase VRK3 molecule: VA related kinase 3; transferase, pseudo kinase domain, vaccinia related kinase, ATP-binding; 2.00A {Homo sapiens} Back     alignment and structure
>3coi_A Mitogen-activated protein kinase 13; P38D, P38delta, ERK, MAP kinase, PMK, STK26, stress-activated protein kinase, structural genomics, PSI; 2.09A {Homo sapiens} Back     alignment and structure
>1blx_A Cyclin-dependent kinase 6; inhibitor protein, cyclin-dependent kinase, cell cycle control, alpha/beta, complex (inhibitor protein/kinase); 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 1bi7_A 1bi8_A 1g3n_A 2f2c_B* 1jow_B* 2euf_B* 1xo2_B* 3nup_A* 3nux_A* 2w9z_B 2w99_B 2w96_B 2w9f_B Back     alignment and structure
>3fhr_A MAP kinase-activated protein kinase 3; kinase-inhibitor complex, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; HET: P4O; 1.90A {Homo sapiens} PDB: 3fxw_A* 3r1n_A* 3she_A* 2oza_A 3fyk_X* 3fyj_X* 2p3g_X* 3ka0_A* 3fpm_A* 2pzy_A* 3a2c_A* 3kc3_A* 3gok_A* 2jbo_A* 2jbp_A* 3r2y_A* 3r30_A* 3r2b_A* Back     alignment and structure
>3e3p_A Protein kinase, putative glycogen synthase kinase; leishmaniasis, transferase; 2.00A {Leishmania major} Back     alignment and structure
>3kvw_A DYRK2, dual specificity tyrosine-phosphorylation-regulat 2; KI-(Y)-phosphorylation REG kinase 2, PSK-H2, kinase, structural genomics consortium; HET: SEP PTR IRB; 2.28A {Homo sapiens} PDB: 3k2l_A* 4azf_A* Back     alignment and structure
>1wak_A Serine/threonine-protein kinase SPRK1; SRPK, transferase, alternative splicing, ATP-binding, chromosome partition, differentiation, mRNA processing; 1.73A {Homo sapiens} PDB: 1wbp_A* 3beg_A* 2x7g_A* Back     alignment and structure
>3aln_A Dual specificity mitogen-activated protein kinase; protein AMP-PNP complex, transferase; HET: ANP; 2.30A {Homo sapiens} PDB: 3alo_A* Back     alignment and structure
>4e7w_A Glycogen synthase kinase 3; GSK3, PTyr195, transferase; HET: PTR; 3.30A {Ustilago maydis} Back     alignment and structure
>3rgf_A Cyclin-dependent kinase 8; protein kinase complex, transferase,transcription; HET: BAX; 2.20A {Homo sapiens} Back     alignment and structure
>1z57_A Dual specificity protein kinase CLK1; protein tyrosine kinase, splicing, human, 10Z-hymendialdisine, structural genomics; HET: DBQ; 1.70A {Homo sapiens} PDB: 2vag_A* Back     alignment and structure
>3uzp_A CKI-delta, CKID, casein kinase I isoform delta; CK1D, inhibitor, PF670462, transferase-transferase I complex; HET: 0CK; 1.94A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 1cki_A 1ckj_A Back     alignment and structure
>2rio_A Serine/threonine-protein kinase/endoribonuclease IRE1; protein-nucleotide complex, ATP-binding, endoplasmic reticulum, glycoprotein; HET: ADP; 2.40A {Saccharomyces cerevisiae} PDB: 3lj0_A* 3lj1_A* 3lj2_A* 3fbv_A* 3sdm_A* 3sdj_A* Back     alignment and structure
>3a99_A Proto-oncogene serine/threonine-protein kinase PI; PIM-1, P27KIP1, peptide drug, prostate cancer, transferase; HET: ANP; 1.60A {Homo sapiens} PDB: 3bgq_A* 3bgp_A* 2obj_A* 3bgz_A* 3t9i_A* 3dcv_A* 1xws_A* 2xj1_A* 2xix_A* 2xiz_A* 2xj0_A* 2xiy_A* 2xj2_A* 3f2a_A* 1xr1_A* 1xqz_A* 3cy2_A* 3cxw_A* 3cy3_A* 2bik_B* ... Back     alignment and structure
>3p23_A Serine/threonine-protein kinase/endoribonuclease; kinase domain, kinase and RNAse function, ATP binding ssRNA dephosphorylated, hydrolase; HET: ADP; 2.70A {Homo sapiens} Back     alignment and structure
>1j1b_A Glycogen synthase kinase-3 beta; complex, TAU, AMPPNP, transferase; HET: ANP; 1.80A {Homo sapiens} SCOP: d.144.1.7 PDB: 1i09_A* 1j1c_A* 2jld_A* 3m1s_A* 3pup_A* 3du8_A* 1pyx_A* 1q41_A* 1q3w_A* 1q3d_A* 1q4l_A* 3q3b_A* 1q5k_A* 3i4b_A* 3l1s_A* 1r0e_A* 3zrk_A* 3zrl_A* 3zrm_A* 4dit_A* ... Back     alignment and structure
>4hgt_A Casein kinase I isoform delta; CK1D, inhibitor, transferase-transferase inhibitor C; HET: 15G; 1.80A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 3uzp_A* 4hnf_A* 1cki_A 1ckj_A 4hni_A* 4hok_A Back     alignment and structure
>2dyl_A Dual specificity mitogen-activated protein kinase kinase 7; MKK7, activated mutant, ATP-binding, structural genomics, NPPSFA; 2.45A {Homo sapiens} Back     alignment and structure
>1q8y_A SR protein kinase; transferase; HET: ADP ADE; 2.05A {Saccharomyces cerevisiae} SCOP: d.144.1.7 PDB: 1q8z_A 1q97_A* 1q99_A* 1how_A 2jd5_A Back     alignment and structure
>3sv0_A Casein kinase I-like; typical kinase domain fold, cytosol, transferase; 2.00A {Oryza sativa japonica group} Back     alignment and structure
>2eu9_A Dual specificity protein kinase CLK3; kinase domain, transferase; 1.53A {Homo sapiens} PDB: 2wu6_A* 2wu7_A* 3raw_A* 2exe_A 3nr9_A* Back     alignment and structure
>2vx3_A Dual specificity tyrosine-phosphorylation- regula kinase 1A; serine/threonine-protein kinase, minibrain homolog, nucleotide-binding, transferase; HET: PTR D15 P6G; 2.40A {Homo sapiens} PDB: 2wo6_A* 3anq_A* 3anr_A* Back     alignment and structure
>3q60_A ROP5B; pseudokinase, transferase; HET: ATP; 1.72A {Toxoplasma gondii} PDB: 3q5z_A* Back     alignment and structure
>3en9_A Glycoprotease, O-sialoglycoprotein endopeptidase/protein kinase; endopeptidase activity, protein kinase activity; HET: TBR; 2.67A {Methanocaldococcus jannaschii} PDB: 3enh_A* 2vwb_A* Back     alignment and structure
>1zar_A RIO2 kinase; serine kinase, winged-helix, RIO domain, ADP-Mn complex, rRNA processing, transferase; HET: ADP; 1.75A {Archaeoglobus fulgidus} SCOP: a.4.5.56 d.144.1.9 PDB: 1tqi_A* 1tqp_A* 1tqm_A* 1zao_A* Back     alignment and structure
