BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 008054
         (579 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1NKQ|A Chain A, Crystal Structure Of Yeast Ynq8, A Fumarylacetoacetate
           Hydrolase Family Protein
 pdb|1NKQ|B Chain B, Crystal Structure Of Yeast Ynq8, A Fumarylacetoacetate
           Hydrolase Family Protein
 pdb|1NKQ|C Chain C, Crystal Structure Of Yeast Ynq8, A Fumarylacetoacetate
           Hydrolase Family Protein
 pdb|1NKQ|D Chain D, Crystal Structure Of Yeast Ynq8, A Fumarylacetoacetate
           Hydrolase Family Protein
 pdb|1NKQ|E Chain E, Crystal Structure Of Yeast Ynq8, A Fumarylacetoacetate
           Hydrolase Family Protein
 pdb|1NKQ|F Chain F, Crystal Structure Of Yeast Ynq8, A Fumarylacetoacetate
           Hydrolase Family Protein
          Length = 259

 Score = 30.4 bits (67), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 17/55 (30%), Positives = 30/55 (54%), Gaps = 1/55 (1%)

Query: 270 AERIRQVQQSSARQPSTYVLPTPIDAKVPISSSVAPRTRPSNPSGRTYNLSHSSP 324
           A  I+++  S+ +QP  ++ PT      P+SSS+   TRP+N +    N   ++P
Sbjct: 20  AAHIKELNNSTPKQPFFFLKPTS-SIVTPLSSSLVKTTRPANSTFNGLNEDGTNP 73


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.311    0.126    0.348 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 14,128,310
Number of Sequences: 62578
Number of extensions: 500497
Number of successful extensions: 803
Number of sequences better than 100.0: 10
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 9
Number of HSP's that attempted gapping in prelim test: 802
Number of HSP's gapped (non-prelim): 10
length of query: 579
length of database: 14,973,337
effective HSP length: 104
effective length of query: 475
effective length of database: 8,465,225
effective search space: 4020981875
effective search space used: 4020981875
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 54 (25.4 bits)