>4azs_A Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15A {Escherichia coli} PDB: 4azt_A* 4azv_A* 4azw_A* Back     alignment and structure
>3dzo_A Rhoptry kinase domain; parasitic disease, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Back     alignment and structure
>1zth_A RIO1 serine protein kinase; ribosome biogenesis, rRNA, ADP, manganese, transferase; HET: ADP; 1.89A {Archaeoglobus fulgidus} PDB: 1zp9_A* 1ztf_A* Back     alignment and structure
>4gyi_A RIO2 kinase; protein kinase, ADP complex, phosphoaspartate, acyl-phosphat ribosome biogenesis, Ser/Thr protein kinase; HET: PHD ADP; 2.20A {Chaetomium thermophilum} PDB: 4gyg_A Back     alignment and structure
>3tm0_A Aminoglycoside 3'-phosphotransferase; protein kinase, phosphorylation, transferase-antibiotic COMP; HET: ANP B31; 2.10A {Enterococcus faecalis} SCOP: d.144.1.6 PDB: 2b0q_A* 1l8t_A* 3q2j_A* 1j7i_A* 1j7u_A* 3h8p_A* 1j7l_A* 2bkk_A* Back     alignment and structure
>2vtf_A Endo-beta-N-acetylglucosaminidase; hydrolase, family 85, glycosidase, carbohydrat binding; HET: B3P PGE; 1.79A {Arthrobacter protophormiae} PDB: 3fhq_A* 3fha_A* Back     alignment and structure
>2w91_A Endo-beta-N-acetylglucosaminidase D; hydrolase, N-glycan, secreted, oxazoline, NAG-thiazoline, substrate-participation; 1.40A {Streptococcus pneumoniae} PDB: 2w92_A* Back     alignment and structure
>1nd4_A Aminoglycoside 3'-phosphotransferase; protein kinase, ATPase, kanamycin; HET: KAN; 2.10A {Klebsiella pneumoniae} SCOP: d.144.1.6 Back     alignment and structure
>3dxp_A Putative acyl-COA dehydrogenase; protein kinase-like fold, structural genomics, joint center structural genomics, JCSG; 2.32A {Ralstonia eutropha JMP134} Back     alignment and structure
>4gkh_A Aminoglycoside 3'-phosphotransferase APHA1-IAB; pyrazolopyrimidine, 1-Na-PP1, bumped kinase inhibitor, BKI, kinase inhibitor; HET: KAN 0J9; 1.86A {Acinetobacter baumannii} PDB: 4feu_A* 4few_A* 4fex_A* 4fev_A* 4gki_A* 4ej7_A* 3r78_A* Back     alignment and structure
>3tdw_A Gentamicin resistance protein; kinase, phosphoryl transfer, antibiotic resistance, transfer; HET: GDP; 1.70A {Enterococcus gallinarum} PDB: 3tdv_A* Back     alignment and structure
>3ats_A Putative uncharacterized protein; hypothetical protein, putative aminoglycoside phosphortransf transferase; 1.67A {Mycobacterium tuberculosis} PDB: 3att_A* Back     alignment and structure
>3sg8_A APH(2'')-ID; antibiotic resistance enzyme, transferase, aminoglycoside, phosphorylation, transferase-antibiotic complex; HET: TOY; 1.80A {Enterococcus casseliflavus} PDB: 3sg9_A* 3n4v_A 3n4t_A 3n4u_A 3r81_A* 3r80_A* 3r7z_A* 3r82_A* 3vcq_A* 4dbx_A 4de4_A* 4dfb_A* 4dfu_A* 4dt9_A* 4dt8_A* 4dtb_A* 3sgc_A 4dta_A* 3lzh_A Back     alignment and structure
>3f7w_A Putative fructosamine-3-kinase; YP_290396.1, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI-2; 1.85A {Thermobifida fusca YX} Back     alignment and structure
>3jr1_A Putative fructosamine-3-kinase; YP_719053.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE UNL; 2.32A {Haemophilus somnus 129PT} Back     alignment and structure
>2olc_A MTR kinase, methylthioribose kinase; kinase ADP-2HO complex, transferase; HET: CPS ADP; 2.00A {Bacillus subtilis} SCOP: d.144.1.6 PDB: 2pu8_A* 2pui_A* 2pul_A* 2pun_A* 2pup_A* Back     alignment and structure
>3gdb_A Endo-D, putative uncharacterized protein SPR0440; alpha-beta-barrels, cell WALL, peptidoglycan-anchor, secreted, hydrolase; HET: PGE; 1.87A {Streptococcus pneumoniae} PDB: 2xqx_A Back     alignment and structure
>2k1k_A Ephrin type-A receptor 1; EPHA1, receptor tyrosine kinase, dimeric transmembrane domain, ATP-binding, glycoprotein, nucleotide-binding; NMR {Homo sapiens} PDB: 2k1l_A Back     alignment and structure
>2wnw_A Activated by transcription factor SSRB; hydrolase, salmonella typhimurium, O-glycosyl hydrolase family 30; 2.00A {Salmonella enterica subsp} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 580
d1goia2356 c.1.8.5 (A:3-291,A:380-446) Chitinase B, catalytic 4e-33
d1vf8a1302 c.1.8.5 (A:1-245,A:316-372) Chitinase-like lectin 8e-27
d1vf8a1302 c.1.8.5 (A:1-245,A:316-372) Chitinase-like lectin 2e-04
d1w9pa1333 c.1.8.5 (A:39-298,A:361-433) Chitinase 1 {Aspergil 2e-26
d2pi6a1292 c.1.8.5 (A:1-239,A:308-361) Signal processing prot 4e-26
d2pi6a1292 c.1.8.5 (A:1-239,A:308-361) Signal processing prot 1e-05
d1ll7a1330 c.1.8.5 (A:36-292,A:355-427) Chitinase 1 {Fungus ( 9e-26
d1wb0a1297 c.1.8.5 (A:22-266,A:337-388) Chitotriosidase {Huma 1e-25
d1wb0a1297 c.1.8.5 (A:22-266,A:337-388) Chitotriosidase {Huma 3e-05
d1edqa2358 c.1.8.5 (A:133-443,A:517-563) Chitinase A, catalyt 3e-25
d1sm2a_ 263 d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Hu 1e-23
d1jnda1327 c.1.8.5 (A:2-278,A:371-420) Imaginal disc growth f 1e-23
d1k2pa_ 258 d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Hum 4e-23
d1qpca_ 272 d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Hom 4e-23
d1s9ja_ 322 d.144.1.7 (A:) Dual specificity mitogen-activated 2e-22
d1lufa_ 301 d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus n 4e-22
d1uwha_ 276 d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) 4e-22
d1u5ra_ 309 d.144.1.7 (A:) Serine/threonine protein kinase TAO 7e-22
d1opja_ 287 d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mou 1e-21
d1byga_ 262 d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) 1e-21
d1yhwa1 293 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [ 3e-21
d1t46a_ 311 d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens 4e-21
d1u59a_ 285 d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Hum 4e-21
d1jpaa_ 299 d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mou 8e-21
d1p4oa_ 308 d.144.1.7 (A:) Insulin-like growth factor 1 recept 1e-20
d2jfla1 288 d.144.1.7 (A:21-308) STE20-like serine/threonine-p 1e-20
d1fmka3 285 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human 2e-20
d1koaa2 350 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {C 2e-20
d1a06a_ 307 d.144.1.7 (A:) Calmodulin-dependent protein kinase 5e-20
d1koba_ 352 d.144.1.7 (A:) Twitchin, kinase domain {California 5e-20
d1vjya_ 303 d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human 7e-20
d1uu3a_ 288 d.144.1.7 (A:) 3-phosphoinositide dependent protei 4e-19
d1rjba_ 325 d.144.1.7 (A:) Fl cytokine receptor {Human (Homo s 6e-19
d1xbba_ 277 d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human 9e-19
d1u46a_ 273 d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Hum 1e-18
d1pmea_ 345 d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapien 2e-18
d1fvra_ 309 d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [ 2e-18
d1kfwa1374 c.1.8.5 (A:10-327,A:389-444) Psychrophilic chitina 3e-18
d1nvra_ 271 d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 { 3e-18
d2j4za1 263 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aur 5e-18
d1mp8a_ 273 d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Huma 5e-18
d1r0pa_ 311 d.144.1.7 (A:) Hepatocyte growth factor receptor, 6e-18
d1o6ya_ 277 d.144.1.7 (A:) Mycobacterial protein kinase PknB, 7e-18
d1ob3a_ 286 d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmod 8e-18
d2java1 269 d.144.1.7 (A:3-271) Serine/threonine-protein kinas 8e-18
d1mqba_ 283 d.144.1.7 (A:) epha2 receptor tyrosine kinase {Hum 2e-17
d1jksa_ 293 d.144.1.7 (A:) Death-associated protein kinase, Da 2e-17
d1tkia_ 321 d.144.1.7 (A:) Titin, kinase domain {Human (Homo s 2e-17
d1itxa1347 c.1.8.5 (A:33-337,A:410-451) Chitinase A1 {Bacillu 2e-17
d1itxa1347 c.1.8.5 (A:33-337,A:410-451) Chitinase A1 {Bacillu 2e-07
d1t4ha_ 270 d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sa 1e-16
d1fgka_ 299 d.144.1.7 (A:) Fibroblast growth factor receptor 1 1e-16
d1omwa3 364 d.144.1.7 (A:186-549) G-protein coupled receptor k 1e-16
d1fota_ 316 d.144.1.7 (A:) cAMP-dependent PK, catalytic subuni 2e-16
d1q5ka_ 350 d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gs 6e-16
d1xjda_ 320 d.144.1.7 (A:) Protein kinase C, theta type {Human 1e-15
d1gz8a_ 298 d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (H 3e-15
d1xkka_ 317 d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb- 6e-15
d1phka_ 277 d.144.1.7 (A:) gamma-subunit of glycogen phosphory 8e-15
d1ua2a_ 299 d.144.1.7 (A:) Cell division protein kinase 7, CDK 1e-14
d1unla_ 292 d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (H 1e-14
d1xwsa_ 273 d.144.1.7 (A:) Proto-oncogene serine/threonine-pro 1e-14
d1ywna1 299 d.144.1.7 (A:818-1166) Vascular endothelial growth 2e-14
d1ckia_ 299 d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus n 7e-14
d3bqca1 328 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subu 9e-14
d1cm8a_ 346 d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo s 1e-13
d1nara_289 c.1.8.5 (A:) Seed storage protein {Vicia narbonens 2e-13
d3blha1 318 d.144.1.7 (A:8-325) Cell division protein kinase 9 2e-13
d2gfsa1 348 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sa 2e-13
d1csna_ 293 d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast 5e-13
d2b1pa1 355 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3 6e-13
d1vzoa_ 322 d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5 1e-12
d1blxa_ 305 d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (H 2e-12
d1edta_265 c.1.8.5 (A:) Endo-beta-N-acetylglucosaminidase {St 2e-12
d1rdqe_ 350 d.144.1.7 (E:) cAMP-dependent PK, catalytic subuni 2e-12
d1o6la_ 337 d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sap 3e-12
d2ozaa1 335 d.144.1.7 (A:51-385) MAP kinase activated protein 7e-12
d2ebna_285 c.1.8.5 (A:) Endo-beta-N-acetylglucosaminidase {Fl 1e-11
d1q8ya_ 362 d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces 4e-10
d1zara2191 d.144.1.9 (A:91-281) Rio2 serine protein kinase C- 1e-09
d1vf8a270 d.26.3.1 (A:246-315) Chitinase-like lectin ym1 {Mo 2e-08
d2hvma_273 c.1.8.5 (A:) Hevamine A (chitinase/lysozyme) {Para 2e-06
d1itxa272 d.26.3.1 (A:338-409) Chitinase A1 {Bacillus circul 3e-06
d1wb0a268 d.26.3.1 (A:267-336) Chitotriosidase {Human (Homo 7e-06
d1edqa373 d.26.3.1 (A:444-516) Chitinase A {Serratia marcesc 1e-05
d1eoka_282 c.1.8.5 (A:) Endo-beta-N-acetylglucosaminidase {Fl 3e-05
d2pi6a268 d.26.3.1 (A:240-307) Signal processing protein (SP 4e-05
d1kfwa261 d.26.3.1 (A:328-388) Psychrophilic chitinase B {Ar 4e-05
d1ta3a_274 c.1.8.5 (A:) Xylanase inhibitor protein I, XIP-I { 4e-04
>d1goia2 c.1.8.5 (A:3-291,A:380-446) Chitinase B, catalytic domain {Serratia marcescens [TaxId: 615]} Length = 356 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: (Trans)glycosidases
family: Type II chitinase
domain: Chitinase B, catalytic domain
species: Serratia marcescens [TaxId: 615]
 Score =  127 bits (321), Expect = 4e-33
 Identities = 63/343 (18%), Positives = 117/343 (34%), Gaps = 55/343 (16%)

Query: 36  EVSTISGINYDLFTHLICSSADINSTTYQLSLSLPSDENQIAKFAD---TVKKKNPSITT 92
            VS I+       TH+  S  DINS     +    +++ +     +    +K  NPS+  
Sbjct: 30  PVSNITPAKAKQLTHINFSFLDINSNLE-CAWDPATNDAKARDVVNRLTALKAHNPSLRI 88

Query: 93  ILSIG-----QGKDTNYSIYSSMVRNSSHRKSFIDSSIRIARLYGFRGLDFAWTAPNTST 147
           + SIG          +++ Y + V+  + R  F  S +RI + YGF G++  W     + 
Sbjct: 89  MFSIGGWYYSNDLGVSHANYVNAVKTPASRAKFAQSCVRIMKDYGFDGVNIDWE-YPQAA 147

Query: 148 DMFNIGLLFDEWRIAATKLDAKNSTRQQSLLILTARFRYSPPANSYL--LNSIQRNLNWI 205
           ++        E R    +    +  +     +  A    +   + Y   L  I   L++I
Sbjct: 148 EVDGFIAALQEIRTLLNQQTITDGRQALPYQLTIAGAGGAFFLSRYYSKLAQIVAPLDYI 207

Query: 206 HAVTASYYEPVSTNFTAPPAALYGSISGRFARSTDQVLKAWIERGLSADKLVMCLPFYGY 265
           + +T     P     T   AAL+G  +G                        +     G+
Sbjct: 208 NLMTYDLAGPWE-KVTNHQAALFGDAAGP------------------TFYNALREANLGW 248

Query: 266 AWTLVKPEDNGIGAAAAGPALYDSGLVTYKKIKNHIKTYGPDVQVMYNSTYEVNYFSTGT 325
           +W  +        +     A           ++ H+   G                +   
Sbjct: 249 SWEELTRAFPSPFSLTVDAA-----------VQQHLMMEGV-------------PSAKIV 284

Query: 326 VWFGFDDVEAVRAKIAYAKEKRLLGYYAWQVSFDDHDWLLSQA 368
           +   FDD E+ + K  Y K+++L G   W +  D+ +  L  A
Sbjct: 285 MGVPFDDAESFKYKAKYIKQQQLGGVMFWHLGQDNRNGDLLAA 327


>d1vf8a1 c.1.8.5 (A:1-245,A:316-372) Chitinase-like lectin ym1, saccharide binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 302 Back     information, alignment and structure
>d1vf8a1 c.1.8.5 (A:1-245,A:316-372) Chitinase-like lectin ym1, saccharide binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 302 Back     information, alignment and structure
>d1w9pa1 c.1.8.5 (A:39-298,A:361-433) Chitinase 1 {Aspergillus fumigatus [TaxId: 5085]} Length = 333 Back     information, alignment and structure
>d2pi6a1 c.1.8.5 (A:1-239,A:308-361) Signal processing protein (SPC-40, MGP-40) {Sheep (Ovis aries) [TaxId: 9940]} Length = 292 Back     information, alignment and structure
>d2pi6a1 c.1.8.5 (A:1-239,A:308-361) Signal processing protein (SPC-40, MGP-40) {Sheep (Ovis aries) [TaxId: 9940]} Length = 292 Back     information, alignment and structure
>d1ll7a1 c.1.8.5 (A:36-292,A:355-427) Chitinase 1 {Fungus (Coccidioides immitis) [TaxId: 5501]} Length = 330 Back     information, alignment and structure
>d1wb0a1 c.1.8.5 (A:22-266,A:337-388) Chitotriosidase {Human (Homo sapiens) [TaxId: 9606]} Length = 297 Back     information, alignment and structure
>d1wb0a1 c.1.8.5 (A:22-266,A:337-388) Chitotriosidase {Human (Homo sapiens) [TaxId: 9606]} Length = 297 Back     information, alignment and structure
>d1edqa2 c.1.8.5 (A:133-443,A:517-563) Chitinase A, catalytic domain {Serratia marcescens [TaxId: 615]} Length = 358 Back     information, alignment and structure
>d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Length = 263 Back     information, alignment and structure
>d1jnda1 c.1.8.5 (A:2-278,A:371-420) Imaginal disc growth factor-2 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 327 Back     information, alignment and structure
>d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Length = 258 Back     information, alignment and structure
>d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Length = 272 Back     information, alignment and structure
>d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 Back     information, alignment and structure
>d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 301 Back     information, alignment and structure
>d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 276 Back     information, alignment and structure
>d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 309 Back     information, alignment and structure
>d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Length = 287 Back     information, alignment and structure
>d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Length = 262 Back     information, alignment and structure
>d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 311 Back     information, alignment and structure
>d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Length = 299 Back     information, alignment and structure
>d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 308 Back     information, alignment and structure
>d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Length = 350 Back     information, alignment and structure
>d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 307 Back     information, alignment and structure
>d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Length = 352 Back     information, alignment and structure
>d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} Length = 303 Back     information, alignment and structure
>d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 325 Back     information, alignment and structure
>d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Length = 277 Back     information, alignment and structure
>d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} Length = 345 Back     information, alignment and structure
>d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 309 Back     information, alignment and structure
>d1kfwa1 c.1.8.5 (A:10-327,A:389-444) Psychrophilic chitinase B {Arthrobacter sp., tad20 [TaxId: 1667]} Length = 374 Back     information, alignment and structure
>d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 271 Back     information, alignment and structure
>d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 263 Back     information, alignment and structure
>d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Length = 311 Back     information, alignment and structure
>d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Length = 277 Back     information, alignment and structure
>d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} Length = 286 Back     information, alignment and structure
>d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Length = 269 Back     information, alignment and structure
>d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 283 Back     information, alignment and structure
>d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Length = 321 Back     information, alignment and structure
>d1itxa1 c.1.8.5 (A:33-337,A:410-451) Chitinase A1 {Bacillus circulans [TaxId: 1397]} Length = 347 Back     information, alignment and structure
>d1itxa1 c.1.8.5 (A:33-337,A:410-451) Chitinase A1 {Bacillus circulans [TaxId: 1397]} Length = 347 Back     information, alignment and structure
>d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 270 Back     information, alignment and structure
>d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Length = 364 Back     information, alignment and structure
>d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 316 Back     information, alignment and structure
>d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Length = 350 Back     information, alignment and structure
>d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Length = 320 Back     information, alignment and structure
>d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} Length = 298 Back     information, alignment and structure
>d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 317 Back     information, alignment and structure
>d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 277 Back     information, alignment and structure
>d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} Length = 292 Back     information, alignment and structure
>d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 299 Back     information, alignment and structure
>d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Length = 328 Back     information, alignment and structure
>d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} Length = 346 Back     information, alignment and structure
>d1nara_ c.1.8.5 (A:) Seed storage protein {Vicia narbonensis, Narbonin [TaxId: 3912]} Length = 289 Back     information, alignment and structure
>d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} Length = 318 Back     information, alignment and structure
>d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} Length = 348 Back     information, alignment and structure
>d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 293 Back     information, alignment and structure
>d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} Length = 355 Back     information, alignment and structure
>d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 Back     information, alignment and structure
>d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Length = 305 Back     information, alignment and structure
>d1edta_ c.1.8.5 (A:) Endo-beta-N-acetylglucosaminidase {Streptomyces plicatus, endoglycosidase H [TaxId: 1922]} Length = 265 Back     information, alignment and structure
>d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Length = 350 Back     information, alignment and structure
>d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Length = 335 Back     information, alignment and structure
>d2ebna_ c.1.8.5 (A:) Endo-beta-N-acetylglucosaminidase {Flavobacterium meningosepticum, endoglycosidase F1 [TaxId: 238]} Length = 285 Back     information, alignment and structure
>d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 362 Back     information, alignment and structure
>d1zara2 d.144.1.9 (A:91-281) Rio2 serine protein kinase C-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]} Length = 191 Back     information, alignment and structure
>d1vf8a2 d.26.3.1 (A:246-315) Chitinase-like lectin ym1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 70 Back     information, alignment and structure
>d2hvma_ c.1.8.5 (A:) Hevamine A (chitinase/lysozyme) {Para rubber tree (Hevea brasiliensis) [TaxId: 3981]} Length = 273 Back     information, alignment and structure
>d1itxa2 d.26.3.1 (A:338-409) Chitinase A1 {Bacillus circulans [TaxId: 1397]} Length = 72 Back     information, alignment and structure
>d1wb0a2 d.26.3.1 (A:267-336) Chitotriosidase {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure
>d1edqa3 d.26.3.1 (A:444-516) Chitinase A {Serratia marcescens [TaxId: 615]} Length = 73 Back     information, alignment and structure
>d1eoka_ c.1.8.5 (A:) Endo-beta-N-acetylglucosaminidase {Flavobacterium meningosepticum, endoglycosidase F3 [TaxId: 238]} Length = 282 Back     information, alignment and structure
>d2pi6a2 d.26.3.1 (A:240-307) Signal processing protein (SPC-40, MGP-40) {Sheep (Ovis aries) [TaxId: 9940]} Length = 68 Back     information, alignment and structure
>d1kfwa2 d.26.3.1 (A:328-388) Psychrophilic chitinase B {Arthrobacter sp., tad20 [TaxId: 1667]} Length = 61 Back     information, alignment and structure
>d1ta3a_ c.1.8.5 (A:) Xylanase inhibitor protein I, XIP-I {Wheat (Triticum aestivum) [TaxId: 4565]} Length = 274 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query580
d2pi6a1292 Signal processing protein (SPC-40, MGP-40) {Sheep 100.0
d1kfwa1374 Psychrophilic chitinase B {Arthrobacter sp., tad20 100.0
d1wb0a1297 Chitotriosidase {Human (Homo sapiens) [TaxId: 9606 100.0
d1itxa1347 Chitinase A1 {Bacillus circulans [TaxId: 1397]} 100.0
d1w9pa1333 Chitinase 1 {Aspergillus fumigatus [TaxId: 5085]} 100.0
d1edqa2358 Chitinase A, catalytic domain {Serratia marcescens 100.0
d1vf8a1302 Chitinase-like lectin ym1, saccharide binding doma 100.0
d1jnda1327 Imaginal disc growth factor-2 {Fruit fly (Drosophi 100.0
d1ll7a1330 Chitinase 1 {Fungus (Coccidioides immitis) [TaxId: 100.0
d1goia2356 Chitinase B, catalytic domain {Serratia marcescens 100.0
d1nara_289 Seed storage protein {Vicia narbonensis, Narbonin 99.97
d1edta_265 Endo-beta-N-acetylglucosaminidase {Streptomyces pl 99.95
d2hvma_273 Hevamine A (chitinase/lysozyme) {Para rubber tree 99.94
d2ebna_285 Endo-beta-N-acetylglucosaminidase {Flavobacterium 99.94
d1ta3a_274 Xylanase inhibitor protein I, XIP-I {Wheat (Tritic 99.92
d1cnva_283 Seed storage protein {Jack bean (Canavalia ensifor 99.91
d1sm2a_ 263 Tyrosine-protein kinase Itk/Tsk {Human (Homo sapie 99.79
d1opja_ 287 Abelsone tyrosine kinase (abl) {Mouse (Mus musculu 99.79
d1k2pa_ 258 Bruton's tyrosine kinase (Btk) {Human (Homo sapien 99.78
d2jfla1 288 STE20-like serine/threonine-protein kinase, SLK {H 99.78
d1nvra_ 271 Cell cycle checkpoint kinase chk1 {Human (Homo sap 99.78
d1yhwa1 293 pak1 {Human (Homo sapiens) [TaxId: 9606]} 99.78
d1qpca_ 272 Lymphocyte kinase (lck) {Human (Homo sapiens) [Tax 99.77
d1jksa_ 293 Death-associated protein kinase, Dap {Human (Homo 99.77
d1koaa2 350 Twitchin, kinase domain {Caenorhabditis elegans, p 99.76
d1uwha_ 276 B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} 99.76
d1eoka_282 Endo-beta-N-acetylglucosaminidase {Flavobacterium 99.76
d2j4za1 263 Aurora-related kinase 1 (aurora-2) {Human (Homo sa 99.76
d1u59a_ 285 Tyrosine-protein kinase ZAP-70 {Human (Homo sapien 99.76
d1jpaa_ 299 ephb2 receptor tyrosine kinase {Mouse (Mus musculu 99.76
d1s9ja_ 322 Dual specificity mitogen-activated protein kinase 99.75
d1a06a_ 307 Calmodulin-dependent protein kinase {Rat (Rattus n 99.75
d1koba_ 352 Twitchin, kinase domain {California sea hare (Aply 99.75
d2java1 269 Serine/threonine-protein kinase Nek2 {Human (Homo 99.75
d1fmka3 285 c-src tyrosine kinase {Human (Homo sapiens) [TaxId 99.75
d1tkia_ 321 Titin, kinase domain {Human (Homo sapiens) [TaxId: 99.74
d1t4ha_ 270 Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 99.74
d1uu3a_ 288 3-phosphoinositide dependent protein kinase-1 Pdk1 99.74
d1xbba_ 277 Tyrosine-protein kinase SYK {Human (Homo sapiens) 99.73
d1phka_ 277 gamma-subunit of glycogen phosphorylase kinase (Ph 99.73
d1u5ra_ 309 Serine/threonine protein kinase TAO2 {Rat (Rattus 99.73
d1byga_ 262 Carboxyl-terminal src kinase (csk) {Human (Homo sa 99.72
d1o6la_ 337 Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9 99.71
d1mqba_ 283 epha2 receptor tyrosine kinase {Human (Homo sapien 99.7
d1xjda_ 320 Protein kinase C, theta type {Human (Homo sapiens) 99.7
d1lufa_ 301 Musk tyrosine kinase {Rat (Rattus norvegicus) [Tax 99.7
d1rjba_ 325 Fl cytokine receptor {Human (Homo sapiens) [TaxId: 99.7
d1fvra_ 309 Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} 99.69
d1o6ya_ 277 Mycobacterial protein kinase PknB, catalytic domai 99.69
d1fota_ 316 cAMP-dependent PK, catalytic subunit {Baker's yeas 99.69
d1mp8a_ 273 Focal adhesion kinase 1 (fak) {Human (Homo sapiens 99.69
d1p4oa_ 308 Insulin-like growth factor 1 receptor {Human (Homo 99.68
d1t46a_ 311 c-KIT receptor {Human (Homo sapiens) [TaxId: 9606] 99.68
d1r0pa_ 311 Hepatocyte growth factor receptor, c-MET {Human (H 99.66
d1u46a_ 273 Activated CDC42 kinase 1, ACK1 {Human (Homo sapien 99.66
d1xkka_ 317 EGF receptor tyrosine kinase, Erbb-1 {Human (Homo 99.66
d1gz8a_ 298 Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [T 99.66
d1ob3a_ 286 Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) 99.65
d1rdqe_ 350 cAMP-dependent PK, catalytic subunit {Mouse (Mus m 99.65
d1omwa3 364 G-protein coupled receptor kinase 2 {Cow (Bos taur 99.65
d1fgka_ 299 Fibroblast growth factor receptor 1 {Human (Homo s 99.65
d2ozaa1 335 MAP kinase activated protein kinase 2, mapkap2 {Hu 99.64
d1vjya_ 303 Type I TGF-beta receptor R4 {Human (Homo sapiens) 99.64
d1ua2a_ 299 Cell division protein kinase 7, CDK7 {Human (Homo 99.63
d1ywna1 299 Vascular endothelial growth factor receptor 2 (kdr 99.62
d1unla_ 292 Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [T 99.61
d3bqca1 328 Protein kinase CK2, alpha subunit {Rattus norvegic 99.58
d1xwsa_ 273 Proto-oncogene serine/threonine-protein kinase Pim 99.57
d1pmea_ 345 MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606 99.56
d2gfsa1 348 MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606] 99.56
d1cm8a_ 346 MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 99.56
d1q5ka_ 350 Glycogen synthase kinase-3 beta (Gsk3b) {Human (Ho 99.55
d3blha1 318 Cell division protein kinase 9, CDK9 {Human (Homo 99.54
d1vzoa_ 322 Ribosomal protein S6 kinase alpha 5, Msk1 {Human ( 99.54
d2b1pa1 355 c-jun N-terminal kinase (jnk3s) {Human (Homo sapie 99.52
d1blxa_ 305 Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [T 99.48
d1csna_ 293 Casein kinase-1, CK1 {Fission yeast (Schizosacchar 99.43
d1ckia_ 299 Casein kinase-1, CK1 {Rat (Rattus norvegicus) [Tax 99.41
d1vf8a270 Chitinase-like lectin ym1 {Mouse (Mus musculus) [T 99.24
d1wb0a268 Chitotriosidase {Human (Homo sapiens) [TaxId: 9606 99.1
d1q8ya_ 362 Sky1p {Baker's yeast (Saccharomyces cerevisiae) [T 99.1
d2pi6a268 Signal processing protein (SPC-40, MGP-40) {Sheep 99.05
d1zara2191 Rio2 serine protein kinase C-terminal domain {Arch 98.91
d1itxa272 Chitinase A1 {Bacillus circulans [TaxId: 1397]} 98.65
d1edqa373 Chitinase A {Serratia marcescens [TaxId: 615]} 98.59
d1jnda292 Imaginal disc growth factor-2 {Fruit fly (Drosophi 98.53
d1kfwa261 Psychrophilic chitinase B {Arthrobacter sp., tad20 98.52
d1goia388 Chitinase B {Serratia marcescens [TaxId: 615]} 97.39
d1w9pa262 Chitinase 1 {Aspergillus fumigatus [TaxId: 5085]} 97.09
d1ll7a262 Chitinase 1 {Fungus (Coccidioides immitis) [TaxId: 97.08
d1j7la_ 263 Type IIIa 3',5"-aminoglycoside phosphotransferase 95.76
d1nd4a_ 255 Aminoglycoside 3'-phosphotransferase IIa (Kanamyci 89.15
d2bhua3420 Glycosyltrehalose trehalohydrolase, central domain 82.45
>d2pi6a1 c.1.8.5 (A:1-239,A:308-361) Signal processing protein (SPC-40, MGP-40) {Sheep (Ovis aries) [TaxId: 9940]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: (Trans)glycosidases
family: Type II chitinase
domain: Signal processing protein (SPC-40, MGP-40)
species: Sheep (Ovis aries) [TaxId: 9940]
Probab=100.00  E-value=3.1e-54  Score=424.12  Aligned_cols=259  Identities=25%  Similarity=0.355  Sum_probs=218.0

Q ss_pred             EEEEEecCCC-------CCcCCCCCCCCCcEEEEeeEEeeCCceEEeeCCCccHHHHHHHHHHHHhhCCCceEEEEecCC
Q 008036           27 IRVGYLNLSE-------VSTISGINYDLFTHLICSSADINSTTYQLSLSLPSDENQIAKFADTVKKKNPSITTILSIGQG   99 (580)
Q Consensus        27 ~~vgY~~~~~-------~~~~~~i~~~~~thii~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~lk~~~~~~kvllsigg~   99 (580)
                      ++||||+.|+       .+.+++||+++||||+|+|+.+++++.  ......+...+.++ .+||+++|++|+++|||||
T Consensus         2 kvv~Yy~~w~~~r~~~~~~~~~~i~~~~~THiiyafa~i~~~~~--~~~~~~~~~~~~~~-~~lk~~~~~lKvllSvGG~   78 (292)
T d2pi6a1           2 KLICYYTSWSQYREGDGSCFPDAIDPFLCTHVIYTFANISNNEI--DTWEWNDVTLYDTL-NTLKNRNPKLKTLLSVGGW   78 (292)
T ss_dssp             EEEEEEEGGGGGSSGGGCCCGGGSCTTTCSEEEEEEEEEETTEE--ECCSTTHHHHHHHH-HHHHHHCTTCEEEEEEETT
T ss_pred             eEEEEEccccccCCCCCCCChhHCCcccCCEEEEEEEEecCCCc--eecccccHHHHHHH-HHHHhhCCCceEEEEEecc
Confidence            7899999985       357899999999999999999998753  22323334455555 5699999999999999998


Q ss_pred             CCcccccccccccChhHHHHHHHHHHHHHHHcCCCeeeeeecCCCCCCCCchhhhhHHHHHHHHhhhhhhccccccceEE
Q 008036          100 KDTNYSIYSSMVRNSSHRKSFIDSSIRIARLYGFRGLDFAWTAPNTSTDMFNIGLLFDEWRIAATKLDAKNSTRQQSLLI  179 (580)
Q Consensus       100 ~~~~~~~f~~~~~~~~~r~~fi~~i~~~~~~~~~DGidiDwE~p~~~~~~~~~~~~~~~l~~~l~~~~~~~~~~~~~~~~  179 (580)
                      +. ++..|+.+++++++|++||+++++++++|+|||||||||||+ .+++.+|+.|++++|.+|.+.....    ...+.
T Consensus        79 ~~-~~~~fs~~~~~~~~r~~fi~si~~~l~~~~fDGiDiDwE~p~-~~~~~~~~~l~~~lr~~l~~~~~~~----~~~~~  152 (292)
T d2pi6a1          79 NF-GPERFSKIASKTQSRRTFIKSVPPFLRTHGFDGLDLAWLYPG-RRDKRHLTTLVKEMKAEFIREAQAG----TEQLL  152 (292)
T ss_dssp             TS-CHHHHHHHHTSHHHHHHHHHHHHHHHHHHTCSEEEEECSCCC-GGGHHHHHHHHHHHHHHHHHHHTTS----SCCCE
T ss_pred             cc-CchHHHHHhccHHHHHHHHHHHHHHHHhcCCCeEEEeccccc-cccccccchhHHHHHHHHHHHHhcc----CCCcc
Confidence            65 556799999999999999999999999999999999999994 5788899999999999998654332    23345


Q ss_pred             EEeecccCCC--CCccchHHHhhhcceeeeeeccCcCCCCCCCCCCCCCCCCCCCCC--CccCHHHHHHHHHHcCCCCCc
Q 008036          180 LTARFRYSPP--ANSYLLNSIQRNLNWIHAVTASYYEPVSTNFTAPPAALYGSISGR--FARSTDQVLKAWIERGLSADK  255 (580)
Q Consensus       180 ~~~~~~~~~~--~~~~~~~~l~~~vD~i~vm~yd~~~~~~~~~~~~~a~l~~~~~~~--~~~~v~~~v~~~~~~gvp~~K  255 (580)
                      ++++++..+.  ...|++.++.+++||||+|+||++++|. ..++|+||++......  ...+++.+|++|++.|+|++|
T Consensus       153 ~s~~~~~~~~~~~~~~~~~~l~~~vD~invMtYD~~g~~~-~~~g~~apL~~~~~~~~~~~~~v~~~v~~~~~~Gvp~~K  231 (292)
T d2pi6a1         153 LSAAVSAGKIAIDRGYDIAQISRHLDFISLLTYDFHGAWR-QTVGHHSPLFRGNEDASSRFSNADYAVSYMLRLGAPANK  231 (292)
T ss_dssp             EEEEEECCHHHHHHHCCHHHHHHHCSEEEEETTCCSCTTC-CBCCCSSCSSCCSSSCSCTTSSHHHHHHHHHHTTCCGGG
T ss_pred             eecccCchhhHHhccccHHHHHhhCCEEEEecccccCCCC-CccccCCCCCCCCcccCcCCccHHHHHHHHHHCCCCHHH
Confidence            5555544432  3579999999999999999999999986 4699999998665432  245899999999999999999


Q ss_pred             eeEeccccceeeeecCCCCCCCCCCCCCCCCCCCccccHHHHHHHhhhcCCCeEEeecCceeEEEeecCCEEEecCCHHH
Q 008036          256 LVMCLPFYGYAWTLVKPEDNGIGAAAAGPALYDSGLVTYKKIKNHIKTYGPDVQVMYNSTYEVNYFSTGTVWFGFDDVEA  335 (580)
Q Consensus       256 l~lGip~yG~~~~~~~~~~~~~~~~~~g~~~~~~g~~~y~~i~~~~~~~~~~~~~~~d~~~~~~~~~~~~~wi~ydd~~S  335 (580)
                      |+||||                                                                    |||++|
T Consensus       232 lvlGip--------------------------------------------------------------------ydd~~S  243 (292)
T d2pi6a1         232 LVMGIP--------------------------------------------------------------------TDDQES  243 (292)
T ss_dssp             EEEEEE--------------------------------------------------------------------SCCHHH
T ss_pred             eEEEec--------------------------------------------------------------------CCCHHH
Confidence            999986                                                                    799999


Q ss_pred             HHHHHHHhhhcCCceEEEEEeccCCchh
Q 008036          336 VRAKIAYAKEKRLLGYYAWQVSFDDHDW  363 (580)
Q Consensus       336 i~~K~~~~~~~gLgGv~~W~l~~Dd~~~  363 (580)
                      ++.|++|++++||||+|+|++++||+..
T Consensus       244 i~~K~~~~~~~~lgGv~iW~l~~DD~~G  271 (292)
T d2pi6a1         244 VKNKARYLKNRQLAGAMVWALDLDDFRG  271 (292)
T ss_dssp             HHHHHHHHHHTTCSEEEEECGGGSCSSS
T ss_pred             HHHHHHHHHHCCCceEEEEecccccCCC
Confidence            9999999999999999999999999874



>d1kfwa1 c.1.8.5 (A:10-327,A:389-444) Psychrophilic chitinase B {Arthrobacter sp., tad20 [TaxId: 1667]} Back     information, alignment and structure
>d1wb0a1 c.1.8.5 (A:22-266,A:337-388) Chitotriosidase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1itxa1 c.1.8.5 (A:33-337,A:410-451) Chitinase A1 {Bacillus circulans [TaxId: 1397]} Back     information, alignment and structure
>d1w9pa1 c.1.8.5 (A:39-298,A:361-433) Chitinase 1 {Aspergillus fumigatus [TaxId: 5085]} Back     information, alignment and structure
>d1edqa2 c.1.8.5 (A:133-443,A:517-563) Chitinase A, catalytic domain {Serratia marcescens [TaxId: 615]} Back     information, alignment and structure
>d1vf8a1 c.1.8.5 (A:1-245,A:316-372) Chitinase-like lectin ym1, saccharide binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jnda1 c.1.8.5 (A:2-278,A:371-420) Imaginal disc growth factor-2 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ll7a1 c.1.8.5 (A:36-292,A:355-427) Chitinase 1 {Fungus (Coccidioides immitis) [TaxId: 5501]} Back     information, alignment and structure
>d1goia2 c.1.8.5 (A:3-291,A:380-446) Chitinase B, catalytic domain {Serratia marcescens [TaxId: 615]} Back     information, alignment and structure
>d1nara_ c.1.8.5 (A:) Seed storage protein {Vicia narbonensis, Narbonin [TaxId: 3912]} Back     information, alignment and structure
>d1edta_ c.1.8.5 (A:) Endo-beta-N-acetylglucosaminidase {Streptomyces plicatus, endoglycosidase H [TaxId: 1922]} Back     information, alignment and structure
>d2hvma_ c.1.8.5 (A:) Hevamine A (chitinase/lysozyme) {Para rubber tree (Hevea brasiliensis) [TaxId: 3981]} Back     information, alignment and structure
>d2ebna_ c.1.8.5 (A:) Endo-beta-N-acetylglucosaminidase {Flavobacterium meningosepticum, endoglycosidase F1 [TaxId: 238]} Back     information, alignment and structure
>d1ta3a_ c.1.8.5 (A:) Xylanase inhibitor protein I, XIP-I {Wheat (Triticum aestivum) [TaxId: 4565]} Back     information, alignment and structure
>d1cnva_ c.1.8.5 (A:) Seed storage protein {Jack bean (Canavalia ensiformis), Concanavalin B [TaxId: 3823]} Back     information, alignment and structure
>d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Back     information, alignment and structure
>d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1eoka_ c.1.8.5 (A:) Endo-beta-N-acetylglucosaminidase {Flavobacterium meningosepticum, endoglycosidase F3 [TaxId: 238]} Back     information, alignment and structure
>d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Back     information, alignment and structure
>d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1vf8a2 d.26.3.1 (A:246-315) Chitinase-like lectin ym1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wb0a2 d.26.3.1 (A:267-336) Chitotriosidase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2pi6a2 d.26.3.1 (A:240-307) Signal processing protein (SPC-40, MGP-40) {Sheep (Ovis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1zara2 d.144.1.9 (A:91-281) Rio2 serine protein kinase C-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1itxa2 d.26.3.1 (A:338-409) Chitinase A1 {Bacillus circulans [TaxId: 1397]} Back     information, alignment and structure
>d1edqa3 d.26.3.1 (A:444-516) Chitinase A {Serratia marcescens [TaxId: 615]} Back     information, alignment and structure
>d1jnda2 d.26.3.1 (A:279-370) Imaginal disc growth factor-2 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1kfwa2 d.26.3.1 (A:328-388) Psychrophilic chitinase B {Arthrobacter sp., tad20 [TaxId: 1667]} Back     information, alignment and structure
>d1goia3 d.26.3.1 (A:292-379) Chitinase B {Serratia marcescens [TaxId: 615]} Back     information, alignment and structure
>d1w9pa2 d.26.3.1 (A:299-360) Chitinase 1 {Aspergillus fumigatus [TaxId: 5085]} Back     information, alignment and structure
>d1ll7a2 d.26.3.1 (A:293-354) Chitinase 1 {Fungus (Coccidioides immitis) [TaxId: 5501]} Back     information, alignment and structure
>d1j7la_ d.144.1.6 (A:) Type IIIa 3',5"-aminoglycoside phosphotransferase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1nd4a_ d.144.1.6 (A:) Aminoglycoside 3'-phosphotransferase IIa (Kanamycin kinase) {Bacteria (Klebsiella pneumoniae) [TaxId: 573]} Back     information, alignment and structure
>d2bhua3 c.1.8.1 (A:111-530) Glycosyltrehalose trehalohydrolase, central domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure