Citrus Sinensis ID: 008107


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------
MAVQYTAVFPLPFSTSRLIDAFVLILSIFLTLSLVQCTTDSSDVQALQVLYTSLNSPSVLTNWKGNEGDPCGESWKGVACEGSAVVSIDISGLGLSGTMGYLLSDLLSLRKFDLSGNSIHDTIPYQLPPNLTSLNLASNNFSGNLPYSIASMVSLSYLNVSRNSLTQSIGDIFGNLAGLATLDLSFNNFSGDLPNSFISLSNISSLYLQNNQVTGSLNVFSGLPLTTLNVANNHFSGWIPRELISIRTFIYDGNSFDNGPAPPPPPSTAPPSGRSHNNRSHRQGSHSPSGSQSSSSDKELPAGAIVGIVLGAVFLVALALLALYFCIRKNRRKVSGARSSAGSFPVSTNNMNTEMHEQRVKSVAAVTDLTPPPAEKLVIERVAKSGSLKKIKSPITATSYTVASLQTATNSFSQEFLIGEGSLGRVYRAEFANGKIMAVKKIDNAALSLQEEDNFLEAVSNMSRLRHPNIVTLAGYCAEHGQRLLVYEYVGNGNLHDMLHFADDSSKNLTWNARVRVALGTARALEYLHEVCLPSVVHRNFKSANILLDDELNPHLSDCGLAALTPNTERQVITGTS
cccccccccccccccHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHccccccccccccccccccccccccEEEcccccEEEEEEcccccEEEccccccccccccEEEcccccccccccccccccccEEEcccccccccccccccccccccEEccccccccccccccccccccccEEEcccccccccccHHHHccccccEEEcccccccccccccccccccEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccHHHHHHHcccccccccccccccHHHHHHHHccccccEEEcccccccccHHHHHHHHcccccccEEcccccccEEEEEEccccEEEEEEEcccccccccHHHHHHHHHHHccccccccccccEEEEcccEEEEEEcccccccHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHccccccccccccccccEEEcccccEEEccccccccccccccEEEEEcc
cccHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHcccccccccccccccccccccccEEEEccccEEEEEEccccccccccHHHccccccEEEEcccccccccccHHHHHcccEEEcccccccccccHHHHccccccEEEcccccccccccHHHcccccccEEEcccccccccccHHHcccccccEEEcccccccccccHHHcccccEEEcccccccccccHHHccccccEEEEcccccccccccccccccccccEEccccccccccccccccccccccccccccEEEEHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccHccEEEEEEEEHHHHHcccccccccccccccccccccccccccccccccccHHHHHHHHccccHHHEEccccccEEEEEEcccccEEEEEEcccccccccccHHHHHHHHHHHcccccccEEEEEEEcccccEEEEEEccccccHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHcccccEEEcccccccEEccccccccHcHccHHHHccccccccEEEcc
mavqytavfplpfstsRLIDAFVLILSIFLTLSLVqcttdssdvQALQVLYTslnspsvltnwkgnegdpcgeswkgvacegsavvsidisglglsgTMGYLLSDLLslrkfdlsgnsihdtipyqlppnltslnlasnnfsgnlpySIASMVSLSYLNVSRNSLTQSIGDIFGNLAGLATLdlsfnnfsgdlpnsfisLSNISSlylqnnqvtgslnvfsglplttlnvannhfsgwipreLISIRTfiydgnsfdngpapppppstappsgrshnnrshrqgshspsgsqssssdkelpagaIVGIVLGAVFLVALALLALYFCIRKnrrkvsgarssagsfpvstnnmnteMHEQRVKSVAavtdltpppaekLVIERVAKsgslkkikspitatSYTVASLQTATNSFSQEfligegslgrvyraefangkIMAVKKIDNAALSLQEEDNFLEAVSNmsrlrhpnivTLAGYCAEHGQRLLVYEYVGNGNLHDMLHFaddssknltwNARVRVALGTARALEYLHEVclpsvvhrnfksanillddelnphlsdcglaaltpnterqvitgts
MAVQYTAVFPLPFSTSRLIDAFVLILSIFLTLSLVQCTTDSSDVQALQVLYTSLNSPSVLTNWKGNEGDPCGESWKGVACEGSAVVSIDISGLGLSGTMGYLLSDLLSLRKFDLSGNSIHDTIPYQLPPNLTSLNLASNNFSGNLPYSIASMVSLSYLNVSRNSLTQSIGDIFGNLAGLATLDLSFNNFSGDLPNSFISLSNISSLYLQNNQVTGSLNVFSGLPLTTLNVANNHFSGWIPRELISIRTFIYDGNSFDNGPAPPPPPSTAPPSGRSHNNRSHRqgshspsgsqssssDKELPAGAIVGIVLGAVFLVALALLALYFCIRKNRRkvsgarssagsfpvstnnmntEMHEQRVKSVAavtdltpppaekLVIERVaksgslkkikspitaTSYTVASLQTATNSFSQEFLIGEGSLGRVYRAEFANGKIMAVKKIDNAALSLQEEDNFLEAVSNMSRLRHPNIVTLAGYCAEHGQRLLVYEYVGNGNLHDMLHFADDSSKNLTWNARVRVALGTARALEYLHEVCLPSVVHRNFKSANILLDDELNPHLSDCGlaaltpnterqvitgts
MAVQYTAVFPLPFSTSRLIDAFVLILSIFLTLSLVQCTTDSSDVQALQVLYTSLNSPSVLTNWKGNEGDPCGESWKGVACEGSAVVSIDISGLGLSGTMGYLLSDLLSLRKFDLSGNSIHDTIPYQLPPNLTSLNLASNNFSGNLPYSIASMVSLSYLNVSRNSLTQSIGDIFGNLAGLATLDLSFNNFSGDlpnsfislsnisslylqnnQVTGSLNVFSGLPLTTLNVANNHFSGWIPRELISIRTFIYDGNSFDNGpapppppstappsGRSHNNrshrqgshspsgsqssssDKELPAGAivgivlgavflvalallalYFCIRKNRRKVSGARSSAGSFPVSTNNMNTEMHEQRVKSVAAVTDLTPPPAEKLVIERVAKSGSLKKIKSPITATSYTVASLQTATNSFSQEFLIGEGSLGRVYRAEFANGKIMAVKKIDNAALSLQEEDNFLEAVSNMSRLRHPNIVTLAGYCAEHGQRLLVYEYVGNGNLHDMLHFADDSSKNLTWNARVRVALGTARALEYLHEVCLPSVVHRNFKSANILLDDELNPHLSDCGLAALTPNTERQVITGTS
***QYTAVFPLPFSTSRLIDAFVLILSIFLTLSLVQCTTDSSDVQALQVLYTSLNSPSVLTNWKGNEGDPCGESWKGVACEGSAVVSIDISGLGLSGTMGYLLSDLLSLRKFDLSGNSIHDTIPYQLPPNLTSLNLASNNFSGNLPYSIASMVSLSYLNVSRNSLTQSIGDIFGNLAGLATLDLSFNNFSGDLPNSFISLSNISSLYLQNNQVTGSLNVFSGLPLTTLNVANNHFSGWIPRELISIRTFIYDG************************************************AGAIVGIVLGAVFLVALALLALYFCIRK************************************************VI***********IKSPITATSYTVASLQTATNSFSQEFLIGEGSLGRVYRAEFANGKIMAVKKIDNAALSLQEEDNFLEAVSNMSRLRHPNIVTLAGYCAEHGQRLLVYEYVGNGNLHDMLHFADDSSKNLTWNARVRVALGTARALEYLHEVCLPSVVHRNFKSANILLDDELNPHLSDCGLAAL*************
**********LPFSTSRLIDAFVLILSIFLTLSLVQCTTDSSDVQALQVLYTSLNSPSVLTNWKGNEGDPCGESWKGVACEGSAVVSIDISGLGLSGTMGYLLSDLLSLRKFDLSGNSIHDTIPYQLPPNLTSLNLASNNFSGNLPYSIASMVSLSYLNVSRNSLTQSIGDIFGNLAGLATLDLSFNNFSGDLPNSFISLSNISSLYLQNNQVTGSLNVFSGLPLTTLNVANNHFSGWIPRELISIRTFIYDGNSFDN***********************************************VGIVLGAVFLVALALLALYFCIR*****************************************************************PITATSYTVASLQTATNSFSQEFLIGEGSLGRVYRAEFANGKIMAVKKID***********FLEAVSNMSRLRHPNIVTLAGYCAEHGQRLLVYEYVGNGNLHDMLHFADDSSKNLTWNARVRVALGTARALEYLHEVCLPSVVHRNFKSANILLDDELNPHLSDCGLAALTP***********
MAVQYTAVFPLPFSTSRLIDAFVLILSIFLTLSLVQCTTDSSDVQALQVLYTSLNSPSVLTNWKGNEGDPCGESWKGVACEGSAVVSIDISGLGLSGTMGYLLSDLLSLRKFDLSGNSIHDTIPYQLPPNLTSLNLASNNFSGNLPYSIASMVSLSYLNVSRNSLTQSIGDIFGNLAGLATLDLSFNNFSGDLPNSFISLSNISSLYLQNNQVTGSLNVFSGLPLTTLNVANNHFSGWIPRELISIRTFIYDGNSFDNGP***************************************LPAGAIVGIVLGAVFLVALALLALYFCIRKNRR**********SFPVSTNNMNTEMHEQRVKSVAAVTDLTPPPAEKLVIERVAKSGSLKKIKSPITATSYTVASLQTATNSFSQEFLIGEGSLGRVYRAEFANGKIMAVKKIDNAALSLQEEDNFLEAVSNMSRLRHPNIVTLAGYCAEHGQRLLVYEYVGNGNLHDMLHFADDSSKNLTWNARVRVALGTARALEYLHEVCLPSVVHRNFKSANILLDDELNPHLSDCGLAALTPNTERQVITGTS
*AVQYTAVFPLPFSTSRLIDAFVLILSIFLTLSLVQCTTDSSDVQALQVLYTSLNSPSVLTNWKGNEGDPCGESWKGVACEGSAVVSIDISGLGLSGTMGYLLSDLLSLRKFDLSGNSIHDTIPYQLPPNLTSLNLASNNFSGNLPYSIASMVSLSYLNVSRNSLTQSIGDIFGNLAGLATLDLSFNNFSGDLPNSFISLSNISSLYLQNNQVTGSLNVFSGLPLTTLNVANNHFSGWIPRELISIRTFIYDGNSFDNGPAPPPPPSTAPPSGRSHNNRSHRQGSHSPSGSQSSSSDKELPAGAIVGIVLGAVFLVALALLALYFCIRKNR************FPVSTNNMNTEMHEQRVKSVAAVTDLTP*****************KKIKSPITATSYTVASLQTATNSFSQEFLIGEGSLGRVYRAEFANGKIMAVKKIDNAA**LQEEDNFLEAVSNMSRLRHPNIVTLAGYCAEHGQRLLVYEYVGNGNLHDMLHFADDSSKNLTWNARVRVALGTARALEYLHEVCLPSVVHRNFKSANILLDDELNPHLSDCGLAALTPN**********
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAVQYTAVFPLPFSTSRLIDAFVLILSIFLTLSLVQCTTDSSDVQALQVLYTSLNSPSVLTNWKGNEGDPCGESWKGVACEGSAVVSIDISGLGLSGTMGYLLSDLLSLRKFDLSGNSIHDTIPYQLPPNLTSLNLASNNFSGNLPYSIASMVSLSYLNVSRNSLTQSIGDIFGNLAGLATLDLSFNNFSGDLPNSFISLSNISSLYLQNNQVTGSLNVFSGLPLTTLNVANNHFSGWIPRELISIRTFIYDGNSFDNGPAPPPPPSTAPPSGRSHNNRSHRQGSHSPSGSQSSSSDKELPAGAIVGIVLGAVFLVALALLALYFCIRKNRRKVSGARSSAGSFPVSTNNMNTEMHEQRVKSVAAVTDLTPPPAEKLVIERVAKSGSLKKIKSPITATSYTVASLQTATNSFSQEFLIGEGSLGRVYRAEFANGKIMAVKKIDNAALSLQEEDNFLEAVSNMSRLRHPNIVTLAGYCAEHGQRLLVYEYVGNGNLHDMLHFADDSSKNLTWNARVRVALGTARALEYLHEVCLPSVVHRNFKSANILLDDELNPHLSDCGLAALTPNTERQVITGTS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query577 2.2.26 [Sep-21-2011]
Q6R2J8 703 Protein STRUBBELIG-RECEPT yes no 0.941 0.772 0.699 0.0
Q9C8M9 719 Protein STRUBBELIG-RECEPT no no 0.942 0.756 0.459 1e-128
Q9LUL4 717 Protein STRUBBELIG-RECEPT no no 0.951 0.765 0.444 1e-124
Q6R2K1 699 Protein STRUBBELIG-RECEPT no no 0.941 0.776 0.405 1e-121
Q6R2K2 687 Protein STRUBBELIG-RECEPT no no 0.937 0.787 0.411 1e-111
Q9FG24 735 Protein STRUBBELIG-RECEPT no no 0.927 0.727 0.393 1e-104
Q06BH3 775 Protein STRUBBELIG-RECEPT no no 0.927 0.690 0.410 1e-101
Q6R2K3 776 Protein STRUBBELIG-RECEPT no no 0.317 0.235 0.586 2e-57
Q9LYN8 1192 Leucine-rich repeat recep no no 0.805 0.390 0.306 4e-50
C0LGQ5 1249 LRR receptor-like serine/ no no 0.696 0.321 0.326 4e-50
>sp|Q6R2J8|SRF8_ARATH Protein STRUBBELIG-RECEPTOR FAMILY 8 OS=Arabidopsis thaliana GN=SRF8 PE=2 SV=1 Back     alignment and function desciption
 Score =  768 bits (1984), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 393/562 (69%), Positives = 448/562 (79%), Gaps = 19/562 (3%)

Query: 21  AFVLILSIFLT----LSLVQCTTDSSDVQALQVLYTSLNSPSVLTNWKGNEGDPCGESWK 76
           A   +L +F+      S+V+C TD SDVQALQVLYTSLNSPS LTNWK   GDPCGESWK
Sbjct: 7   AMFTVLLLFIASISGFSVVRCVTDPSDVQALQVLYTSLNSPSQLTNWKNGGGDPCGESWK 66

Query: 77  GVACEGSAVVSIDISGLGLSGTMGYLLSDLLSLRKFDLSGNSIHDTIPYQLPPNLTSLNL 136
           G+ CEGSAVV+IDIS LG+SGT+GYLLSDL SLRK D+SGNSIHDT+PYQLPPNLTSLNL
Sbjct: 67  GITCEGSAVVTIDISDLGVSGTLGYLLSDLKSLRKLDVSGNSIHDTLPYQLPPNLTSLNL 126

Query: 137 ASNNFSGNLPYSIASMVSLSYLNVSRNSLTQSIGDIFGNLAGLATLDLSFNNFSGDLPNS 196
           A NN SGNLPYSI++M SLSY+NVS NSLT SIGDIF +   LATLDLS NNFSGDLP+S
Sbjct: 127 ARNNLSGNLPYSISAMGSLSYMNVSGNSLTMSIGDIFADHKSLATLDLSHNNFSGDLPSS 186

Query: 197 FISLSNISSLYLQNNQVTGSLNVFSGLPLTTLNVANNHFSGWIPRELISIRTFIYDGNSF 256
             ++S +S LY+QNNQ+TGS++V SGLPL TLNVANNHF+G IP+EL SI+T IYDGNSF
Sbjct: 187 LSTVSTLSVLYVQNNQLTGSIDVLSGLPLKTLNVANNHFNGSIPKELSSIQTLIYDGNSF 246

Query: 257 DNGPAPPPPPSTAPPSGRSHNNRSHRQGSHSPS-GSQSSSSD--KELPAGAIVGIVLGAV 313
           DN PA P P             +    GS  P  GS+  SSD  K L  G + GIV G++
Sbjct: 247 DNVPASPQPERPG--------KKETPSGSKKPKIGSEEKSSDSGKGLSGGVVTGIVFGSL 298

Query: 314 FLVALALLALYFCIRKNRRKVSGA-RSSAGSFPVSTNNMNTEMHEQRVKSVAAVTDLTPP 372
           F+  +  L LY C+ K +RKV G+ R+S  S P+S      E+ EQRVKSVA+V DL   
Sbjct: 299 FVAGIIALVLYLCLHKKKRKVRGSTRASQRSLPLSGT---PEVQEQRVKSVASVADLKSS 355

Query: 373 PAEKLVIERVAKSGSLKKIKSPITATSYTVASLQTATNSFSQEFLIGEGSLGRVYRAEFA 432
           PAEK+ ++RV K+GS+ +I+SPITA+ YTV+SLQ ATNSFSQE +IGEGSLGRVYRAEF 
Sbjct: 356 PAEKVTVDRVMKNGSISRIRSPITASQYTVSSLQVATNSFSQENIIGEGSLGRVYRAEFP 415

Query: 433 NGKIMAVKKIDNAALSLQEEDNFLEAVSNMSRLRHPNIVTLAGYCAEHGQRLLVYEYVGN 492
           NGKIMA+KKIDNAALSLQEEDNFLEAVSNMSRLRHPNIV LAGYC EHGQRLLVYEYVGN
Sbjct: 416 NGKIMAIKKIDNAALSLQEEDNFLEAVSNMSRLRHPNIVPLAGYCTEHGQRLLVYEYVGN 475

Query: 493 GNLHDMLHFADDSSKNLTWNARVRVALGTARALEYLHEVCLPSVVHRNFKSANILLDDEL 552
           GNL D LH  DD S NLTWNARV+VALGTA+ALEYLHEVCLPS+VHRNFKSANILLD+EL
Sbjct: 476 GNLDDTLHTNDDRSMNLTWNARVKVALGTAKALEYLHEVCLPSIVHRNFKSANILLDEEL 535

Query: 553 NPHLSDCGLAALTPNTERQVIT 574
           NPHLSD GLAALTPNTERQV T
Sbjct: 536 NPHLSDSGLAALTPNTERQVST 557





Arabidopsis thaliana (taxid: 3702)
>sp|Q9C8M9|SRF6_ARATH Protein STRUBBELIG-RECEPTOR FAMILY 6 OS=Arabidopsis thaliana GN=SRF6 PE=1 SV=1 Back     alignment and function description
>sp|Q9LUL4|SRF7_ARATH Protein STRUBBELIG-RECEPTOR FAMILY 7 OS=Arabidopsis thaliana GN=SRF7 PE=1 SV=1 Back     alignment and function description
>sp|Q6R2K1|SRF5_ARATH Protein STRUBBELIG-RECEPTOR FAMILY 5 OS=Arabidopsis thaliana GN=SRF5 PE=2 SV=1 Back     alignment and function description
>sp|Q6R2K2|SRF4_ARATH Protein STRUBBELIG-RECEPTOR FAMILY 4 OS=Arabidopsis thaliana GN=SRF4 PE=2 SV=1 Back     alignment and function description
>sp|Q9FG24|SRF2_ARATH Protein STRUBBELIG-RECEPTOR FAMILY 2 OS=Arabidopsis thaliana GN=SRF2 PE=2 SV=1 Back     alignment and function description
>sp|Q06BH3|SRF1_ARATH Protein STRUBBELIG-RECEPTOR FAMILY 1 OS=Arabidopsis thaliana GN=SRF1 PE=2 SV=2 Back     alignment and function description
>sp|Q6R2K3|SRF3_ARATH Protein STRUBBELIG-RECEPTOR FAMILY 3 OS=Arabidopsis thaliana GN=SRF3 PE=1 SV=1 Back     alignment and function description
>sp|Q9LYN8|EXS_ARATH Leucine-rich repeat receptor protein kinase EXS OS=Arabidopsis thaliana GN=EXS PE=1 SV=1 Back     alignment and function description
>sp|C0LGQ5|GSO1_ARATH LRR receptor-like serine/threonine-protein kinase GSO1 OS=Arabidopsis thaliana GN=GSO1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query577
356555690 705 PREDICTED: protein STRUBBELIG-RECEPTOR F 0.946 0.774 0.717 0.0
356532229 706 PREDICTED: protein STRUBBELIG-RECEPTOR F 0.935 0.764 0.723 0.0
359494846 729 PREDICTED: protein STRUBBELIG-RECEPTOR F 0.982 0.777 0.718 0.0
297803912 703 kinase [Arabidopsis lyrata subsp. lyrata 0.946 0.776 0.704 0.0
79481791 703 STRUBBELIG-receptor family 8 protein [Ar 0.941 0.772 0.699 0.0
224117956672 predicted protein [Populus trichocarpa] 0.902 0.775 0.752 0.0
449455383 711 PREDICTED: protein STRUBBELIG-RECEPTOR F 0.941 0.763 0.7 0.0
255554777640 Serine/threonine-protein kinase PBS1, pu 0.811 0.731 0.750 0.0
449513527647 PREDICTED: protein STRUBBELIG-RECEPTOR F 0.857 0.765 0.661 0.0
357138966 715 PREDICTED: protein STRUBBELIG-RECEPTOR F 0.922 0.744 0.633 1e-178
>gi|356555690|ref|XP_003546163.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like [Glycine max] Back     alignment and taxonomy information
 Score =  810 bits (2093), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 399/556 (71%), Positives = 461/556 (82%), Gaps = 10/556 (1%)

Query: 23  VLILSIFLTLSLVQCTTDSSDVQALQVLYTSLNSPSVLTNWKGNEGDPCGESWKGVACEG 82
           +L+  +F+ L L    TD SDVQAL+V+Y +LNSP+ LT WK   GDPCGESWKGV CEG
Sbjct: 10  ILLSLVFVALPLSLANTDPSDVQALEVMYNALNSPTQLTGWKIGGGDPCGESWKGVTCEG 69

Query: 83  SAVVSIDISGLGLSGTMGYLLSDLLSLRKFDLSGNSIHDTIPYQLPPNLTSLNLASNNFS 142
           SAVVSI +SGLGL GT+GYLLSDL+SLR+ DLS N IHDTIPYQLPPNLTSLN A NN S
Sbjct: 70  SAVVSIKLSGLGLDGTLGYLLSDLMSLRELDLSDNKIHDTIPYQLPPNLTSLNFARNNLS 129

Query: 143 GNLPYSIASMVSLSYLNVSRNSLTQSIGDIFGNLAGLATLDLSFNNFSGDLPNSFISLSN 202
           GNLPYSI++MVSL+YLN+S N+L+ ++GDIF +L  L TLDLSFNNFSGDLP SF++L+N
Sbjct: 130 GNLPYSISAMVSLNYLNLSNNALSMTVGDIFASLQDLGTLDLSFNNFSGDLPPSFVALAN 189

Query: 203 ISSLYLQNNQVTGSLNVFSGLPLTTLNVANNHFSGWIPRELISIRTFIYDGNSFDNGPAP 262
           +SSL+LQ NQ+TGSL V  GLPL TLNVANN+FSGWIP EL SIR FIYDGNSF+N PAP
Sbjct: 190 LSSLFLQKNQLTGSLGVLVGLPLDTLNVANNNFSGWIPHELSSIRNFIYDGNSFENSPAP 249

Query: 263 PPPPSTAPPSGRSHNNRSHRQGSHSP---SGSQSSSSDKELPAGAIVGIVLGAVFLVALA 319
            PP  T+PP    H       GSH+    S ++ S   K L  GA+VGIVLG+V + A+ 
Sbjct: 250 LPPAFTSPPPNGPHGRHHSGSGSHNKTQVSDNEKSDGHKGLTVGAVVGIVLGSVLVAAIV 309

Query: 320 LLALYFCIRKNRRKVSGARSSAGSFPVSTNNMNTEMHEQRVKSVAAVTDLTPPPAEKLVI 379
           LLAL FCIRK + K  GAR+ +GS P++      +M EQRVKS A VTDL P PAE + +
Sbjct: 310 LLALVFCIRKQKGK-KGARNFSGSLPLT-----PQMQEQRVKSAAVVTDLKPRPAENVTV 363

Query: 380 ERVA-KSGSLKKIKSPITATSYTVASLQTATNSFSQEFLIGEGSLGRVYRAEFANGKIMA 438
           ERVA KSGS+K++KSPIT+T YTVASLQ+ATNSFSQEF+IGEGSLGRVY+A+F NGK+MA
Sbjct: 364 ERVAVKSGSVKQMKSPITSTLYTVASLQSATNSFSQEFIIGEGSLGRVYKADFPNGKVMA 423

Query: 439 VKKIDNAALSLQEEDNFLEAVSNMSRLRHPNIVTLAGYCAEHGQRLLVYEYVGNGNLHDM 498
           +KKIDN+ALSLQEEDNFLEAVSNMSRLRHP+IVTLAGYCAEHGQRLLVYEY+ NGNLHDM
Sbjct: 424 IKKIDNSALSLQEEDNFLEAVSNMSRLRHPSIVTLAGYCAEHGQRLLVYEYIANGNLHDM 483

Query: 499 LHFADDSSKNLTWNARVRVALGTARALEYLHEVCLPSVVHRNFKSANILLDDELNPHLSD 558
           LHFA+DSSK L+WNARVR+ALGTARALEYLHEVCLPSVVHRNFKSANILLD+ELNPHLSD
Sbjct: 484 LHFAEDSSKALSWNARVRIALGTARALEYLHEVCLPSVVHRNFKSANILLDEELNPHLSD 543

Query: 559 CGLAALTPNTERQVIT 574
           CGLAALTPNTERQV T
Sbjct: 544 CGLAALTPNTERQVST 559




Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|356532229|ref|XP_003534676.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like [Glycine max] Back     alignment and taxonomy information
>gi|359494846|ref|XP_002267170.2| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like [Vitis vinifera] gi|297741762|emb|CBI32991.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|297803912|ref|XP_002869840.1| kinase [Arabidopsis lyrata subsp. lyrata] gi|297315676|gb|EFH46099.1| kinase [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|79481791|ref|NP_193944.2| STRUBBELIG-receptor family 8 protein [Arabidopsis thaliana] gi|75127758|sp|Q6R2J8.1|SRF8_ARATH RecName: Full=Protein STRUBBELIG-RECEPTOR FAMILY 8; AltName: Full=Leucine-rich repeat receptor kinase-like protein SRF8; Flags: Precursor gi|41323415|gb|AAR99876.1| strubbelig receptor family 8 [Arabidopsis thaliana] gi|224589624|gb|ACN59345.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis thaliana] gi|332659160|gb|AEE84560.1| STRUBBELIG-receptor family 8 protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|224117956|ref|XP_002331522.1| predicted protein [Populus trichocarpa] gi|222873746|gb|EEF10877.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449455383|ref|XP_004145432.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|255554777|ref|XP_002518426.1| Serine/threonine-protein kinase PBS1, putative [Ricinus communis] gi|223542271|gb|EEF43813.1| Serine/threonine-protein kinase PBS1, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|449513527|ref|XP_004164349.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|357138966|ref|XP_003571057.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like [Brachypodium distachyon] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query577
TAIR|locus:2120683 703 SRF8 "STRUBBELIG-receptor fami 0.951 0.780 0.650 2.2e-183
TAIR|locus:2091015 717 SRF7 "STRUBBELIG-receptor fami 0.372 0.299 0.531 1e-109
TAIR|locus:2024837 720 SRF6 "STRUBBELIG-receptor fami 0.961 0.770 0.410 4.3e-109
TAIR|locus:2207280 699 SRF5 "STRUBBELIG-receptor fami 0.415 0.343 0.425 1.5e-102
TAIR|locus:2089210 687 SRF4 "STRUBBELIG-receptor fami 0.417 0.350 0.430 1.1e-99
TAIR|locus:2125566 776 SRF3 "STRUBBELIG-receptor fami 0.351 0.261 0.539 2e-96
TAIR|locus:2051404 775 SRF1 "STRUBBELIG-receptor fami 0.386 0.287 0.502 9.9e-95
TAIR|locus:2170219 735 SRF2 "STRUBBELIG-receptor fami 0.419 0.329 0.424 1.6e-89
TAIR|locus:2202084 768 SUB "STRUBBELIG" [Arabidopsis 0.305 0.229 0.522 1.7e-84
TAIR|locus:2154709 1036 PSKR2 "phytosylfokine-alpha re 0.298 0.166 0.425 7.9e-49
TAIR|locus:2120683 SRF8 "STRUBBELIG-receptor family 8" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1779 (631.3 bits), Expect = 2.2e-183, P = 2.2e-183
 Identities = 363/558 (65%), Positives = 408/558 (73%)

Query:    18 LIDAFVLILSIFLTLSLVQCTTDSSDVQALQVLYTSLNSPSVLTNWKGNEGDPCGESWKG 77
             +    +L ++     S+V+C TD SDVQALQVLYTSLNSPS LTNWK   GDPCGESWKG
Sbjct:     8 MFTVLLLFIASISGFSVVRCVTDPSDVQALQVLYTSLNSPSQLTNWKNGGGDPCGESWKG 67

Query:    78 VACEGSAVVSIDISGLGLSGTMGYLLSDLLSLRKFDLSGNSIHDTIPYQLPPNLTSLNLA 137
             + CEGSAVV+IDIS LG+SGT+GYLLSDL SLRK D+SGNSIHDT+PYQLPPNLTSLNLA
Sbjct:    68 ITCEGSAVVTIDISDLGVSGTLGYLLSDLKSLRKLDVSGNSIHDTLPYQLPPNLTSLNLA 127

Query:   138 SNNFSGNLPYSIASMVSLSYLNVSRNSLTQSIGDIFGNLAGLATLDLSFNNFSGDXXXXX 197
              NN SGNLPYSI++M SLSY+NVS NSLT SIGDIF +   LATLDLS NNFSGD     
Sbjct:   128 RNNLSGNLPYSISAMGSLSYMNVSGNSLTMSIGDIFADHKSLATLDLSHNNFSGDLPSSL 187

Query:   198 XXXXXXXXXXXXXXQVTGSLNVFSGLPLTTLNVANNHFSGWIPRELISIRTFIYDGNSFD 257
                           Q+TGS++V SGLPL TLNVANNHF+G IP+EL SI+T IYDGNSFD
Sbjct:   188 STVSTLSVLYVQNNQLTGSIDVLSGLPLKTLNVANNHFNGSIPKELSSIQTLIYDGNSFD 247

Query:   258 NGXXXXXXXXXXXXXGRSHNNXXXXXXXXXXXXXXXXXXDKELPAGAXXXXXXXXXXXXX 317
             N              G+                       K L  G              
Sbjct:   248 N----VPASPQPERPGKKETPSGSKKPKIGSEEKSSDSG-KGLSGGVVTGIVFGSLFVAG 302

Query:   318 XXXXXXYFCIRKNRRKVSGA-RSSAGSFPVSTNNMNTEMHEQRVKSVAAVTDLTPPPAEK 376
                   Y C+ K +RKV G+ R+S  S P+S      E+ EQRVKSVA+V DL   PAEK
Sbjct:   303 IIALVLYLCLHKKKRKVRGSTRASQRSLPLSGT---PEVQEQRVKSVASVADLKSSPAEK 359

Query:   377 LVIERVAKSGSLKKIKSPITATSYTVASLQTATNSFSQEFLIGEGSLGRVYRAEFANGKI 436
             + ++RV K+GS+ +I+SPITA+ YTV+SLQ ATNSFSQE +IGEGSLGRVYRAEF NGKI
Sbjct:   360 VTVDRVMKNGSISRIRSPITASQYTVSSLQVATNSFSQENIIGEGSLGRVYRAEFPNGKI 419

Query:   437 MAVKKIDNAALSLQEEDNFLEAVSNMSRLRHPNIVTLAGYCAEHGQRLLVYEYVGNGNLH 496
             MA+KKIDNAALSLQEEDNFLEAVSNMSRLRHPNIV LAGYC EHGQRLLVYEYVGNGNL 
Sbjct:   420 MAIKKIDNAALSLQEEDNFLEAVSNMSRLRHPNIVPLAGYCTEHGQRLLVYEYVGNGNLD 479

Query:   497 DMLHFADDSSKNLTWNARVRVALGTARALEYLHEVCLPSVVHRNFKSANILLDDELNPHL 556
             D LH  DD S NLTWNARV+VALGTA+ALEYLHEVCLPS+VHRNFKSANILLD+ELNPHL
Sbjct:   480 DTLHTNDDRSMNLTWNARVKVALGTAKALEYLHEVCLPSIVHRNFKSANILLDEELNPHL 539

Query:   557 SDCGLAALTPNTERQVIT 574
             SD GLAALTPNTERQV T
Sbjct:   540 SDSGLAALTPNTERQVST 557




GO:0004672 "protein kinase activity" evidence=IEA
GO:0004713 "protein tyrosine kinase activity" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0005576 "extracellular region" evidence=ISM
GO:0005886 "plasma membrane" evidence=ISM;IDA
GO:0006468 "protein phosphorylation" evidence=IEA
GO:0016301 "kinase activity" evidence=ISS
GO:0016772 "transferase activity, transferring phosphorus-containing groups" evidence=IEA
GO:0009624 "response to nematode" evidence=RCA
GO:0010075 "regulation of meristem growth" evidence=RCA
GO:0048653 "anther development" evidence=RCA
TAIR|locus:2091015 SRF7 "STRUBBELIG-receptor family 7" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2024837 SRF6 "STRUBBELIG-receptor family 6" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2207280 SRF5 "STRUBBELIG-receptor family 5" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2089210 SRF4 "STRUBBELIG-receptor family 4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2125566 SRF3 "STRUBBELIG-receptor family 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2051404 SRF1 "STRUBBELIG-receptor family 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2170219 SRF2 "STRUBBELIG-receptor family 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2202084 SUB "STRUBBELIG" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2154709 PSKR2 "phytosylfokine-alpha receptor 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q6R2J8SRF8_ARATHNo assigned EC number0.69920.94100.7724yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query577
pfam00069260 pfam00069, Pkinase, Protein kinase domain 1e-33
cd00180215 cd00180, PKc, Catalytic domain of Protein Kinases 1e-31
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 5e-30
smart00220254 smart00220, S_TKc, Serine/Threonine protein kinase 8e-29
pfam07714258 pfam07714, Pkinase_Tyr, Protein tyrosine kinase 2e-28
smart00219257 smart00219, TyrKc, Tyrosine kinase, catalytic doma 4e-27
smart00221258 smart00221, STYKc, Protein kinase; unclassified sp 6e-27
cd00192262 cd00192, PTKc, Catalytic domain of Protein Tyrosin 2e-26
cd05039256 cd05039, PTKc_Csk_like, Catalytic domain of C-term 4e-21
cd06606260 cd06606, STKc_MAPKKK, Catalytic domain of the Prot 4e-20
cd06627254 cd06627, STKc_Cdc7_like, Catalytic domain of Cell 2e-19
cd05122253 cd05122, PKc_STE, Catalytic domain of STE family P 3e-18
cd08529256 cd08529, STKc_FA2-like, Catalytic domain of the Pr 2e-17
cd06613262 cd06613, STKc_MAP4K3_like, Catalytic domain of Mit 6e-17
cd05048283 cd05048, PTKc_Ror, Catalytic Domain of the Protein 9e-17
cd06626264 cd06626, STKc_MEKK4, Catalytic domain of the Prote 1e-16
cd05049280 cd05049, PTKc_Trk, Catalytic domain of the Protein 2e-16
cd06614 286 cd06614, STKc_PAK, Catalytic domain of the Protein 3e-16
cd08215258 cd08215, STKc_Nek, Catalytic domain of the Protein 3e-16
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 5e-16
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 8e-16
cd06612256 cd06612, STKc_MST1_2, Catalytic domain of the Prot 1e-15
cd05034261 cd05034, PTKc_Src_like, Catalytic domain of Src ki 1e-15
cd06608275 cd06608, STKc_myosinIII_like, Catalytic domain of 3e-15
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 5e-15
cd05059256 cd05059, PTKc_Tec_like, Catalytic domain of Tec-li 6e-15
COG0515 384 COG0515, SPS1, Serine/threonine protein kinase [Ge 6e-15
cd05123250 cd05123, STKc_AGC, Catalytic domain of AGC family 7e-15
cd07840 287 cd07840, STKc_CDK9_like, Catalytic domain of Cycli 2e-14
cd07829 282 cd07829, STKc_CDK_like, Catalytic domain of Cyclin 4e-14
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 6e-14
cd05148261 cd05148, PTKc_Srm_Brk, Catalytic domain of the Pro 6e-14
cd06610 267 cd06610, STKc_OSR1_SPAK, Catalytic domain of the P 7e-14
cd06632258 cd06632, STKc_MEKK1_plant, Catalytic domain of the 1e-13
cd05118 283 cd05118, STKc_CMGC, Catalytic domain of CMGC famil 2e-13
cd05038 284 cd05038, PTKc_Jak_rpt2, Catalytic (repeat 2) domai 2e-13
cd06609 274 cd06609, STKc_MST3_like, Catalytic domain of Mamma 2e-13
cd08217265 cd08217, STKc_Nek2, Catalytic domain of the Protei 3e-13
cd06607 307 cd06607, STKc_TAO, Catalytic domain of the Protein 4e-13
cd05053293 cd05053, PTKc_FGFR, Catalytic domain of the Protei 5e-13
cd05112256 cd05112, PTKc_Itk, Catalytic domain of the Protein 6e-13
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 9e-13
cd07845 309 cd07845, STKc_CDK10, Catalytic domain of the Serin 1e-12
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-12
cd05052263 cd05052, PTKc_Abl, Catalytic domain of the Protein 2e-12
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 3e-12
PLN00113968 PLN00113, PLN00113, leucine-rich repeat receptor-l 3e-12
cd05033266 cd05033, PTKc_EphR, Catalytic domain of Ephrin Rec 3e-12
cd07833 288 cd07833, STKc_CDKL, Catalytic domain of Cyclin-Dep 4e-12
cd06630 268 cd06630, STKc_MEKK1, Catalytic domain of the Prote 5e-12
cd06628267 cd06628, STKc_MAPKKK_Byr2_like, Catalytic domain o 7e-12
cd05067260 cd05067, PTKc_Lck_Blk, Catalytic domain of the Pro 1e-11
cd05581 280 cd05581, STKc_PDK1, Catalytic domain of the Protei 1e-11
cd07832 286 cd07832, STKc_CCRK, Catalytic domain of the Serine 1e-11
cd05083254 cd05083, PTKc_Chk, Catalytic domain of the Protein 1e-11
cd05042 269 cd05042, PTKc_Aatyk, Catalytic domain of the Prote 1e-11
cd05058 262 cd05058, PTKc_Met_Ron, Catalytic domain of the Pro 1e-11
cd07841 298 cd07841, STKc_CDK7, Catalytic domain of the Serine 1e-11
cd05070260 cd05070, PTKc_Fyn_Yrk, Catalytic domain of the Pro 2e-11
cd05041251 cd05041, PTKc_Fes_like, Catalytic domain of Fes-li 2e-11
cd07838 287 cd07838, STKc_CDK4_6_like, Catalytic domain of Cyc 2e-11
cd08530256 cd08530, STKc_CNK2-like, Catalytic domain of the P 2e-11
cd05080 283 cd05080, PTKc_Tyk2_rpt2, Catalytic (repeat 2) doma 3e-11
cd08225257 cd08225, STKc_Nek5, Catalytic domain of the Protei 4e-11
cd06648 285 cd06648, STKc_PAK_II, Catalytic domain of the Prot 4e-11
cd07835 283 cd07835, STKc_CDK1_like, Catalytic domain of Cycli 4e-11
cd05047270 cd05047, PTKc_Tie, Catalytic domain of Tie Protein 4e-11
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 5e-11
cd05612 291 cd05612, STKc_PRKX_like, Catalytic domain of PRKX- 5e-11
cd05089 297 cd05089, PTKc_Tie1, Catalytic domain of the Protei 5e-11
cd05060257 cd05060, PTKc_Syk_like, Catalytic domain of Spleen 5e-11
cd05043 280 cd05043, PTK_Ryk, Pseudokinase domain of Ryk (Rece 7e-11
cd05069260 cd05069, PTKc_Yes, Catalytic domain of the Protein 9e-11
cd05071262 cd05071, PTKc_Src, Catalytic domain of the Protein 1e-10
cd05114256 cd05114, PTKc_Tec_Rlk, Catalytic domain of the Pro 1e-10
cd05035273 cd05035, PTKc_Axl_like, Catalytic Domain of Axl-li 1e-10
cd05082256 cd05082, PTKc_Csk, Catalytic domain of the Protein 1e-10
cd05113256 cd05113, PTKc_Btk_Bmx, Catalytic domain of the Pro 1e-10
cd05050288 cd05050, PTKc_Musk, Catalytic domain of the Protei 1e-10
cd05068261 cd05068, PTKc_Frk_like, Catalytic domain of Fyn-re 1e-10
cd05578258 cd05578, STKc_Yank1, Catalytic domain of the Prote 1e-10
cd06623 264 cd06623, PKc_MAPKK_plant_like, Catalytic domain of 1e-10
cd05063268 cd05063, PTKc_EphR_A2, Catalytic domain of the Pro 1e-10
cd06645267 cd06645, STKc_MAP4K3, Catalytic domain of the Prot 2e-10
cd05091283 cd05091, PTKc_Ror2, Catalytic domain of the Protei 3e-10
cd05090283 cd05090, PTKc_Ror1, Catalytic domain of the Protei 3e-10
cd06629 272 cd06629, STKc_MAPKKK_Bck1_like, Catalytic domain o 4e-10
cd06633 313 cd06633, STKc_TAO3, Catalytic domain of the Protei 5e-10
cd08224267 cd08224, STKc_Nek6_Nek7, Catalytic domain of the P 5e-10
cd06625263 cd06625, STKc_MEKK3_like, Catalytic domain of MAP/ 5e-10
cd05065 269 cd05065, PTKc_EphR_B, Catalytic domain of the Prot 7e-10
cd06611 280 cd06611, STKc_SLK_like, Catalytic domain of Ste20- 7e-10
cd05072261 cd05072, PTKc_Lyn, Catalytic domain of the Protein 8e-10
cd08218256 cd08218, STKc_Nek1, Catalytic domain of the Protei 8e-10
cd06646267 cd06646, STKc_MAP4K5, Catalytic domain of the Prot 9e-10
cd05096 304 cd05096, PTKc_DDR1, Catalytic domain of the Protei 1e-09
cd05088 303 cd05088, PTKc_Tie2, Catalytic domain of the Protei 1e-09
cd05097 295 cd05097, PTKc_DDR_like, Catalytic domain of Discoi 2e-09
cd06917 277 cd06917, STKc_NAK1_like, Catalytic domain of Funga 2e-09
cd06634 308 cd06634, STKc_TAO2, Catalytic domain of the Protei 2e-09
cd08221256 cd08221, STKc_Nek9, Catalytic domain of the Protei 2e-09
cd05075272 cd05075, PTKc_Axl, Catalytic domain of the Protein 3e-09
cd05099 314 cd05099, PTKc_FGFR4, Catalytic domain of the Prote 3e-09
cd07842 316 cd07842, STKc_CDK8_like, Catalytic domain of Cycli 3e-09
cd06605 265 cd06605, PKc_MAPKK, Catalytic domain of the dual-s 3e-09
cd05579 265 cd05579, STKc_MAST_like, Catalytic domain of Micro 4e-09
cd06655 296 cd06655, STKc_PAK2, Catalytic domain of the Protei 5e-09
cd07866 311 cd07866, STKc_BUR1, Catalytic domain of the Serine 5e-09
cd05078258 cd05078, PTK_Jak2_Jak3_rpt1, Pseudokinase (repeat 5e-09
cd05580 290 cd05580, STKc_PKA, Catalytic domain of the Protein 6e-09
cd06647 293 cd06647, STKc_PAK_I, Catalytic domain of the Prote 6e-09
cd07865 310 cd07865, STKc_CDK9, Catalytic domain of the Serine 7e-09
cd05577 277 cd05577, STKc_GRK, Catalytic domain of the Protein 7e-09
cd05575 323 cd05575, STKc_SGK, Catalytic domain of the Protein 8e-09
cd06621 287 cd06621, PKc_MAPKK_Pek1_like, Catalytic domain of 9e-09
cd05085250 cd05085, PTKc_Fer, Catalytic domain of the Protein 1e-08
cd06643 282 cd06643, STKc_SLK, Catalytic domain of the Protein 1e-08
cd07846 286 cd07846, STKc_CDKL2_3, Catalytic domain of the Ser 1e-08
cd06653264 cd06653, STKc_MEKK3_like_1, Catalytic domain of MA 2e-08
cd05084252 cd05084, PTKc_Fes, Catalytic domain of the Protein 2e-08
cd05040257 cd05040, PTKc_Ack_like, Catalytic domain of the Pr 2e-08
cd05100 334 cd05100, PTKc_FGFR3, Catalytic domain of the Prote 2e-08
cd07831 282 cd07831, STKc_MOK, Catalytic domain of the Serine/ 2e-08
cd07861 285 cd07861, STKc_CDK1_euk, Catalytic domain of the Se 3e-08
cd06635 317 cd06635, STKc_TAO1, Catalytic domain of the Protei 3e-08
cd05066267 cd05066, PTKc_EphR_A, Catalytic domain of the Prot 3e-08
cd08219255 cd08219, STKc_Nek3, Catalytic domain of the Protei 3e-08
cd05077262 cd05077, PTK_Jak1_rpt1, Pseudokinase (repeat 1) do 3e-08
cd05056 270 cd05056, PTKc_FAK, Catalytic domain of the Protein 3e-08
PTZ00263 329 PTZ00263, PTZ00263, protein kinase A catalytic sub 3e-08
cd05092280 cd05092, PTKc_TrkA, Catalytic domain of the Protei 3e-08
cd06639291 cd06639, STKc_myosinIIIB, Catalytic domain of the 4e-08
cd06637272 cd06637, STKc_TNIK, Catalytic domain of the Protei 4e-08
cd05093 288 cd05093, PTKc_TrkB, Catalytic domain of the Protei 4e-08
cd07860 284 cd07860, STKc_CDK2_3, Catalytic domain of the Seri 4e-08
cd06651266 cd06651, STKc_MEKK3, Catalytic domain of the Prote 4e-08
cd05081 284 cd05081, PTKc_Jak2_Jak3_rpt2, Catalytic (repeat 2) 5e-08
cd05589 324 cd05589, STKc_PKN, Catalytic domain of the Protein 5e-08
cd05574 316 cd05574, STKc_phototropin_like, Catalytic domain o 5e-08
cd07864 302 cd07864, STKc_CDK12, Catalytic domain of the Serin 5e-08
cd05086 268 cd05086, PTKc_Aatyk2, Catalytic domain of the Prot 5e-08
cd06642 277 cd06642, STKc_STK25-YSK1, Catalytic domain of the 6e-08
cd08223257 cd08223, STKc_Nek4, Catalytic domain of the Protei 6e-08
cd07843 293 cd07843, STKc_CDC2L1, Catalytic domain of the Seri 7e-08
cd07869 303 cd07869, STKc_PFTAIRE1, Catalytic domain of the Se 7e-08
cd07830 283 cd07830, STKc_MAK_like, Catalytic domain of Male g 7e-08
cd05101 304 cd05101, PTKc_FGFR2, Catalytic domain of the Prote 8e-08
pfam0826342 pfam08263, LRRNT_2, Leucine rich repeat N-terminal 8e-08
cd05098 307 cd05098, PTKc_FGFR1, Catalytic domain of the Prote 9e-08
cd05570 318 cd05570, STKc_PKC, Catalytic domain of the Protein 9e-08
cd06658 292 cd06658, STKc_PAK5, Catalytic domain of the Protei 9e-08
cd07868 317 cd07868, STKc_CDK8, Catalytic domain of the Serine 1e-07
cd08528269 cd08528, STKc_Nek10, Catalytic domain of the Prote 1e-07
cd06624268 cd06624, STKc_ASK, Catalytic domain of the Protein 2e-07
cd06636282 cd06636, STKc_MAP4K4_6, Catalytic domain of the Pr 2e-07
cd07847 286 cd07847, STKc_CDKL1_4, Catalytic domain of the Ser 2e-07
cd05036277 cd05036, PTKc_ALK_LTK, Catalytic domain of the Pro 2e-07
PLN00009 294 PLN00009, PLN00009, cyclin-dependent kinase A; Pro 2e-07
cd05630 285 cd05630, STKc_GRK6, Catalytic domain of the Protei 2e-07
cd06652265 cd06652, STKc_MEKK2, Catalytic domain of the Prote 2e-07
cd05044 269 cd05044, PTKc_c-ros, Catalytic domain of the Prote 2e-07
cd06616 288 cd06616, PKc_MKK4, Catalytic domain of the dual-sp 2e-07
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 2e-07
cd05087 269 cd05087, PTKc_Aatyk1_Aatyk3, Catalytic domain of t 2e-07
cd05607 277 cd05607, STKc_GRK7, Catalytic domain of the Protei 2e-07
cd06641 277 cd06641, STKc_MST3, Catalytic domain of the Protei 3e-07
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 3e-07
cd05584 323 cd05584, STKc_p70S6K, Catalytic domain of the Prot 3e-07
cd07839 284 cd07839, STKc_CDK5, Catalytic domain of the Serine 3e-07
cd07844 291 cd07844, STKc_PCTAIRE_like, Catalytic domain of PC 3e-07
cd05057 279 cd05057, PTKc_EGFR_like, Catalytic domain of Epide 3e-07
cd05045 290 cd05045, PTKc_RET, Catalytic domain of the Protein 3e-07
cd05051 296 cd05051, PTKc_DDR, Catalytic domain of the Protein 4e-07
cd05094 291 cd05094, PTKc_TrkC, Catalytic domain of the Protei 4e-07
cd05055302 cd05055, PTKc_PDGFR, Catalytic domain of the Prote 4e-07
cd06640 277 cd06640, STKc_MST4, Catalytic domain of the Protei 5e-07
cd06644 292 cd06644, STKc_STK10_LOK, Catalytic domain of the P 6e-07
cd05111 279 cd05111, PTK_HER3, Pseudokinase domain of the Prot 6e-07
cd05110 303 cd05110, PTKc_HER4, Catalytic domain of the Protei 6e-07
cd05583 288 cd05583, STKc_MSK_N, N-terminal catalytic domain o 6e-07
cd07867 317 cd07867, STKc_CDC2L6, Catalytic domain of Serine/T 8e-07
cd06656 297 cd06656, STKc_PAK3, Catalytic domain of the Protei 8e-07
cd05605 285 cd05605, STKc_GRK4_like, Catalytic domain of G pro 9e-07
cd08229267 cd08229, STKc_Nek7, Catalytic domain of the Protei 9e-07
cd05602 325 cd05602, STKc_SGK1, Catalytic domain of the Protei 1e-06
cd05603 321 cd05603, STKc_SGK2, Catalytic domain of the Protei 1e-06
cd05074273 cd05074, PTKc_Tyro3, Catalytic domain of the Prote 1e-06
cd07855 334 cd07855, STKc_ERK5, Catalytic domain of the Serine 1e-06
cd05614 332 cd05614, STKc_MSK2_N, N-terminal catalytic domain 1e-06
cd05116257 cd05116, PTKc_Syk, Catalytic domain of the Protein 1e-06
cd05037259 cd05037, PTK_Jak_rpt1, Pseudokinase (repeat 1) dom 1e-06
cd05590 320 cd05590, STKc_nPKC_eta, Catalytic domain of the Pr 1e-06
cd06654 296 cd06654, STKc_PAK1, Catalytic domain of the Protei 1e-06
cd06657 292 cd06657, STKc_PAK4, Catalytic domain of the Protei 1e-06
cd06631 265 cd06631, STKc_YSK4, Catalytic domain of the Protei 1e-06
PTZ00024 335 PTZ00024, PTZ00024, cyclin-dependent protein kinas 2e-06
cd05095 296 cd05095, PTKc_DDR2, Catalytic domain of the Protei 2e-06
cd07859 338 cd07859, STKc_TDY_MAPK_plant, Catalytic domain of 2e-06
cd05032277 cd05032, PTKc_InsR_like, Catalytic domain of Insul 2e-06
cd07852 337 cd07852, STKc_MAPK15, Catalytic domain of the Seri 2e-06
cd06617 283 cd06617, PKc_MKK3_6, Catalytic domain of the dual- 3e-06
cd07873 301 cd07873, STKc_PCTAIRE1, Catalytic domain of the Se 3e-06
cd05588 329 cd05588, STKc_aPKC, Catalytic domain of the Protei 3e-06
cd05572 262 cd05572, STKc_cGK_PKG, Catalytic domain of the Pro 3e-06
cd07862 290 cd07862, STKc_CDK6, Catalytic domain of the Serine 4e-06
cd07871 288 cd07871, STKc_PCTAIRE3, Catalytic domain of the Se 4e-06
PTZ00426 340 PTZ00426, PTZ00426, cAMP-dependent protein kinase 5e-06
cd05632 285 cd05632, STKc_GRK5, Catalytic domain of the Protei 7e-06
cd06659 297 cd06659, STKc_PAK6, Catalytic domain of the Protei 8e-06
cd07863 288 cd07863, STKc_CDK4, Catalytic domain of the Serine 1e-05
cd06638286 cd06638, STKc_myosinIIIA, Catalytic domain of the 1e-05
cd05073260 cd05073, PTKc_Hck, Catalytic domain of the Protein 1e-05
cd05585 312 cd05585, STKc_YPK1_like, Catalytic domain of Yeast 1e-05
cd05604 325 cd05604, STKc_SGK3, Catalytic domain of the Protei 1e-05
cd05593 328 cd05593, STKc_PKB_gamma, Catalytic domain of the P 1e-05
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 2e-05
cd07836 284 cd07836, STKc_Pho85, Catalytic domain of the Serin 2e-05
cd07872 309 cd07872, STKc_PCTAIRE2, Catalytic domain of the Se 2e-05
cd05601 330 cd05601, STKc_CRIK, Catalytic domain of the Protei 3e-05
cd05079 284 cd05079, PTKc_Jak1_rpt2, Catalytic (repeat 2) doma 3e-05
cd07834 330 cd07834, STKc_MAPK, Catalytic domain of the Serine 3e-05
cd08228267 cd08228, STKc_Nek6, Catalytic domain of the Protei 3e-05
cd05115257 cd05115, PTKc_Zap-70, Catalytic domain of the Prot 3e-05
cd05608 280 cd05608, STKc_GRK1, Catalytic domain of the Protei 3e-05
cd05633 279 cd05633, STKc_GRK3, Catalytic domain of the Protei 3e-05
cd05618 329 cd05618, STKc_aPKC_iota, Catalytic domain of the P 3e-05
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 4e-05
cd07837 295 cd07837, STKc_CdkB_plant, Catalytic domain of the 4e-05
cd05571 323 cd05571, STKc_PKB, Catalytic domain of the Protein 4e-05
cd06618 296 cd06618, PKc_MKK7, Catalytic domain of the dual-sp 5e-05
cd05595 323 cd05595, STKc_PKB_beta, Catalytic domain of the Pr 6e-05
cd05631 285 cd05631, STKc_GRK4, Catalytic domain of the Protei 6e-05
TIGR03903 1266 TIGR03903, TOMM_kin_cyc, TOMM system kinase/cyclas 6e-05
cd08216 314 cd08216, PK_STRAD, Pseudokinase domain of STE20-re 7e-05
cd05591 321 cd05591, STKc_nPKC_epsilon, Catalytic domain of th 7e-05
cd05606 278 cd05606, STKc_beta_ARK, Catalytic domain of the Pr 8e-05
cd08220256 cd08220, STKc_Nek8, Catalytic domain of the Protei 9e-05
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 1e-04
cd05108 316 cd05108, PTKc_EGFR, Catalytic domain of the Protei 1e-04
cd05610 669 cd05610, STKc_MASTL, Catalytic domain of the Prote 1e-04
cd05076274 cd05076, PTK_Tyk2_rpt1, Pseudokinase (repeat 1) do 1e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 2e-04
cd05582 318 cd05582, STKc_RSK_N, N-terminal catalytic domain o 2e-04
cd05594 325 cd05594, STKc_PKB_alpha, Catalytic domain of the P 3e-04
cd05046275 cd05046, PTK_CCK4, Pseudokinase domain of the Prot 3e-04
cd05619 316 cd05619, STKc_nPKC_theta, Catalytic domain of the 4e-04
cd07848 287 cd07848, STKc_CDKL5, Catalytic domain of the Serin 5e-04
cd05611 260 cd05611, STKc_Rim15_like, Catalytic domain of fung 6e-04
cd05609 305 cd05609, STKc_MAST, Catalytic domain of the Protei 6e-04
cd05061 288 cd05061, PTKc_InsR, Catalytic domain of the Protei 8e-04
cd05107 401 cd05107, PTKc_PDGFR_beta, Catalytic domain of the 9e-04
cd05629 377 cd05629, STKc_NDR_like_fungal, Catalytic domain of 9e-04
cd05613 290 cd05613, STKc_MSK1_N, N-terminal catalytic domain 0.001
cd05109 279 cd05109, PTKc_HER2, Catalytic domain of the Protei 0.002
cd05064266 cd05064, PTKc_EphR_A10, Catalytic domain of the Pr 0.002
cd05617 327 cd05617, STKc_aPKC_zeta, Catalytic domain of the P 0.002
cd05062277 cd05062, PTKc_IGF-1R, Catalytic domain of the Prot 0.003
cd06622 286 cd06622, PKc_MAPKK_PBS2_like, Catalytic domain of 0.003
cd07856 328 cd07856, STKc_Sty1_Hog1, Catalytic domain of the S 0.003
cd07858 337 cd07858, STKc_TEY_MAPK_plant, Catalytic domain of 0.004
>gnl|CDD|215690 pfam00069, Pkinase, Protein kinase domain Back     alignment and domain information
 Score =  128 bits (324), Expect = 1e-33
 Identities = 52/163 (31%), Positives = 77/163 (47%), Gaps = 10/163 (6%)

Query: 418 IGEGSLGRVYRAEFAN-GKIMAVKKIDNAALSLQEEDNFLEAVSNMSRLRHPNIVTLAGY 476
           +G GS G VY+A+    GKI+AVK +   +   +++      +  + RL HPNIV L   
Sbjct: 7   LGSGSFGTVYKAKHKGTGKIVAVKILKKRSEKSKKDQTARREIRILRRLSHPNIVRLIDA 66

Query: 477 CAEHGQRLLVYEYVGNGNLHDMLHFADDSSKNLTWNARVRVALGTARALEYLHEVCLPSV 536
             +     LV EY   G+L D L         L+ +   ++AL   R LEYLH      +
Sbjct: 67  FEDKDHLYLVMEYCEGGDLFDYLS----RGGPLSEDEAKKIALQILRGLEYLHSN---GI 119

Query: 537 VHRNFKSANILLDDELNPHLSDCGLAAL--TPNTERQVITGTS 577
           +HR+ K  NILLD+     ++D GLA      ++      GT 
Sbjct: 120 IHRDLKPENILLDENGVVKIADFGLAKKLLKSSSSLTTFVGTP 162


Length = 260

>gnl|CDD|173623 cd00180, PKc, Catalytic domain of Protein Kinases Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|214567 smart00220, S_TKc, Serine/Threonine protein kinases, catalytic domain Back     alignment and domain information
>gnl|CDD|219530 pfam07714, Pkinase_Tyr, Protein tyrosine kinase Back     alignment and domain information
>gnl|CDD|197581 smart00219, TyrKc, Tyrosine kinase, catalytic domain Back     alignment and domain information
>gnl|CDD|214568 smart00221, STYKc, Protein kinase; unclassified specificity Back     alignment and domain information
>gnl|CDD|173624 cd00192, PTKc, Catalytic domain of Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|133171 cd05039, PTKc_Csk_like, Catalytic domain of C-terminal Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173724 cd06606, STKc_MAPKKK, Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase Back     alignment and domain information
>gnl|CDD|173731 cd06627, STKc_Cdc7_like, Catalytic domain of Cell division control protein 7-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173659 cd05122, PKc_STE, Catalytic domain of STE family Protein Kinases Back     alignment and domain information
>gnl|CDD|173771 cd08529, STKc_FA2-like, Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii FA2 and similar domains Back     alignment and domain information
>gnl|CDD|173727 cd06613, STKc_MAP4K3_like, Catalytic domain of Mitogen-activated protein kinase kinase kinase kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|133179 cd05048, PTKc_Ror, Catalytic Domain of the Protein Tyrosine Kinases, Receptor tyrosine kinase-like Orphan Receptors Back     alignment and domain information
>gnl|CDD|132957 cd06626, STKc_MEKK4, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 4 Back     alignment and domain information
>gnl|CDD|133180 cd05049, PTKc_Trk, Catalytic domain of the Protein Tyrosine Kinases, Tropomyosin Related Kinases Back     alignment and domain information
>gnl|CDD|173728 cd06614, STKc_PAK, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase Back     alignment and domain information
>gnl|CDD|173755 cd08215, STKc_Nek, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|132943 cd06612, STKc_MST1_2, Catalytic domain of the Protein Serine/Threonine Kinases, Mammalian Ste20-like protein kinase 1 and 2 Back     alignment and domain information
>gnl|CDD|173626 cd05034, PTKc_Src_like, Catalytic domain of Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173725 cd06608, STKc_myosinIII_like, Catalytic domain of Class III myosin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|173637 cd05059, PTKc_Tec_like, Catalytic domain of Tec-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|223589 COG0515, SPS1, Serine/threonine protein kinase [General function prediction only / Signal transduction mechanisms / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|173660 cd05123, STKc_AGC, Catalytic domain of AGC family Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|143345 cd07840, STKc_CDK9_like, Catalytic domain of Cyclin-Dependent protein Kinase 9-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173733 cd07829, STKc_CDK_like, Catalytic domain of Cyclin-Dependent protein Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|133248 cd05148, PTKc_Srm_Brk, Catalytic domain of the Protein Tyrosine Kinases, Srm and Brk Back     alignment and domain information
>gnl|CDD|173726 cd06610, STKc_OSR1_SPAK, Catalytic domain of the Protein Serine/Threonine Kinases, Oxidative stress response kinase and Ste20-related proline alanine-rich kinase Back     alignment and domain information
>gnl|CDD|132963 cd06632, STKc_MEKK1_plant, Catalytic domain of the Protein Serine/Threonine Kinase, Plant MAP/ERK kinase kinase 1 Back     alignment and domain information
>gnl|CDD|143333 cd05118, STKc_CMGC, Catalytic domain of CMGC family Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173628 cd05038, PTKc_Jak_rpt2, Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>gnl|CDD|132940 cd06609, STKc_MST3_like, Catalytic domain of Mammalian Ste20-like protein kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173757 cd08217, STKc_Nek2, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 2 Back     alignment and domain information
>gnl|CDD|132938 cd06607, STKc_TAO, Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids proteins Back     alignment and domain information
>gnl|CDD|173634 cd05053, PTKc_FGFR, Catalytic domain of the Protein Tyrosine Kinases, Fibroblast Growth Factor Receptors Back     alignment and domain information
>gnl|CDD|133243 cd05112, PTKc_Itk, Catalytic domain of the Protein Tyrosine Kinase, Interleukin-2-inducible T-cell Kinase Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|173742 cd07845, STKc_CDK10, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 10 Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|173633 cd05052, PTKc_Abl, Catalytic domain of the Protein Tyrosine Kinase, Abelson kinase Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|133165 cd05033, PTKc_EphR, Catalytic domain of Ephrin Receptor Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|143338 cd07833, STKc_CDKL, Catalytic domain of Cyclin-Dependent protein Kinase Like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132961 cd06630, STKc_MEKK1, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 1 Back     alignment and domain information
>gnl|CDD|173732 cd06628, STKc_MAPKKK_Byr2_like, Catalytic domain of fungal Byr2-like MAP Kinase Kinase Kinases Back     alignment and domain information
>gnl|CDD|173640 cd05067, PTKc_Lck_Blk, Catalytic domain of the Protein Tyrosine Kinases, Lymphocyte-specific kinase and Blk Back     alignment and domain information
>gnl|CDD|173672 cd05581, STKc_PDK1, Catalytic domain of the Protein Serine/Threonine Kinase, Phosphoinositide-dependent kinase 1 Back     alignment and domain information
>gnl|CDD|173736 cd07832, STKc_CCRK, Catalytic domain of the Serine/Threonine Kinase, Cell Cycle-Related Kinase Back     alignment and domain information
>gnl|CDD|133214 cd05083, PTKc_Chk, Catalytic domain of the Protein Tyrosine Kinase, Csk homologous kinase Back     alignment and domain information
>gnl|CDD|133174 cd05042, PTKc_Aatyk, Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases Back     alignment and domain information
>gnl|CDD|133189 cd05058, PTKc_Met_Ron, Catalytic domain of the Protein Tyrosine Kinases, Met and Ron Back     alignment and domain information
>gnl|CDD|143346 cd07841, STKc_CDK7, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 7 Back     alignment and domain information
>gnl|CDD|133201 cd05070, PTKc_Fyn_Yrk, Catalytic domain of the Protein Tyrosine Kinases, Fyn and Yrk Back     alignment and domain information
>gnl|CDD|173629 cd05041, PTKc_Fes_like, Catalytic domain of Fes-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173739 cd07838, STKc_CDK4_6_like, Catalytic domain of Cyclin-Dependent protein Kinase 4 and 6-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173772 cd08530, STKc_CNK2-like, Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii CNK2, and similar domains Back     alignment and domain information
>gnl|CDD|133211 cd05080, PTKc_Tyk2_rpt2, Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>gnl|CDD|173765 cd08225, STKc_Nek5, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 5 Back     alignment and domain information
>gnl|CDD|132979 cd06648, STKc_PAK_II, Catalytic domain of the Protein Serine/Threonine Kinase, Group II p21-activated kinase Back     alignment and domain information
>gnl|CDD|173738 cd07835, STKc_CDK1_like, Catalytic domain of Cyclin-Dependent protein Kinase 1-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|88330 cd05047, PTKc_Tie, Catalytic domain of Tie Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|173703 cd05612, STKc_PRKX_like, Catalytic domain of PRKX-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|133220 cd05089, PTKc_Tie1, Catalytic domain of the Protein Tyrosine Kinase, Tie1 Back     alignment and domain information
>gnl|CDD|133191 cd05060, PTKc_Syk_like, Catalytic domain of Spleen Tyrosine Kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|133175 cd05043, PTK_Ryk, Pseudokinase domain of Ryk (Receptor related to tyrosine kinase) Back     alignment and domain information
>gnl|CDD|133200 cd05069, PTKc_Yes, Catalytic domain of the Protein Tyrosine Kinase, Yes Back     alignment and domain information
>gnl|CDD|133202 cd05071, PTKc_Src, Catalytic domain of the Protein Tyrosine Kinase, Src Back     alignment and domain information
>gnl|CDD|173658 cd05114, PTKc_Tec_Rlk, Catalytic domain of the Protein Tyrosine Kinases, Tyrosine kinase expressed in hepatocellular carcinoma and Resting lymphocyte kinase Back     alignment and domain information
>gnl|CDD|133167 cd05035, PTKc_Axl_like, Catalytic Domain of Axl-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|133213 cd05082, PTKc_Csk, Catalytic domain of the Protein Tyrosine Kinase, C-terminal Src kinase Back     alignment and domain information
>gnl|CDD|173657 cd05113, PTKc_Btk_Bmx, Catalytic domain of the Protein Tyrosine Kinases, Bruton's tyrosine kinase and Bone marrow kinase on the X chromosome Back     alignment and domain information
>gnl|CDD|133181 cd05050, PTKc_Musk, Catalytic domain of the Protein Tyrosine Kinase, Muscle-specific kinase Back     alignment and domain information
>gnl|CDD|133199 cd05068, PTKc_Frk_like, Catalytic domain of Fyn-related kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173669 cd05578, STKc_Yank1, Catalytic domain of the Protein Serine/Threonine Kinase, Yank1 Back     alignment and domain information
>gnl|CDD|132954 cd06623, PKc_MAPKK_plant_like, Catalytic domain of Plant dual-specificity MAP kinase kinases and similar proteins Back     alignment and domain information
>gnl|CDD|133194 cd05063, PTKc_EphR_A2, Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A2 Back     alignment and domain information
>gnl|CDD|132976 cd06645, STKc_MAP4K3, Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 3 Back     alignment and domain information
>gnl|CDD|173647 cd05091, PTKc_Ror2, Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 2 Back     alignment and domain information
>gnl|CDD|133221 cd05090, PTKc_Ror1, Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 1 Back     alignment and domain information
>gnl|CDD|132960 cd06629, STKc_MAPKKK_Bck1_like, Catalytic domain of fungal Bck1-like MAP Kinase Kinase Kinases Back     alignment and domain information
>gnl|CDD|132964 cd06633, STKc_TAO3, Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 3 Back     alignment and domain information
>gnl|CDD|173764 cd08224, STKc_Nek6_Nek7, Catalytic domain of the Protein Serine/Threonine Kinases, Never In Mitosis gene A-related kinase 6 and 7 Back     alignment and domain information
>gnl|CDD|132956 cd06625, STKc_MEKK3_like, Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173638 cd05065, PTKc_EphR_B, Catalytic domain of the Protein Tyrosine Kinases, Class EphB Ephrin Receptors Back     alignment and domain information
>gnl|CDD|132942 cd06611, STKc_SLK_like, Catalytic domain of Ste20-like kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173641 cd05072, PTKc_Lyn, Catalytic domain of the Protein Tyrosine Kinase, Lyn Back     alignment and domain information
>gnl|CDD|173758 cd08218, STKc_Nek1, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 1 Back     alignment and domain information
>gnl|CDD|132977 cd06646, STKc_MAP4K5, Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 5 Back     alignment and domain information
>gnl|CDD|133227 cd05096, PTKc_DDR1, Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 1 Back     alignment and domain information
>gnl|CDD|133219 cd05088, PTKc_Tie2, Catalytic domain of the Protein Tyrosine Kinase, Tie2 Back     alignment and domain information
>gnl|CDD|133228 cd05097, PTKc_DDR_like, Catalytic domain of Discoidin Domain Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|132991 cd06917, STKc_NAK1_like, Catalytic domain of Fungal Nak1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132965 cd06634, STKc_TAO2, Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 2 Back     alignment and domain information
>gnl|CDD|173761 cd08221, STKc_Nek9, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 9 Back     alignment and domain information
>gnl|CDD|173642 cd05075, PTKc_Axl, Catalytic domain of the Protein Tyrosine Kinase, Axl Back     alignment and domain information
>gnl|CDD|133230 cd05099, PTKc_FGFR4, Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 4 Back     alignment and domain information
>gnl|CDD|173740 cd07842, STKc_CDK8_like, Catalytic domain of Cyclin-Dependent protein Kinase 8-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173723 cd06605, PKc_MAPKK, Catalytic domain of the dual-specificity Protein Kinase, Mitogen-Activated Protein Kinase Kinase Back     alignment and domain information
>gnl|CDD|173670 cd05579, STKc_MAST_like, Catalytic domain of Microtubule-associated serine/threonine kinase-like proteins Back     alignment and domain information
>gnl|CDD|132986 cd06655, STKc_PAK2, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 2 Back     alignment and domain information
>gnl|CDD|143371 cd07866, STKc_BUR1, Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Bypass UAS Requirement 1 and similar proteins Back     alignment and domain information
>gnl|CDD|133209 cd05078, PTK_Jak2_Jak3_rpt1, Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>gnl|CDD|173671 cd05580, STKc_PKA, Catalytic domain of the Protein Serine/Threonine Kinase, cAMP-dependent protein kinase Back     alignment and domain information
>gnl|CDD|132978 cd06647, STKc_PAK_I, Catalytic domain of the Protein Serine/Threonine Kinase, Group I p21-activated kinase Back     alignment and domain information
>gnl|CDD|173754 cd07865, STKc_CDK9, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 9 Back     alignment and domain information
>gnl|CDD|173668 cd05577, STKc_GRK, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase Back     alignment and domain information
>gnl|CDD|173666 cd05575, STKc_SGK, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase Back     alignment and domain information
>gnl|CDD|132952 cd06621, PKc_MAPKK_Pek1_like, Catalytic domain of fungal Pek1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>gnl|CDD|133216 cd05085, PTKc_Fer, Catalytic domain of the Protein Tyrosine Kinase, Fer Back     alignment and domain information
>gnl|CDD|132974 cd06643, STKc_SLK, Catalytic domain of the Protein Serine/Threonine Kinase, Ste20-like kinase Back     alignment and domain information
>gnl|CDD|173743 cd07846, STKc_CDKL2_3, Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 2 and 3 Back     alignment and domain information
>gnl|CDD|132984 cd06653, STKc_MEKK3_like_1, Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173645 cd05084, PTKc_Fes, Catalytic domain of the Protein Tyrosine Kinase, Fes Back     alignment and domain information
>gnl|CDD|133172 cd05040, PTKc_Ack_like, Catalytic domain of the Protein Tyrosine Kinase, Activated Cdc42-associated kinase Back     alignment and domain information
>gnl|CDD|173652 cd05100, PTKc_FGFR3, Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 3 Back     alignment and domain information
>gnl|CDD|173735 cd07831, STKc_MOK, Catalytic domain of the Serine/Threonine Kinase, MAPK/MAK/MRK Overlapping Kinase Back     alignment and domain information
>gnl|CDD|173752 cd07861, STKc_CDK1_euk, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 1 from higher eukaryotes-like Back     alignment and domain information
>gnl|CDD|132966 cd06635, STKc_TAO1, Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 1 Back     alignment and domain information
>gnl|CDD|173639 cd05066, PTKc_EphR_A, Catalytic domain of the Protein Tyrosine Kinases, Class EphA Ephrin Receptors Back     alignment and domain information
>gnl|CDD|173759 cd08219, STKc_Nek3, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 3 Back     alignment and domain information
>gnl|CDD|173643 cd05077, PTK_Jak1_rpt1, Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information
>gnl|CDD|133187 cd05056, PTKc_FAK, Catalytic domain of the Protein Tyrosine Kinase, Focal Adhesion Kinase Back     alignment and domain information
>gnl|CDD|140289 PTZ00263, PTZ00263, protein kinase A catalytic subunit; Provisional Back     alignment and domain information
>gnl|CDD|173648 cd05092, PTKc_TrkA, Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase A Back     alignment and domain information
>gnl|CDD|132970 cd06639, STKc_myosinIIIB, Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIB myosin Back     alignment and domain information
>gnl|CDD|132968 cd06637, STKc_TNIK, Catalytic domain of the Protein Serine/Threonine Kinase, Traf2- and Nck-interacting kinase Back     alignment and domain information
>gnl|CDD|173649 cd05093, PTKc_TrkB, Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase B Back     alignment and domain information
>gnl|CDD|173751 cd07860, STKc_CDK2_3, Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase 2 and 3 Back     alignment and domain information
>gnl|CDD|132982 cd06651, STKc_MEKK3, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 3 Back     alignment and domain information
>gnl|CDD|133212 cd05081, PTKc_Jak2_Jak3_rpt2, Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>gnl|CDD|173680 cd05589, STKc_PKN, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase N Back     alignment and domain information
>gnl|CDD|173665 cd05574, STKc_phototropin_like, Catalytic domain of Phototropin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173753 cd07864, STKc_CDK12, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 12 Back     alignment and domain information
>gnl|CDD|133217 cd05086, PTKc_Aatyk2, Catalytic domain of the Protein Tyrosine Kinase, Apoptosis-associated tyrosine kinase 2 Back     alignment and domain information
>gnl|CDD|132973 cd06642, STKc_STK25-YSK1, Catalytic domain of the Protein Serine/Threonine Kinase, STK25 or Yeast Sps1/Ste20-related kinase 1 Back     alignment and domain information
>gnl|CDD|173763 cd08223, STKc_Nek4, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 4 Back     alignment and domain information
>gnl|CDD|173741 cd07843, STKc_CDC2L1, Catalytic domain of the Serine/Threonine Kinase, Cell Division Cycle 2-like 1 Back     alignment and domain information
>gnl|CDD|143374 cd07869, STKc_PFTAIRE1, Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-1 kinase Back     alignment and domain information
>gnl|CDD|173734 cd07830, STKc_MAK_like, Catalytic domain of Male germ cell-Associated Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|133232 cd05101, PTKc_FGFR2, Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 2 Back     alignment and domain information
>gnl|CDD|219766 pfam08263, LRRNT_2, Leucine rich repeat N-terminal domain Back     alignment and domain information
>gnl|CDD|133229 cd05098, PTKc_FGFR1, Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 1 Back     alignment and domain information
>gnl|CDD|173661 cd05570, STKc_PKC, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase C Back     alignment and domain information
>gnl|CDD|132989 cd06658, STKc_PAK5, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 5 Back     alignment and domain information
>gnl|CDD|143373 cd07868, STKc_CDK8, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 8 Back     alignment and domain information
>gnl|CDD|173770 cd08528, STKc_Nek10, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 10 Back     alignment and domain information
>gnl|CDD|173730 cd06624, STKc_ASK, Catalytic domain of the Protein Serine/Threonine Kinase, Apoptosis signal-regulating kinase Back     alignment and domain information
>gnl|CDD|132967 cd06636, STKc_MAP4K4_6, Catalytic domain of the Protein Serine/Threonine Kinases, Mitogen-Activated Protein Kinase Kinase Kinase Kinase 4 and 6 Back     alignment and domain information
>gnl|CDD|173744 cd07847, STKc_CDKL1_4, Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 1 and 4 Back     alignment and domain information
>gnl|CDD|133168 cd05036, PTKc_ALK_LTK, Catalytic domain of the Protein Tyrosine Kinases, Anaplastic Lymphoma Kinase and Leukocyte Tyrosine Kinase Back     alignment and domain information
>gnl|CDD|177649 PLN00009, PLN00009, cyclin-dependent kinase A; Provisional Back     alignment and domain information
>gnl|CDD|173719 cd05630, STKc_GRK6, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 6 Back     alignment and domain information
>gnl|CDD|132983 cd06652, STKc_MEKK2, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 2 Back     alignment and domain information
>gnl|CDD|173630 cd05044, PTKc_c-ros, Catalytic domain of the Protein Tyrosine Kinase, C-ros Back     alignment and domain information
>gnl|CDD|132947 cd06616, PKc_MKK4, Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 4 Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|173646 cd05087, PTKc_Aatyk1_Aatyk3, Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases 1 and 3 Back     alignment and domain information
>gnl|CDD|173698 cd05607, STKc_GRK7, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 7 Back     alignment and domain information
>gnl|CDD|132972 cd06641, STKc_MST3, Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 3 Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|173675 cd05584, STKc_p70S6K, Catalytic domain of the Protein Serine/Threonine Kinase, 70 kDa ribosomal protein S6 kinase Back     alignment and domain information
>gnl|CDD|143344 cd07839, STKc_CDK5, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 5 Back     alignment and domain information
>gnl|CDD|143349 cd07844, STKc_PCTAIRE_like, Catalytic domain of PCTAIRE-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173636 cd05057, PTKc_EGFR_like, Catalytic domain of Epidermal Growth Factor Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173631 cd05045, PTKc_RET, Catalytic domain of the Protein Tyrosine Kinase, REarranged during Transfection protein Back     alignment and domain information
>gnl|CDD|173632 cd05051, PTKc_DDR, Catalytic domain of the Protein Tyrosine Kinases, Discoidin Domain Receptors Back     alignment and domain information
>gnl|CDD|173650 cd05094, PTKc_TrkC, Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase C Back     alignment and domain information
>gnl|CDD|133186 cd05055, PTKc_PDGFR, Catalytic domain of the Protein Tyrosine Kinases, Platelet Derived Growth Factor Receptors Back     alignment and domain information
>gnl|CDD|132971 cd06640, STKc_MST4, Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 4 Back     alignment and domain information
>gnl|CDD|132975 cd06644, STKc_STK10_LOK, Catalytic domain of the Protein Serine/Threonine Kinase, STK10 or Lymphocyte-oriented kinase Back     alignment and domain information
>gnl|CDD|173656 cd05111, PTK_HER3, Pseudokinase domain of the Protein Tyrosine Kinase, HER3 Back     alignment and domain information
>gnl|CDD|173655 cd05110, PTKc_HER4, Catalytic domain of the Protein Tyrosine Kinase, HER4 Back     alignment and domain information
>gnl|CDD|173674 cd05583, STKc_MSK_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase Back     alignment and domain information
>gnl|CDD|143372 cd07867, STKc_CDC2L6, Catalytic domain of Serine/Threonine Kinase, Cell Division Cycle 2-like 6 Back     alignment and domain information
>gnl|CDD|132987 cd06656, STKc_PAK3, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 3 Back     alignment and domain information
>gnl|CDD|173696 cd05605, STKc_GRK4_like, Catalytic domain of G protein-coupled Receptor Kinase 4-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173769 cd08229, STKc_Nek7, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 7 Back     alignment and domain information
>gnl|CDD|173693 cd05602, STKc_SGK1, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 1 Back     alignment and domain information
>gnl|CDD|173694 cd05603, STKc_SGK2, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 2 Back     alignment and domain information
>gnl|CDD|133205 cd05074, PTKc_Tyro3, Catalytic domain of the Protein Tyrosine Kinase, Tyro3 Back     alignment and domain information
>gnl|CDD|173749 cd07855, STKc_ERK5, Catalytic domain of the Serine/Threonine Kinase, Extracellular signal-Regulated Kinase 5 Back     alignment and domain information
>gnl|CDD|173705 cd05614, STKc_MSK2_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 2 Back     alignment and domain information
>gnl|CDD|133247 cd05116, PTKc_Syk, Catalytic domain of the Protein Tyrosine Kinase, Spleen tyrosine kinase Back     alignment and domain information
>gnl|CDD|173627 cd05037, PTK_Jak_rpt1, Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>gnl|CDD|173681 cd05590, STKc_nPKC_eta, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C eta Back     alignment and domain information
>gnl|CDD|132985 cd06654, STKc_PAK1, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 1 Back     alignment and domain information
>gnl|CDD|132988 cd06657, STKc_PAK4, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 4 Back     alignment and domain information
>gnl|CDD|132962 cd06631, STKc_YSK4, Catalytic domain of the Protein Serine/Threonine Kinase, Yeast Sps1/Ste20-related kinase 4 Back     alignment and domain information
>gnl|CDD|240233 PTZ00024, PTZ00024, cyclin-dependent protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|173651 cd05095, PTKc_DDR2, Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 2 Back     alignment and domain information
>gnl|CDD|143364 cd07859, STKc_TDY_MAPK_plant, Catalytic domain of the Serine/Threonine Kinases, TDY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>gnl|CDD|173625 cd05032, PTKc_InsR_like, Catalytic domain of Insulin Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173747 cd07852, STKc_MAPK15, Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase 15 Back     alignment and domain information
>gnl|CDD|173729 cd06617, PKc_MKK3_6, Catalytic domain of the dual-specificity Protein Kinases, MAP kinase kinases 3 and 6 Back     alignment and domain information
>gnl|CDD|143378 cd07873, STKc_PCTAIRE1, Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-1 kinase Back     alignment and domain information
>gnl|CDD|173679 cd05588, STKc_aPKC, Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C Back     alignment and domain information
>gnl|CDD|173663 cd05572, STKc_cGK_PKG, Catalytic domain of the Protein Serine/Threonine Kinase, cGMP-dependent protein kinase Back     alignment and domain information
>gnl|CDD|143367 cd07862, STKc_CDK6, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 6 Back     alignment and domain information
>gnl|CDD|143376 cd07871, STKc_PCTAIRE3, Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-3 kinase Back     alignment and domain information
>gnl|CDD|173616 PTZ00426, PTZ00426, cAMP-dependent protein kinase catalytic subunit; Provisional Back     alignment and domain information
>gnl|CDD|173721 cd05632, STKc_GRK5, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 5 Back     alignment and domain information
>gnl|CDD|132990 cd06659, STKc_PAK6, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 6 Back     alignment and domain information
>gnl|CDD|143368 cd07863, STKc_CDK4, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 4 Back     alignment and domain information
>gnl|CDD|132969 cd06638, STKc_myosinIIIA, Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIA myosin Back     alignment and domain information
>gnl|CDD|133204 cd05073, PTKc_Hck, Catalytic domain of the Protein Tyrosine Kinase, Hematopoietic cell kinase Back     alignment and domain information
>gnl|CDD|173676 cd05585, STKc_YPK1_like, Catalytic domain of Yeast Protein Kinase 1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173695 cd05604, STKc_SGK3, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 3 Back     alignment and domain information
>gnl|CDD|173684 cd05593, STKc_PKB_gamma, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B gamma Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|143341 cd07836, STKc_Pho85, Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Pho85 Back     alignment and domain information
>gnl|CDD|143377 cd07872, STKc_PCTAIRE2, Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-2 kinase Back     alignment and domain information
>gnl|CDD|173692 cd05601, STKc_CRIK, Catalytic domain of the Protein Serine/Threonine Kinase, Citron Rho-interacting kinase Back     alignment and domain information
>gnl|CDD|173644 cd05079, PTKc_Jak1_rpt2, Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information
>gnl|CDD|173737 cd07834, STKc_MAPK, Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Back     alignment and domain information
>gnl|CDD|173768 cd08228, STKc_Nek6, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 6 Back     alignment and domain information
>gnl|CDD|133246 cd05115, PTKc_Zap-70, Catalytic domain of the Protein Tyrosine Kinase, Zeta-chain-associated protein of 70kDa Back     alignment and domain information
>gnl|CDD|173699 cd05608, STKc_GRK1, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 1 Back     alignment and domain information
>gnl|CDD|173722 cd05633, STKc_GRK3, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 3 Back     alignment and domain information
>gnl|CDD|88519 cd05618, STKc_aPKC_iota, Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C iota Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|143342 cd07837, STKc_CdkB_plant, Catalytic domain of the Serine/Threonine Kinase, Plant B-type Cyclin-Dependent protein Kinase Back     alignment and domain information
>gnl|CDD|173662 cd05571, STKc_PKB, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B Back     alignment and domain information
>gnl|CDD|132949 cd06618, PKc_MKK7, Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 7 Back     alignment and domain information
>gnl|CDD|173686 cd05595, STKc_PKB_beta, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B beta Back     alignment and domain information
>gnl|CDD|173720 cd05631, STKc_GRK4, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 4 Back     alignment and domain information
>gnl|CDD|234389 TIGR03903, TOMM_kin_cyc, TOMM system kinase/cyclase fusion protein Back     alignment and domain information
>gnl|CDD|173756 cd08216, PK_STRAD, Pseudokinase domain of STE20-related kinase adapter protein Back     alignment and domain information
>gnl|CDD|173682 cd05591, STKc_nPKC_epsilon, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C epsilon Back     alignment and domain information
>gnl|CDD|173697 cd05606, STKc_beta_ARK, Catalytic domain of the Protein Serine/Threonine Kinase, beta-adrenergic receptor kinase Back     alignment and domain information
>gnl|CDD|173760 cd08220, STKc_Nek8, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 8 Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|173654 cd05108, PTKc_EGFR, Catalytic domain of the Protein Tyrosine Kinase, Epidermal Growth Factor Receptor Back     alignment and domain information
>gnl|CDD|173701 cd05610, STKc_MASTL, Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine-like kinase Back     alignment and domain information
>gnl|CDD|133207 cd05076, PTK_Tyk2_rpt1, Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|173673 cd05582, STKc_RSK_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, 90 kDa ribosomal protein S6 kinase Back     alignment and domain information
>gnl|CDD|173685 cd05594, STKc_PKB_alpha, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B alpha Back     alignment and domain information
>gnl|CDD|133178 cd05046, PTK_CCK4, Pseudokinase domain of the Protein Tyrosine Kinase, Colon Carcinoma Kinase 4 Back     alignment and domain information
>gnl|CDD|173709 cd05619, STKc_nPKC_theta, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C theta Back     alignment and domain information
>gnl|CDD|173745 cd07848, STKc_CDKL5, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase Like 5 Back     alignment and domain information
>gnl|CDD|173702 cd05611, STKc_Rim15_like, Catalytic domain of fungal Rim15-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173700 cd05609, STKc_MAST, Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine kinase Back     alignment and domain information
>gnl|CDD|133192 cd05061, PTKc_InsR, Catalytic domain of the Protein Tyrosine Kinase, Insulin Receptor Back     alignment and domain information
>gnl|CDD|133238 cd05107, PTKc_PDGFR_beta, Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor beta Back     alignment and domain information
>gnl|CDD|173718 cd05629, STKc_NDR_like_fungal, Catalytic domain of Fungal Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173704 cd05613, STKc_MSK1_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 1 Back     alignment and domain information
>gnl|CDD|133240 cd05109, PTKc_HER2, Catalytic domain of the Protein Tyrosine Kinase, HER2 Back     alignment and domain information
>gnl|CDD|133195 cd05064, PTKc_EphR_A10, Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A10 Back     alignment and domain information
>gnl|CDD|173708 cd05617, STKc_aPKC_zeta, Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C zeta Back     alignment and domain information
>gnl|CDD|133193 cd05062, PTKc_IGF-1R, Catalytic domain of the Protein Tyrosine Kinase, Insulin-like Growth Factor-1 Receptor Back     alignment and domain information
>gnl|CDD|132953 cd06622, PKc_MAPKK_PBS2_like, Catalytic domain of fungal PBS2-like dual-specificity MAP kinase kinases Back     alignment and domain information
>gnl|CDD|143361 cd07856, STKc_Sty1_Hog1, Catalytic domain of the Serine/Threonine Kinases, Fungal Mitogen-Activated Protein Kinases Sty1 and Hog1 Back     alignment and domain information
>gnl|CDD|143363 cd07858, STKc_TEY_MAPK_plant, Catalytic domain of the Serine/Threonine Kinases, TEY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 577
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
KOG1187 361 consensus Serine/threonine protein kinase [Signal 100.0
KOG0595 429 consensus Serine/threonine-protein kinase involved 100.0
KOG0615 475 consensus Serine/threonine protein kinase Chk2 and 99.98
KOG0575 592 consensus Polo-like serine/threonine protein kinas 99.97
KOG0581 364 consensus Mitogen-activated protein kinase kinase 99.97
KOG0192 362 consensus Tyrosine kinase specific for activated ( 99.97
KOG0598 357 consensus Ribosomal protein S6 kinase and related 99.97
KOG0197 468 consensus Tyrosine kinases [Signal transduction me 99.97
KOG0591 375 consensus NIMA (never in mitosis)-related G2-speci 99.97
KOG0600 560 consensus Cdc2-related protein kinase [Cell cycle 99.97
KOG0593 396 consensus Predicted protein kinase KKIAMRE [Genera 99.96
KOG0611 668 consensus Predicted serine/threonine protein kinas 99.96
KOG0616 355 consensus cAMP-dependent protein kinase catalytic 99.96
KOG0659 318 consensus Cdk activating kinase (CAK)/RNA polymera 99.96
KOG1094 807 consensus Discoidin domain receptor DDR1 [Signal t 99.96
KOG0580281 consensus Serine/threonine protein kinase [Cell cy 99.96
KOG1026 774 consensus Nerve growth factor receptor TRKA and re 99.95
KOG0583 370 consensus Serine/threonine protein kinase [Signal 99.95
KOG0592 604 consensus 3-phosphoinositide-dependent protein kin 99.95
KOG0597 808 consensus Serine-threonine protein kinase FUSED [G 99.95
KOG0661 538 consensus MAPK related serine/threonine protein ki 99.95
KOG0663 419 consensus Protein kinase PITSLRE and related kinas 99.95
KOG0198 313 consensus MEKK and related serine/threonine protei 99.95
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.95
KOG0585 576 consensus Ca2+/calmodulin-dependent protein kinase 99.95
KOG0194 474 consensus Protein tyrosine kinase [Signal transduc 99.95
KOG0605 550 consensus NDR and related serine/threonine kinases 99.94
KOG3653 534 consensus Transforming growth factor beta/activin 99.94
KOG0594 323 consensus Protein kinase PCTAIRE and related kinas 99.94
KOG0582 516 consensus Ste20-like serine/threonine protein kina 99.94
KOG0658 364 consensus Glycogen synthase kinase-3 [Carbohydrate 99.94
KOG0196 996 consensus Tyrosine kinase, EPH (ephrin) receptor f 99.94
KOG0588 786 consensus Serine/threonine protein kinase [Cell cy 99.94
KOG0193 678 consensus Serine/threonine protein kinase RAF [Sig 99.94
KOG0578 550 consensus p21-activated serine/threonine protein k 99.94
cd05102 338 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosi 99.94
KOG2052 513 consensus Activin A type IB receptor, serine/threo 99.94
cd05096 304 PTKc_DDR1 Catalytic domain of the Protein Tyrosine 99.94
cd05628 363 STKc_NDR1 Catalytic domain of the Protein Serine/T 99.94
cd05621 370 STKc_ROCK2 Catalytic domain of the Protein Serine/ 99.93
KOG0694 694 consensus Serine/threonine protein kinase [Signal 99.93
PTZ00263 329 protein kinase A catalytic subunit; Provisional 99.93
cd05629 377 STKc_NDR_like_fungal Catalytic domain of Fungal Nu 99.93
cd05612 291 STKc_PRKX_like Catalytic domain of PRKX-like Prote 99.93
cd05600 333 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- 99.93
cd05599 364 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Rel 99.93
PTZ00426 340 cAMP-dependent protein kinase catalytic subunit; P 99.93
cd05626 381 STKc_LATS2 Catalytic domain of the Protein Serine/ 99.93
cd05571 323 STKc_PKB Catalytic domain of the Protein Serine/Th 99.93
KOG1095 1025 consensus Protein tyrosine kinase [Signal transduc 99.93
cd05631 285 STKc_GRK4 Catalytic domain of the Protein Serine/T 99.93
KOG0589 426 consensus Serine/threonine protein kinase [General 99.93
KOG0586 596 consensus Serine/threonine protein kinase [General 99.93
cd05104375 PTKc_Kit Catalytic domain of the Protein Tyrosine 99.93
KOG0599 411 consensus Phosphorylase kinase gamma subunit [Carb 99.93
cd05582 318 STKc_RSK_N N-terminal catalytic domain of the Prot 99.93
cd05593 328 STKc_PKB_gamma Catalytic domain of the Protein Ser 99.93
cd05585 312 STKc_YPK1_like Catalytic domain of Yeast Protein K 99.93
cd05595 323 STKc_PKB_beta Catalytic domain of the Protein Seri 99.93
cd05573 350 STKc_ROCK_NDR_like Catalytic domain of ROCK- and N 99.93
cd05622 371 STKc_ROCK1 Catalytic domain of the Protein Serine/ 99.93
cd05596 370 STKc_ROCK Catalytic domain of the Protein Serine/T 99.93
cd06649 331 PKc_MEK2 Catalytic domain of the dual-specificity 99.93
cd05594 325 STKc_PKB_alpha Catalytic domain of the Protein Ser 99.92
cd05598 376 STKc_LATS Catalytic domain of the Protein Serine/T 99.92
cd05624 331 STKc_MRCK_beta Catalytic domain of the Protein Ser 99.92
cd05625 382 STKc_LATS1 Catalytic domain of the Protein Serine/ 99.92
cd05627 360 STKc_NDR2 Catalytic domain of the Protein Serine/T 99.92
cd05597 331 STKc_DMPK_like Catalytic domain of Myotonic Dystro 99.92
cd05601 330 STKc_CRIK Catalytic domain of the Protein Serine/T 99.92
cd05106374 PTKc_CSF-1R Catalytic domain of the Protein Tyrosi 99.92
KOG4236 888 consensus Serine/threonine protein kinase PKC mu/P 99.92
cd05584 323 STKc_p70S6K Catalytic domain of the Protein Serine 99.92
KOG0574 502 consensus STE20-like serine/threonine kinase MST [ 99.92
PTZ00267 478 NIMA-related protein kinase; Provisional 99.92
KOG0032 382 consensus Ca2+/calmodulin-dependent protein kinase 99.92
cd05614 332 STKc_MSK2_N N-terminal catalytic domain of the Pro 99.92
KOG4250 732 consensus TANK binding protein kinase TBK1 [Signal 99.92
cd05588 329 STKc_aPKC Catalytic domain of the Protein Serine/T 99.92
cd05623 332 STKc_MRCK_alpha Catalytic domain of the Protein Se 99.92
KOG1989 738 consensus ARK protein kinase family [Signal transd 99.92
cd05608 280 STKc_GRK1 Catalytic domain of the Protein Serine/T 99.92
cd05105 400 PTKc_PDGFR_alpha Catalytic domain of the Protein T 99.92
cd05587 324 STKc_cPKC Catalytic domain of the Protein Serine/T 99.92
cd05618 329 STKc_aPKC_iota Catalytic domain of the Protein Ser 99.92
KOG0033 355 consensus Ca2+/calmodulin-dependent protein kinase 99.92
KOG0660 359 consensus Mitogen-activated protein kinase [Signal 99.92
cd06650 333 PKc_MEK1 Catalytic domain of the dual-specificity 99.92
cd07848 287 STKc_CDKL5 Catalytic domain of the Serine/Threonin 99.92
cd05114256 PTKc_Tec_Rlk Catalytic domain of the Protein Tyros 99.92
cd05064266 PTKc_EphR_A10 Catalytic domain of the Protein Tyro 99.92
PTZ00283 496 serine/threonine protein kinase; Provisional 99.92
cd07869 303 STKc_PFTAIRE1 Catalytic domain of the Serine/Threo 99.92
cd07859 338 STKc_TDY_MAPK_plant Catalytic domain of the Serine 99.92
cd05605 285 STKc_GRK4_like Catalytic domain of G protein-coupl 99.92
PLN00034 353 mitogen-activated protein kinase kinase; Provision 99.92
cd05592 316 STKc_nPKC_theta_delta Catalytic domain of the Prot 99.92
cd05591 321 STKc_nPKC_epsilon Catalytic domain of the Protein 99.92
cd07871 288 STKc_PCTAIRE3 Catalytic domain of the Serine/Threo 99.92
cd05616 323 STKc_cPKC_beta Catalytic domain of the Protein Ser 99.92
cd05589 324 STKc_PKN Catalytic domain of the Protein Serine/Th 99.92
cd05590 320 STKc_nPKC_eta Catalytic domain of the Protein Seri 99.92
cd05603 321 STKc_SGK2 Catalytic domain of the Protein Serine/T 99.92
cd05575 323 STKc_SGK Catalytic domain of the Protein Serine/Th 99.91
cd05108 316 PTKc_EGFR Catalytic domain of the Protein Tyrosine 99.91
cd05617 327 STKc_aPKC_zeta Catalytic domain of the Protein Ser 99.91
cd05619 316 STKc_nPKC_theta Catalytic domain of the Protein Se 99.91
cd05604 325 STKc_SGK3 Catalytic domain of the Protein Serine/T 99.91
cd05602 325 STKc_SGK1 Catalytic domain of the Protein Serine/T 99.91
cd05068261 PTKc_Frk_like Catalytic domain of Fyn-related kina 99.91
KOG0610 459 consensus Putative serine/threonine protein kinase 99.91
KOG4278 1157 consensus Protein tyrosine kinase [Signal transduc 99.91
KOG0662 292 consensus Cyclin-dependent kinase CDK5 [Intracellu 99.91
PHA03212 391 serine/threonine kinase US3; Provisional 99.91
cd05113256 PTKc_Btk_Bmx Catalytic domain of the Protein Tyros 99.91
cd05620 316 STKc_nPKC_delta Catalytic domain of the Protein Se 99.91
KOG4721 904 consensus Serine/threonine protein kinase, contain 99.91
KOG1025 1177 consensus Epidermal growth factor receptor EGFR an 99.91
cd05059256 PTKc_Tec_like Catalytic domain of Tec-like Protein 99.91
cd05615 323 STKc_cPKC_alpha Catalytic domain of the Protein Se 99.91
cd05072261 PTKc_Lyn Catalytic domain of the Protein Tyrosine 99.91
cd07862 290 STKc_CDK6 Catalytic domain of the Serine/Threonine 99.91
PHA02988283 hypothetical protein; Provisional 99.91
cd07853 372 STKc_NLK Catalytic domain of the Serine/Threonine 99.91
PRK13184 932 pknD serine/threonine-protein kinase; Reviewed 99.91
KOG0584 632 consensus Serine/threonine protein kinase [General 99.91
cd05107401 PTKc_PDGFR_beta Catalytic domain of the Protein Ty 99.91
cd05081 284 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of 99.91
KOG0201 467 consensus Serine/threonine protein kinase [Signal 99.91
KOG0577 948 consensus Serine/threonine protein kinase [Signal 99.91
cd05095 296 PTKc_DDR2 Catalytic domain of the Protein Tyrosine 99.91
PF07714259 Pkinase_Tyr: Protein tyrosine kinase Protein kinas 99.91
cd06615 308 PKc_MEK Catalytic domain of the dual-specificity P 99.91
cd05075272 PTKc_Axl Catalytic domain of the Protein Tyrosine 99.91
cd05033266 PTKc_EphR Catalytic domain of Ephrin Receptor Prot 99.91
cd05570 318 STKc_PKC Catalytic domain of the Protein Serine/Th 99.91
cd05042 269 PTKc_Aatyk Catalytic domain of the Protein Tyrosin 99.91
cd08228267 STKc_Nek6 Catalytic domain of the Protein Serine/T 99.91
cd05066267 PTKc_EphR_A Catalytic domain of the Protein Tyrosi 99.91
cd05084252 PTKc_Fes Catalytic domain of the Protein Tyrosine 99.91
cd05097 295 PTKc_DDR_like Catalytic domain of Discoidin Domain 99.91
cd05090283 PTKc_Ror1 Catalytic domain of the Protein Tyrosine 99.91
cd05035273 PTKc_Axl_like Catalytic Domain of Axl-like Protein 99.91
cd05062277 PTKc_IGF-1R Catalytic domain of the Protein Tyrosi 99.9
cd05610 669 STKc_MASTL Catalytic domain of the Protein Serine/ 99.9
cd05586 330 STKc_Sck1_like Catalytic domain of Suppressor of l 99.9
cd05607 277 STKc_GRK7 Catalytic domain of the Protein Serine/T 99.9
cd05632 285 STKc_GRK5 Catalytic domain of the Protein Serine/T 99.9
cd05103 343 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosi 99.9
cd05053293 PTKc_FGFR Catalytic domain of the Protein Tyrosine 99.9
cd08224267 STKc_Nek6_Nek7 Catalytic domain of the Protein Ser 99.9
cd05051 296 PTKc_DDR Catalytic domain of the Protein Tyrosine 99.9
cd05630 285 STKc_GRK6 Catalytic domain of the Protein Serine/T 99.9
KOG0690 516 consensus Serine/threonine protein kinase [Signal 99.9
cd05054 337 PTKc_VEGFR Catalytic domain of the Protein Tyrosin 99.9
cd05052263 PTKc_Abl Catalytic domain of the Protein Tyrosine 99.9
cd05087 269 PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein 99.9
cd05148261 PTKc_Srm_Brk Catalytic domain of the Protein Tyros 99.9
cd05061 288 PTKc_InsR Catalytic domain of the Protein Tyrosine 99.9
cd05071262 PTKc_Src Catalytic domain of the Protein Tyrosine 99.9
cd08529256 STKc_FA2-like Catalytic domain of the Protein Seri 99.9
PF00069260 Pkinase: Protein kinase domain Protein kinase; unc 99.9
cd05093 288 PTKc_TrkB Catalytic domain of the Protein Tyrosine 99.9
cd05580 290 STKc_PKA Catalytic domain of the Protein Serine/Th 99.9
cd08221256 STKc_Nek9 Catalytic domain of the Protein Serine/T 99.9
cd06646267 STKc_MAP4K5 Catalytic domain of the Protein Serine 99.9
cd05067260 PTKc_Lck_Blk Catalytic domain of the Protein Tyros 99.9
cd06619 279 PKc_MKK5 Catalytic domain of the dual-specificity 99.9
cd05086 268 PTKc_Aatyk2 Catalytic domain of the Protein Tyrosi 99.9
PTZ00036 440 glycogen synthase kinase; Provisional 99.9
cd05088 303 PTKc_Tie2 Catalytic domain of the Protein Tyrosine 99.9
cd05070260 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyros 99.9
cd05048283 PTKc_Ror Catalytic Domain of the Protein Tyrosine 99.9
cd05049280 PTKc_Trk Catalytic domain of the Protein Tyrosine 99.9
cd07872 309 STKc_PCTAIRE2 Catalytic domain of the Serine/Threo 99.9
cd05116257 PTKc_Syk Catalytic domain of the Protein Tyrosine 99.9
KOG2345 302 consensus Serine/threonine protein kinase/TGF-beta 99.9
cd05034261 PTKc_Src_like Catalytic domain of Src kinase-like 99.9
cd05111 279 PTK_HER3 Pseudokinase domain of the Protein Tyrosi 99.9
cd05115257 PTKc_Zap-70 Catalytic domain of the Protein Tyrosi 99.9
KOG0666 438 consensus Cyclin C-dependent kinase CDK8 [Transcri 99.9
cd07876 359 STKc_JNK2 Catalytic domain of the Serine/Threonine 99.9
cd05069260 PTKc_Yes Catalytic domain of the Protein Tyrosine 99.9
cd05032277 PTKc_InsR_like Catalytic domain of Insulin Recepto 99.9
cd05101 304 PTKc_FGFR2 Catalytic domain of the Protein Tyrosin 99.9
cd05085250 PTKc_Fer Catalytic domain of the Protein Tyrosine 99.9
cd07847 286 STKc_CDKL1_4 Catalytic domain of the Serine/Threon 99.9
cd06638286 STKc_myosinIIIA Catalytic domain of the Protein Se 99.9
cd05039256 PTKc_Csk_like Catalytic domain of C-terminal Src k 99.9
PTZ00266 1021 NIMA-related protein kinase; Provisional 99.9
cd07878 343 STKc_p38beta_MAPK11 Catalytic domain of the Serine 99.9
cd05045 290 PTKc_RET Catalytic domain of the Protein Tyrosine 99.9
cd05089 297 PTKc_Tie1 Catalytic domain of the Protein Tyrosine 99.9
cd05091283 PTKc_Ror2 Catalytic domain of the Protein Tyrosine 99.9
cd06622 286 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS 99.9
cd05055302 PTKc_PDGFR Catalytic domain of the Protein Tyrosin 99.9
cd05079 284 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the 99.9
PHA03211 461 serine/threonine kinase US3; Provisional 99.89
cd05109 279 PTKc_HER2 Catalytic domain of the Protein Tyrosine 99.89
cd05076274 PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of th 99.89
cd05098 307 PTKc_FGFR1 Catalytic domain of the Protein Tyrosin 99.89
cd08229267 STKc_Nek7 Catalytic domain of the Protein Serine/T 99.89
cd05073260 PTKc_Hck Catalytic domain of the Protein Tyrosine 99.89
cd05063268 PTKc_EphR_A2 Catalytic domain of the Protein Tyros 99.89
cd06617 283 PKc_MKK3_6 Catalytic domain of the dual-specificit 99.89
cd06625263 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase 99.89
cd06632258 STKc_MEKK1_plant Catalytic domain of the Protein S 99.89
cd05036277 PTKc_ALK_LTK Catalytic domain of the Protein Tyros 99.89
cd06631 265 STKc_YSK4 Catalytic domain of the Protein Serine/T 99.89
cd07861 285 STKc_CDK1_euk Catalytic domain of the Serine/Threo 99.89
KOG0612 1317 consensus Rho-associated, coiled-coil containing p 99.89
cd05065 269 PTKc_EphR_B Catalytic domain of the Protein Tyrosi 99.89
cd05080 283 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the 99.89
cd05043 280 PTK_Ryk Pseudokinase domain of Ryk (Receptor relat 99.89
cd05094 291 PTKc_TrkC Catalytic domain of the Protein Tyrosine 99.89
cd07874 355 STKc_JNK3 Catalytic domain of the Serine/Threonine 99.89
KOG4257 974 consensus Focal adhesion tyrosine kinase FAK, cont 99.89
cd07841 298 STKc_CDK7 Catalytic domain of the Serine/Threonine 99.89
cd06637272 STKc_TNIK Catalytic domain of the Protein Serine/T 99.89
cd05099 314 PTKc_FGFR4 Catalytic domain of the Protein Tyrosin 99.89
cd05037259 PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the 99.89
cd05047270 PTKc_Tie Catalytic domain of Tie Protein Tyrosine 99.89
cd05050288 PTKc_Musk Catalytic domain of the Protein Tyrosine 99.89
cd06656 297 STKc_PAK3 Catalytic domain of the Protein Serine/T 99.89
cd08227 327 PK_STRAD_alpha Pseudokinase domain of STE20-relate 99.89
KOG4717 864 consensus Serine/threonine protein kinase [Signal 99.89
KOG0667 586 consensus Dual-specificity tyrosine-phosphorylatio 99.89
PHA03209 357 serine/threonine kinase US3; Provisional 99.89
cd00192262 PTKc Catalytic domain of Protein Tyrosine Kinases. 99.89
cd05057 279 PTKc_EGFR_like Catalytic domain of Epidermal Growt 99.89
cd08217265 STKc_Nek2 Catalytic domain of the Protein Serine/T 99.89
cd06643 282 STKc_SLK Catalytic domain of the Protein Serine/Th 99.89
cd05046275 PTK_CCK4 Pseudokinase domain of the Protein Tyrosi 99.89
cd06645267 STKc_MAP4K3 Catalytic domain of the Protein Serine 99.89
cd07875 364 STKc_JNK1 Catalytic domain of the Serine/Threonine 99.89
cd05112256 PTKc_Itk Catalytic domain of the Protein Tyrosine 99.89
cd05040257 PTKc_Ack_like Catalytic domain of the Protein Tyro 99.89
PRK09188 365 serine/threonine protein kinase; Provisional 99.89
cd05609 305 STKc_MAST Catalytic domain of the Protein Serine/T 99.89
cd07863 288 STKc_CDK4 Catalytic domain of the Serine/Threonine 99.89
cd07832 286 STKc_CCRK Catalytic domain of the Serine/Threonine 99.89
cd05041251 PTKc_Fes_like Catalytic domain of Fes-like Protein 99.89
cd05100 334 PTKc_FGFR3 Catalytic domain of the Protein Tyrosin 99.89
cd07846 286 STKc_CDKL2_3 Catalytic domain of the Serine/Threon 99.89
cd06620 284 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr 99.89
cd06652265 STKc_MEKK2 Catalytic domain of the Protein Serine/ 99.89
KOG0607 463 consensus MAP kinase-interacting kinase and relate 99.89
cd06621 287 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek 99.89
cd08223257 STKc_Nek4 Catalytic domain of the Protein Serine/T 99.89
cd06654 296 STKc_PAK1 Catalytic domain of the Protein Serine/T 99.89
KOG0579 1187 consensus Ste20-like serine/threonine protein kina 99.89
cd06611 280 STKc_SLK_like Catalytic domain of Ste20-like kinas 99.89
cd08219255 STKc_Nek3 Catalytic domain of the Protein Serine/T 99.89
cd05633 279 STKc_GRK3 Catalytic domain of the Protein Serine/T 99.89
cd05092280 PTKc_TrkA Catalytic domain of the Protein Tyrosine 99.89
cd05038 284 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the P 99.89
cd08218256 STKc_Nek1 Catalytic domain of the Protein Serine/T 99.89
cd06628267 STKc_MAPKKK_Byr2_like Catalytic domain of fungal B 99.89
cd06639 291 STKc_myosinIIIB Catalytic domain of the Protein Se 99.89
cd05060257 PTKc_Syk_like Catalytic domain of Spleen Tyrosine 99.89
KOG0986 591 consensus G protein-coupled receptor kinase [Signa 99.89
cd05578258 STKc_Yank1 Catalytic domain of the Protein Serine/ 99.89
cd05082256 PTKc_Csk Catalytic domain of the Protein Tyrosine 99.89
cd06644 292 STKc_STK10_LOK Catalytic domain of the Protein Ser 99.88
cd07873 301 STKc_PCTAIRE1 Catalytic domain of the Serine/Threo 99.88
cd05077262 PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of th 99.88
cd06626 264 STKc_MEKK4 Catalytic domain of the Protein Serine/ 99.88
cd06624268 STKc_ASK Catalytic domain of the Protein Serine/Th 99.88
cd05574 316 STKc_phototropin_like Catalytic domain of Phototro 99.88
PHA03207 392 serine/threonine kinase US3; Provisional 99.88
cd07868 317 STKc_CDK8 Catalytic domain of the Serine/Threonine 99.88
cd05074273 PTKc_Tyro3 Catalytic domain of the Protein Tyrosin 99.88
cd06651266 STKc_MEKK3 Catalytic domain of the Protein Serine/ 99.88
cd07844 291 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like 99.88
cd05147190 RIO1_euk RIO kinase family; eukaryotic RIO1, catal 99.88
cd05058 262 PTKc_Met_Ron Catalytic domain of the Protein Tyros 99.88
cd06629 272 STKc_MAPKKK_Bck1_like Catalytic domain of fungal B 99.88
cd07839 284 STKc_CDK5 Catalytic domain of the Serine/Threonine 99.88
cd07870 291 STKc_PFTAIRE2 Catalytic domain of the Serine/Threo 99.88
cd05606 278 STKc_beta_ARK Catalytic domain of the Protein Seri 99.88
cd05056 270 PTKc_FAK Catalytic domain of the Protein Tyrosine 99.88
cd06612256 STKc_MST1_2 Catalytic domain of the Protein Serine 99.88
KOG0199 1039 consensus ACK and related non-receptor tyrosine ki 99.88
cd05083254 PTKc_Chk Catalytic domain of the Protein Tyrosine 99.88
cd07833 288 STKc_CDKL Catalytic domain of Cyclin-Dependent pro 99.88
cd05613 290 STKc_MSK1_N N-terminal catalytic domain of the Pro 99.88
cd06613262 STKc_MAP4K3_like Catalytic domain of Mitogen-activ 99.88
cd07860 284 STKc_CDK2_3 Catalytic domain of the Serine/Threoni 99.88
cd06627254 STKc_Cdc7_like Catalytic domain of Cell division c 99.88
cd08530256 STKc_CNK2-like Catalytic domain of the Protein Ser 99.88
cd07843 293 STKc_CDC2L1 Catalytic domain of the Serine/Threoni 99.88
cd05110 303 PTKc_HER4 Catalytic domain of the Protein Tyrosine 99.88
cd06630 268 STKc_MEKK1 Catalytic domain of the Protein Serine/ 99.88
KOG1152772 consensus Signal transduction serine/threonine kin 99.88
cd06623 264 PKc_MAPKK_plant_like Catalytic domain of Plant dua 99.88
cd08528269 STKc_Nek10 Catalytic domain of the Protein Serine/ 99.88
cd07837 295 STKc_CdkB_plant Catalytic domain of the Serine/Thr 99.88
cd06605 265 PKc_MAPKK Catalytic domain of the dual-specificity 99.88
cd08220256 STKc_Nek8 Catalytic domain of the Protein Serine/T 99.88
cd08215258 STKc_Nek Catalytic domain of the Protein Serine/Th 99.88
smart00219258 TyrKc Tyrosine kinase, catalytic domain. Phosphotr 99.88
cd06642 277 STKc_STK25-YSK1 Catalytic domain of the Protein Se 99.88
cd06641 277 STKc_MST3 Catalytic domain of the Protein Serine/T 99.88
cd06640 277 STKc_MST4 Catalytic domain of the Protein Serine/T 99.87
cd06655 296 STKc_PAK2 Catalytic domain of the Protein Serine/T 99.87
cd05044269 PTKc_c-ros Catalytic domain of the Protein Tyrosin 99.87
cd06609 274 STKc_MST3_like Catalytic domain of Mammalian Ste20 99.87
cd07842 316 STKc_CDK8_like Catalytic domain of Cyclin-Dependen 99.87
cd06658 292 STKc_PAK5 Catalytic domain of the Protein Serine/T 99.87
PHA03210 501 serine/threonine kinase US3; Provisional 99.87
KOG1035 1351 consensus eIF-2alpha kinase GCN2 [Translation, rib 99.87
cd07867 317 STKc_CDC2L6 Catalytic domain of Serine/Threonine K 99.87
cd06610 267 STKc_OSR1_SPAK Catalytic domain of the Protein Ser 99.87
cd06608275 STKc_myosinIII_like Catalytic domain of Class III 99.87
cd05078258 PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain 99.87
cd06653264 STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kina 99.87
cd07877 345 STKc_p38alpha_MAPK14 Catalytic domain of the Serin 99.87
cd05577 277 STKc_GRK Catalytic domain of the Protein Serine/Th 99.87
cd05572 262 STKc_cGK_PKG Catalytic domain of the Protein Serin 99.87
cd07864 302 STKc_CDK12 Catalytic domain of the Serine/Threonin 99.87
cd06917 277 STKc_NAK1_like Catalytic domain of Fungal Nak1-lik 99.87
PLN00009 294 cyclin-dependent kinase A; Provisional 99.87
cd06606260 STKc_MAPKKK Catalytic domain of the Protein Serine 99.87
KOG0984282 consensus Mitogen-activated protein kinase (MAPK) 99.87
cd05579 265 STKc_MAST_like Catalytic domain of Microtubule-ass 99.87
cd08225257 STKc_Nek5 Catalytic domain of the Protein Serine/T 99.87
cd06636282 STKc_MAP4K4_6 Catalytic domain of the Protein Seri 99.87
cd07836 284 STKc_Pho85 Catalytic domain of the Serine/Threonin 99.87
cd05145190 RIO1_like RIO kinase family; RIO1, RIO3 and simila 99.87
cd07880 343 STKc_p38gamma_MAPK12 Catalytic domain of the Serin 99.87
PTZ00284 467 protein kinase; Provisional 99.87
KOG1151 775 consensus Tousled-like protein kinase [Signal tran 99.87
cd06607 307 STKc_TAO Catalytic domain of the Protein Serine/Th 99.87
KOG0669 376 consensus Cyclin T-dependent kinase CDK9 [Cell cyc 99.87
cd06647 293 STKc_PAK_I Catalytic domain of the Protein Serine/ 99.87
cd06659 297 STKc_PAK6 Catalytic domain of the Protein Serine/T 99.86
KOG4645 1509 consensus MAPKKK (MAP kinase kinase kinase) SSK2 a 99.86
cd07865 310 STKc_CDK9 Catalytic domain of the Serine/Threonine 99.86
cd07840 287 STKc_CDK9_like Catalytic domain of Cyclin-Dependen 99.86
cd05581 280 STKc_PDK1 Catalytic domain of the Protein Serine/T 99.86
cd07845 309 STKc_CDK10 Catalytic domain of the Serine/Threonin 99.86
cd07835 283 STKc_CDK1_like Catalytic domain of Cyclin-Dependen 99.86
KOG4279 1226 consensus Serine/threonine protein kinase [Signal 99.86
KOG0587 953 consensus Traf2- and Nck-interacting kinase and re 99.86
cd07855 334 STKc_ERK5 Catalytic domain of the Serine/Threonine 99.86
cd07850 353 STKc_JNK Catalytic domain of the Serine/Threonine 99.86
cd05122253 PKc_STE Catalytic domain of STE family Protein Kin 99.86
cd07856 328 STKc_Sty1_Hog1 Catalytic domain of the Serine/Thre 99.86
cd08226 328 PK_STRAD_beta Pseudokinase domain of STE20-related 99.86
KOG0608 1034 consensus Warts/lats-like serine threonine kinases 99.86
cd07852 337 STKc_MAPK15 Catalytic domain of the Serine/Threoni 99.86
cd05611 260 STKc_Rim15_like Catalytic domain of fungal Rim15-l 99.86
cd06614 286 STKc_PAK Catalytic domain of the Protein Serine/Th 99.86
PLN03224 507 probable serine/threonine protein kinase; Provisio 99.86
KOG0664 449 consensus Nemo-like MAPK-related serine/threonine 99.86
cd06657 292 STKc_PAK4 Catalytic domain of the Protein Serine/T 99.86
cd05583 288 STKc_MSK_N N-terminal catalytic domain of the Prot 99.86
cd06635 317 STKc_TAO1 Catalytic domain of the Protein Serine/T 99.85
cd07834 330 STKc_MAPK Catalytic domain of the Serine/Threonine 99.85
cd07831 282 STKc_MOK Catalytic domain of the Serine/Threonine 99.85
cd08216 314 PK_STRAD Pseudokinase domain of STE20-related kina 99.85
KOG0200 609 consensus Fibroblast/platelet-derived growth facto 99.85
cd06648 285 STKc_PAK_II Catalytic domain of the Protein Serine 99.85
cd07849 336 STKc_ERK1_2_like Catalytic domain of Extracellular 99.85
cd07858 337 STKc_TEY_MAPK_plant Catalytic domain of the Serine 99.85
cd07838 287 STKc_CDK4_6_like Catalytic domain of Cyclin-Depend 99.85
cd07857 332 STKc_MPK1 Catalytic domain of the Serine/Threonine 99.85
PTZ00024 335 cyclin-dependent protein kinase; Provisional 99.85
cd06616 288 PKc_MKK4 Catalytic domain of the dual-specificity 99.85
KOG0983 391 consensus Mitogen-activated protein kinase (MAPK) 99.84
PLN03150623 hypothetical protein; Provisional 99.84
cd07830 283 STKc_MAK_like Catalytic domain of Male germ cell-A 99.84
cd07879 342 STKc_p38delta_MAPK13 Catalytic domain of the Serin 99.84
cd05123250 STKc_AGC Catalytic domain of AGC family Protein Se 99.84
PHA03390267 pk1 serine/threonine-protein kinase 1; Provisional 99.84
cd07866 311 STKc_BUR1 Catalytic domain of the Serine/Threonine 99.84
cd05118 283 STKc_CMGC Catalytic domain of CMGC family Serine/T 99.84
cd08222260 STKc_Nek11 Catalytic domain of the Protein Serine/ 99.84
cd07829 282 STKc_CDK_like Catalytic domain of Cyclin-Dependent 99.84
cd07851 343 STKc_p38 Catalytic domain of the Serine/Threonine 99.84
cd06633 313 STKc_TAO3 Catalytic domain of the Protein Serine/T 99.84
PHA02882 294 putative serine/threonine kinase; Provisional 99.83
cd06634 308 STKc_TAO2 Catalytic domain of the Protein Serine/T 99.83
KOG0614 732 consensus cGMP-dependent protein kinase [Signal tr 99.83
KOG1006 361 consensus Mitogen-activated protein kinase (MAPK) 99.83
cd06618 296 PKc_MKK7 Catalytic domain of the dual-specificity 99.83
KOG0696 683 consensus Serine/threonine protein kinase [Signal 99.83
KOG0604 400 consensus MAP kinase-activated protein kinase 2 [S 99.83
KOG0695 593 consensus Serine/threonine protein kinase [Signal 99.82
PRK10345210 hypothetical protein; Provisional 99.82
KOG0668 338 consensus Casein kinase II, alpha subunit [Signal 99.82
cd07854 342 STKc_MAPK4_6 Catalytic domain of the Serine/Threon 99.82
KOG0596 677 consensus Dual specificity; serine/threonine and t 99.82
cd05576237 STKc_RPK118_like Catalytic domain of the Protein S 99.81
KOG1345 378 consensus Serine/threonine kinase [Signal transduc 99.81
KOG0576 829 consensus Mitogen-activated protein kinase kinase 99.81
smart00221225 STYKc Protein kinase; unclassified specificity. Ph 99.8
PLN03225 566 Serine/threonine-protein kinase SNT7; Provisional 99.79
KOG0617264 consensus Ras suppressor protein (contains leucine 99.79
smart00090237 RIO RIO-like kinase. 99.78
cd00180215 PKc Catalytic domain of Protein Kinases. Protein K 99.78
PRK12274218 serine/threonine protein kinase; Provisional 99.78
cd05144198 RIO2_C RIO kinase family; RIO2, C-terminal catalyt 99.77
PRK14879211 serine/threonine protein kinase; Provisional 99.77
KOG1024 563 consensus Receptor-like protein tyrosine kinase RY 99.77
PRK10359232 lipopolysaccharide core biosynthesis protein; Prov 99.77
PRK09605535 bifunctional UGMP family protein/serine/threonine 99.76
smart00220244 S_TKc Serine/Threonine protein kinases, catalytic 99.76
KOG1165 449 consensus Casein kinase (serine/threonine/tyrosine 99.75
TIGR03724199 arch_bud32 Kae1-associated kinase Bud32. Members o 99.75
KOG1163 341 consensus Casein kinase (serine/threonine/tyrosine 99.75
KOG1027 903 consensus Serine/threonine protein kinase and endo 99.75
KOG0671 415 consensus LAMMER dual specificity kinases [Signal 99.74
KOG0603 612 consensus Ribosomal protein S6 kinase [Signal tran 99.73
KOG1290 590 consensus Serine/threonine protein kinase [Signal 99.71
KOG0665 369 consensus Jun-N-terminal kinase (JNK) [Signal tran 99.7
cd05119187 RIO RIO kinase family, catalytic domain. The RIO k 99.69
KOG1167 418 consensus Serine/threonine protein kinase of the C 99.68
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.68
KOG1164 322 consensus Casein kinase (serine/threonine/tyrosine 99.68
cd05120155 APH_ChoK_like Aminoglycoside 3'-phosphotransferase 99.68
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.66
PRK01723239 3-deoxy-D-manno-octulosonic-acid kinase; Reviewed 99.66
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.64
COG0515 384 SPS1 Serine/threonine protein kinase [General func 99.64
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 99.61
KOG4237498 consensus Extracellular matrix protein slit, conta 99.6
KOG0617264 consensus Ras suppressor protein (contains leucine 99.59
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.58
KOG0670 752 consensus U4/U6-associated splicing factor PRP4 [R 99.57
TIGR01982 437 UbiB 2-polyprenylphenol 6-hydroxylase. This model 99.53
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.52
KOG1166 974 consensus Mitotic checkpoint serine/threonine prot 99.52
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 99.5
PRK15387788 E3 ubiquitin-protein ligase SspH2; Provisional 99.49
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.47
PRK15387788 E3 ubiquitin-protein ligase SspH2; Provisional 99.46
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.44
PRK04750 537 ubiB putative ubiquinone biosynthesis protein UbiB 99.42
KOG0195448 consensus Integrin-linked kinase [Signal transduct 99.38
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.37
KOG0590 601 consensus Checkpoint kinase and related serine/thr 99.35
cd05151170 ChoK Choline Kinase (ChoK). The ChoK subfamily is 99.35
KOG0603 612 consensus Ribosomal protein S6 kinase [Signal tran 99.32
PLN032101153 Resistant to P. syringae 6; Provisional 99.32
PLN00181 793 protein SPA1-RELATED; Provisional 99.3
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.3
cd05146197 RIO3_euk RIO kinase family; eukaryotic RIO3, catal 99.28
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.26
cd05154223 ACAD10_11_like Acyl-CoA dehydrogenase (ACAD) 10 an 99.24
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.23
PLN03150623 hypothetical protein; Provisional 99.22
COG3642204 Mn2+-dependent serine/threonine protein kinase [Si 99.21
PLN032101153 Resistant to P. syringae 6; Provisional 99.21
KOG4158 598 consensus BRPK/PTEN-induced protein kinase [Signal 99.2
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.16
KOG3087229 consensus Serine/threonine protein kinase [General 99.14
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.12
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.11
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.1
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.09
PF14531288 Kinase-like: Kinase-like; PDB: 3DZO_A 2W1Z_A 3BYV_ 99.09
KOG1240 1431 consensus Protein kinase containing WD40 repeats [ 99.08
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.05
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 99.05
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.0
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.99
KOG1023 484 consensus Natriuretic peptide receptor, guanylate 98.99
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.98
PRK15123268 lipopolysaccharide core heptose(I) kinase RfaP; Pr 98.96
PF01163188 RIO1: RIO1 family; InterPro: IPR018934 Protein pho 98.94
KOG4237498 consensus Extracellular matrix protein slit, conta 98.92
KOG0590 601 consensus Checkpoint kinase and related serine/thr 98.86
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.71
KOG0601524 consensus Cyclin-dependent kinase WEE1 [Cell cycle 98.7
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.67
KOG0606 1205 consensus Microtubule-associated serine/threonine 98.66
PF0826343 LRRNT_2: Leucine rich repeat N-terminal domain; In 98.61
KOG1243 690 consensus Protein kinase [General function predict 98.61
PF06293206 Kdo: Lipopolysaccharide kinase (Kdo/WaaP) family; 98.58
COG0661 517 AarF Predicted unusual protein kinase [General fun 98.56
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.51
smart00750 176 KIND kinase non-catalytic C-lobe domain. It is an 98.49
COG0478304 RIO-like serine/threonine protein kinase fused to 98.49
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.48
KOG0601 524 consensus Cyclin-dependent kinase WEE1 [Cell cycle 98.46
KOG1266 458 consensus Protein kinase [Signal transduction mech 98.44
TIGR02172226 Fb_sc_TIGR02172 Fibrobacter succinogenes paralogou 98.42
KOG3741 655 consensus Poly(A) ribonuclease subunit [RNA proces 98.38
PRK09902216 hypothetical protein; Provisional 98.36
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.36
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.33
KOG1235 538 consensus Predicted unusual protein kinase [Genera 98.23
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.22
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.21
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.21
COG1718268 RIO1 Serine/threonine protein kinase involved in c 98.18
cd05150244 APH Aminoglycoside 3'-phosphotransferase (APH). Th 98.14
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.13
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
Probab=100.00  E-value=4.6e-47  Score=443.26  Aligned_cols=417  Identities=28%  Similarity=0.442  Sum_probs=288.5

Q ss_pred             CcEEEEEcCCCCCcccccccccCCCCCCEEEccCCCcCCcCCCCCC--CCccEEEccCCcCCCcCCCCccCCCCccEEEe
Q 008107           83 SAVVSIDISGLGLSGTMGYLLSDLLSLRKFDLSGNSIHDTIPYQLP--PNLTSLNLASNNFSGNLPYSIASMVSLSYLNV  160 (577)
Q Consensus        83 ~~v~~l~l~~~~l~g~~~~~~~~l~~L~~L~Ls~N~l~~~~p~~~~--~~L~~L~l~~N~l~~~~p~~~~~l~~L~~L~L  160 (577)
                      ..++.|+|++|+++|.+|..+..++.|+.|+|++|++++.+|..+.  ++|+.|+|++|++.+.+|..++ +++|+.|+|
T Consensus       404 ~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~~~~~~~l~~L~~L~L~~n~~~~~~p~~~~-~~~L~~L~l  482 (968)
T PLN00113        404 RSLRRVRLQDNSFSGELPSEFTKLPLVYFLDISNNNLQGRINSRKWDMPSLQMLSLARNKFFGGLPDSFG-SKRLENLDL  482 (968)
T ss_pred             CCCCEEECcCCEeeeECChhHhcCCCCCEEECcCCcccCccChhhccCCCCcEEECcCceeeeecCcccc-cccceEEEC
Confidence            5788999999999999999999999999999999999988886543  8899999999999988887664 588999999


Q ss_pred             ccCCCcccccccccCCCCCcEEeCcCCcccCCCCCCccCCCCCCeEEccCcccccccc-cCCCCC-ccEEEeecCccccc
Q 008107          161 SRNSLTQSIGDIFGNLAGLATLDLSFNNFSGDLPNSFISLSNISSLYLQNNQVTGSLN-VFSGLP-LTTLNVANNHFSGW  238 (577)
Q Consensus       161 ~~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~g~~p~~~~~l~~L~~L~l~~N~l~~~~~-~~~~~~-L~~L~l~~N~l~g~  238 (577)
                      ++|++++.+|..|.++++|+.|+|++|+++|.+|..+..+++|++|+|++|.+++.++ .+..++ |+.|+|++|+++|.
T Consensus       483 s~n~l~~~~~~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~  562 (968)
T PLN00113        483 SRNQFSGAVPRKLGSLSELMQLKLSENKLSGEIPDELSSCKKLVSLDLSHNQLSGQIPASFSEMPVLSQLDLSQNQLSGE  562 (968)
T ss_pred             cCCccCCccChhhhhhhccCEEECcCCcceeeCChHHcCccCCCEEECCCCcccccCChhHhCcccCCEEECCCCccccc
Confidence            9999999999888889999999999999998899888889999999999999988765 455555 88999999999998


Q ss_pred             cCcccc---cccceeecCCcCCCCCCCCCCCCCCCCCCCCCCCCCCCC---CCCCCCCCCCCCCCCCCCCceeehhHHHH
Q 008107          239 IPRELI---SIRTFIYDGNSFDNGPAPPPPPSTAPPSGRSHNNRSHRQ---GSHSPSGSQSSSSDKELPAGAIVGIVLGA  312 (577)
Q Consensus       239 ~p~~l~---~l~~l~~~~n~~~~~~~~~~~~~~~~~~~~~~~~~~~~~---~~~s~~~s~~s~s~~~~~~~~iv~iv~~~  312 (577)
                      +|..+.   ++..+++++|++.+..+...............+......   .+..++.    ...+......++++++++
T Consensus       563 ~p~~l~~l~~L~~l~ls~N~l~~~~p~~~~~~~~~~~~~~~n~~lc~~~~~~~~~~c~----~~~~~~~~~~~~~~~~~~  638 (968)
T PLN00113        563 IPKNLGNVESLVQVNISHNHLHGSLPSTGAFLAINASAVAGNIDLCGGDTTSGLPPCK----RVRKTPSWWFYITCTLGA  638 (968)
T ss_pred             CChhHhcCcccCEEeccCCcceeeCCCcchhcccChhhhcCCccccCCccccCCCCCc----cccccceeeeehhHHHHH
Confidence            887655   456778888887643221111000000000000000000   0000110    001111112233333333


Q ss_pred             HHHHHHHHHHHHHHHhhcccccCCCCCCCCCCCcccCCCCcchhhccccccccccCCCCCChhhhhhhhhcccCCccccc
Q 008107          313 VFLVALALLALYFCIRKNRRKVSGARSSAGSFPVSTNNMNTEMHEQRVKSVAAVTDLTPPPAEKLVIERVAKSGSLKKIK  392 (577)
Q Consensus       313 ~~lv~~~~~~~~~~~~rrr~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  392 (577)
                      ++++++++++++++++|++.+....   ....         .. +          ..           .....       
T Consensus       639 ~~~~~~~~~~~~~~~~~~~~~~~~~---~~~~---------~~-~----------~~-----------~~~~~-------  677 (968)
T PLN00113        639 FLVLALVAFGFVFIRGRNNLELKRV---ENED---------GT-W----------EL-----------QFFDS-------  677 (968)
T ss_pred             HHHHHHHHHHHHHHHhhhccccccc---cccc---------cc-c----------cc-----------ccccc-------
Confidence            3333333333332222221111000   0000         00 0          00           00000       


Q ss_pred             CCCcceeecHHHHHHhhcCCCccceeccCccceEEEEEE-cCCcEEEEEEccccccchHHHHHHHHHHHHhhcCCCCcee
Q 008107          393 SPITATSYTVASLQTATNSFSQEFLIGEGSLGRVYRAEF-ANGKIMAVKKIDNAALSLQEEDNFLEAVSNMSRLRHPNIV  471 (577)
Q Consensus       393 ~~~~~~~~~~~~~~~~~~~~~~~~~lg~G~fg~Vy~~~~-~~~~~vavK~~~~~~~~~~~~~~~~~e~~~l~~l~H~niv  471 (577)
                        .....++++++   ...|...+.||+|+||.||+|.. .+++.||||+++....      ...+|++.+++++|||||
T Consensus       678 --~~~~~~~~~~~---~~~~~~~~~ig~G~~g~Vy~~~~~~~~~~vavK~~~~~~~------~~~~~~~~l~~l~HpnIv  746 (968)
T PLN00113        678 --KVSKSITINDI---LSSLKEENVISRGKKGASYKGKSIKNGMQFVVKEINDVNS------IPSSEIADMGKLQHPNIV  746 (968)
T ss_pred             --ccchhhhHHHH---HhhCCcccEEccCCCeeEEEEEECCCCcEEEEEEccCCcc------ccHHHHHHHhhCCCCCcc
Confidence              00011233332   23567788999999999999987 5789999999864321      113458889999999999


Q ss_pred             eEeeEEEeCCeEEEEEEecCCCCHHHhhhhccCCCCCCCHHHHHHHHHHHHHHHHHHhcCCCCCeeecCCCCCCeeeCCC
Q 008107          472 TLAGYCAEHGQRLLVYEYVGNGNLHDMLHFADDSSKNLTWNARVRVALGTARALEYLHEVCLPSVVHRNFKSANILLDDE  551 (577)
Q Consensus       472 ~l~~~~~~~~~~~lv~e~~~~g~L~~~l~~~~~~~~~l~~~~~~~i~~~i~~~L~yLH~~~~~~ivHrDlk~~NILl~~~  551 (577)
                      +++|+|.+.+..|+||||+++|+|.++++       .++|.++.+|+.|+++||+|||+.+.++|+||||||+||+++.+
T Consensus       747 ~~~~~~~~~~~~~lv~Ey~~~g~L~~~l~-------~l~~~~~~~i~~~ia~~L~yLH~~~~~~iiH~dlkp~Nil~~~~  819 (968)
T PLN00113        747 KLIGLCRSEKGAYLIHEYIEGKNLSEVLR-------NLSWERRRKIAIGIAKALRFLHCRCSPAVVVGNLSPEKIIIDGK  819 (968)
T ss_pred             eEEEEEEcCCCCEEEEeCCCCCcHHHHHh-------cCCHHHHHHHHHHHHHHHHHhccCCCCCeecCCCCHHhEEECCC
Confidence            99999999999999999999999999995       27999999999999999999997766799999999999999999


Q ss_pred             CCeEEeccccCcc
Q 008107          552 LNPHLSDCGLAAL  564 (577)
Q Consensus       552 ~~~kl~DFGla~~  564 (577)
                      +.+++. ||.+..
T Consensus       820 ~~~~~~-~~~~~~  831 (968)
T PLN00113        820 DEPHLR-LSLPGL  831 (968)
T ss_pred             CceEEE-eccccc
Confidence            988876 666543



>KOG1187 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0595 consensus Serine/threonine-protein kinase involved in autophagy [Posttranslational modification, protein turnover, chaperones; Intracellular trafficking, secretion, and vesicular transport; Signal transduction mechanisms] Back     alignment and domain information
>KOG0615 consensus Serine/threonine protein kinase Chk2 and related proteins [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0575 consensus Polo-like serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0581 consensus Mitogen-activated protein kinase kinase (MAP2K) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0192 consensus Tyrosine kinase specific for activated (GTP-bound) p21cdc42Hs [Signal transduction mechanisms] Back     alignment and domain information
>KOG0598 consensus Ribosomal protein S6 kinase and related proteins [General function prediction only; Signal transduction mechanisms] Back     alignment and domain information
>KOG0197 consensus Tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG0591 consensus NIMA (never in mitosis)-related G2-specific serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0600 consensus Cdc2-related protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0593 consensus Predicted protein kinase KKIAMRE [General function prediction only] Back     alignment and domain information
>KOG0611 consensus Predicted serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>KOG0616 consensus cAMP-dependent protein kinase catalytic subunit (PKA) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0659 consensus Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH/TFIIK, kinase subunit CDK7 [Cell cycle control, cell division, chromosome partitioning; Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG1094 consensus Discoidin domain receptor DDR1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0580 consensus Serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1026 consensus Nerve growth factor receptor TRKA and related tyrosine kinases [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0583 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0592 consensus 3-phosphoinositide-dependent protein kinase (PDK1) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0597 consensus Serine-threonine protein kinase FUSED [General function prediction only] Back     alignment and domain information
>KOG0661 consensus MAPK related serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0663 consensus Protein kinase PITSLRE and related kinases [General function prediction only] Back     alignment and domain information
>KOG0198 consensus MEKK and related serine/threonine protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG0585 consensus Ca2+/calmodulin-dependent protein kinase kinase beta and related serine/threonine protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG0194 consensus Protein tyrosine kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0605 consensus NDR and related serine/threonine kinases [General function prediction only] Back     alignment and domain information
>KOG3653 consensus Transforming growth factor beta/activin receptor subfamily of serine/threonine kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG0594 consensus Protein kinase PCTAIRE and related kinases [General function prediction only] Back     alignment and domain information
>KOG0582 consensus Ste20-like serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0658 consensus Glycogen synthase kinase-3 [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG0196 consensus Tyrosine kinase, EPH (ephrin) receptor family [Signal transduction mechanisms] Back     alignment and domain information
>KOG0588 consensus Serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0193 consensus Serine/threonine protein kinase RAF [Signal transduction mechanisms] Back     alignment and domain information
>KOG0578 consensus p21-activated serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05102 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 3 Back     alignment and domain information
>KOG2052 consensus Activin A type IB receptor, serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05096 PTKc_DDR1 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 1 Back     alignment and domain information
>cd05628 STKc_NDR1 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 1 Back     alignment and domain information
>cd05621 STKc_ROCK2 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 2 Back     alignment and domain information
>KOG0694 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PTZ00263 protein kinase A catalytic subunit; Provisional Back     alignment and domain information
>cd05629 STKc_NDR_like_fungal Catalytic domain of Fungal Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05612 STKc_PRKX_like Catalytic domain of PRKX-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05600 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05599 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>PTZ00426 cAMP-dependent protein kinase catalytic subunit; Provisional Back     alignment and domain information
>cd05626 STKc_LATS2 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 2 Back     alignment and domain information
>cd05571 STKc_PKB Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B Back     alignment and domain information
>KOG1095 consensus Protein tyrosine kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05631 STKc_GRK4 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 4 Back     alignment and domain information
>KOG0589 consensus Serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>KOG0586 consensus Serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>cd05104 PTKc_Kit Catalytic domain of the Protein Tyrosine Kinase, Kit Back     alignment and domain information
>KOG0599 consensus Phosphorylase kinase gamma subunit [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd05582 STKc_RSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, 90 kDa ribosomal protein S6 kinase Back     alignment and domain information
>cd05593 STKc_PKB_gamma Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B gamma Back     alignment and domain information
>cd05585 STKc_YPK1_like Catalytic domain of Yeast Protein Kinase 1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05595 STKc_PKB_beta Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B beta Back     alignment and domain information
>cd05573 STKc_ROCK_NDR_like Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05622 STKc_ROCK1 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 1 Back     alignment and domain information
>cd05596 STKc_ROCK Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase Back     alignment and domain information
>cd06649 PKc_MEK2 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 2 Back     alignment and domain information
>cd05594 STKc_PKB_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B alpha Back     alignment and domain information
>cd05598 STKc_LATS Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor Back     alignment and domain information
>cd05624 STKc_MRCK_beta Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase beta Back     alignment and domain information
>cd05625 STKc_LATS1 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 1 Back     alignment and domain information
>cd05627 STKc_NDR2 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 2 Back     alignment and domain information
>cd05597 STKc_DMPK_like Catalytic domain of Myotonic Dystrophy protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05601 STKc_CRIK Catalytic domain of the Protein Serine/Threonine Kinase, Citron Rho-interacting kinase Back     alignment and domain information
>cd05106 PTKc_CSF-1R Catalytic domain of the Protein Tyrosine Kinase, Colony-Stimulating Factor-1 Receptor Back     alignment and domain information
>KOG4236 consensus Serine/threonine protein kinase PKC mu/PKD and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>cd05584 STKc_p70S6K Catalytic domain of the Protein Serine/Threonine Kinase, 70 kDa ribosomal protein S6 kinase Back     alignment and domain information
>KOG0574 consensus STE20-like serine/threonine kinase MST [Signal transduction mechanisms] Back     alignment and domain information
>PTZ00267 NIMA-related protein kinase; Provisional Back     alignment and domain information
>KOG0032 consensus Ca2+/calmodulin-dependent protein kinase, EF-Hand protein superfamily [Signal transduction mechanisms] Back     alignment and domain information
>cd05614 STKc_MSK2_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 2 Back     alignment and domain information
>KOG4250 consensus TANK binding protein kinase TBK1 [Signal transduction mechanisms] Back     alignment and domain information
>cd05588 STKc_aPKC Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C Back     alignment and domain information
>cd05623 STKc_MRCK_alpha Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase alpha Back     alignment and domain information
>KOG1989 consensus ARK protein kinase family [Signal transduction mechanisms] Back     alignment and domain information
>cd05608 STKc_GRK1 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 1 Back     alignment and domain information
>cd05105 PTKc_PDGFR_alpha Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor alpha Back     alignment and domain information
>cd05587 STKc_cPKC Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C Back     alignment and domain information
>cd05618 STKc_aPKC_iota Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C iota Back     alignment and domain information
>KOG0033 consensus Ca2+/calmodulin-dependent protein kinase, EF-Hand protein superfamily [Signal transduction mechanisms] Back     alignment and domain information
>KOG0660 consensus Mitogen-activated protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd06650 PKc_MEK1 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 1 Back     alignment and domain information
>cd07848 STKc_CDKL5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase Like 5 Back     alignment and domain information
>cd05114 PTKc_Tec_Rlk Catalytic domain of the Protein Tyrosine Kinases, Tyrosine kinase expressed in hepatocellular carcinoma and Resting lymphocyte kinase Back     alignment and domain information
>cd05064 PTKc_EphR_A10 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A10 Back     alignment and domain information
>PTZ00283 serine/threonine protein kinase; Provisional Back     alignment and domain information
>cd07869 STKc_PFTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-1 kinase Back     alignment and domain information
>cd07859 STKc_TDY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TDY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>cd05605 STKc_GRK4_like Catalytic domain of G protein-coupled Receptor Kinase 4-like Protein Serine/Threonine Kinases Back     alignment and domain information
>PLN00034 mitogen-activated protein kinase kinase; Provisional Back     alignment and domain information
>cd05592 STKc_nPKC_theta_delta Catalytic domain of the Protein Serine/Threonine Kinases, Novel Protein Kinase C theta and delta Back     alignment and domain information
>cd05591 STKc_nPKC_epsilon Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C epsilon Back     alignment and domain information
>cd07871 STKc_PCTAIRE3 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-3 kinase Back     alignment and domain information
>cd05616 STKc_cPKC_beta Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C beta Back     alignment and domain information
>cd05589 STKc_PKN Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase N Back     alignment and domain information
>cd05590 STKc_nPKC_eta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C eta Back     alignment and domain information
>cd05603 STKc_SGK2 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 2 Back     alignment and domain information
>cd05575 STKc_SGK Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase Back     alignment and domain information
>cd05108 PTKc_EGFR Catalytic domain of the Protein Tyrosine Kinase, Epidermal Growth Factor Receptor Back     alignment and domain information
>cd05617 STKc_aPKC_zeta Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C zeta Back     alignment and domain information
>cd05619 STKc_nPKC_theta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C theta Back     alignment and domain information
>cd05604 STKc_SGK3 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 3 Back     alignment and domain information
>cd05602 STKc_SGK1 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 1 Back     alignment and domain information
>cd05068 PTKc_Frk_like Catalytic domain of Fyn-related kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>KOG0610 consensus Putative serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>KOG4278 consensus Protein tyrosine kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0662 consensus Cyclin-dependent kinase CDK5 [Intracellular trafficking, secretion, and vesicular transport; Signal transduction mechanisms] Back     alignment and domain information
>PHA03212 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd05113 PTKc_Btk_Bmx Catalytic domain of the Protein Tyrosine Kinases, Bruton's tyrosine kinase and Bone marrow kinase on the X chromosome Back     alignment and domain information
>cd05620 STKc_nPKC_delta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C delta Back     alignment and domain information
>KOG4721 consensus Serine/threonine protein kinase, contains leucine zipper domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG1025 consensus Epidermal growth factor receptor EGFR and related tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd05059 PTKc_Tec_like Catalytic domain of Tec-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05615 STKc_cPKC_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C alpha Back     alignment and domain information
>cd05072 PTKc_Lyn Catalytic domain of the Protein Tyrosine Kinase, Lyn Back     alignment and domain information
>cd07862 STKc_CDK6 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 6 Back     alignment and domain information
>PHA02988 hypothetical protein; Provisional Back     alignment and domain information
>cd07853 STKc_NLK Catalytic domain of the Serine/Threonine Kinase, Nemo-Like Kinase Back     alignment and domain information
>PRK13184 pknD serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>KOG0584 consensus Serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>cd05107 PTKc_PDGFR_beta Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor beta Back     alignment and domain information
>cd05081 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>KOG0201 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0577 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05095 PTKc_DDR2 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 2 Back     alignment and domain information
>PF07714 Pkinase_Tyr: Protein tyrosine kinase Protein kinase; unclassified specificity Back     alignment and domain information
>cd06615 PKc_MEK Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase Back     alignment and domain information
>cd05075 PTKc_Axl Catalytic domain of the Protein Tyrosine Kinase, Axl Back     alignment and domain information
>cd05033 PTKc_EphR Catalytic domain of Ephrin Receptor Protein Tyrosine Kinases Back     alignment and domain information
>cd05570 STKc_PKC Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase C Back     alignment and domain information
>cd05042 PTKc_Aatyk Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases Back     alignment and domain information
>cd08228 STKc_Nek6 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 6 Back     alignment and domain information
>cd05066 PTKc_EphR_A Catalytic domain of the Protein Tyrosine Kinases, Class EphA Ephrin Receptors Back     alignment and domain information
>cd05084 PTKc_Fes Catalytic domain of the Protein Tyrosine Kinase, Fes Back     alignment and domain information
>cd05097 PTKc_DDR_like Catalytic domain of Discoidin Domain Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05090 PTKc_Ror1 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 1 Back     alignment and domain information
>cd05035 PTKc_Axl_like Catalytic Domain of Axl-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05062 PTKc_IGF-1R Catalytic domain of the Protein Tyrosine Kinase, Insulin-like Growth Factor-1 Receptor Back     alignment and domain information
>cd05610 STKc_MASTL Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine-like kinase Back     alignment and domain information
>cd05586 STKc_Sck1_like Catalytic domain of Suppressor of loss of cAMP-dependent protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05607 STKc_GRK7 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 7 Back     alignment and domain information
>cd05632 STKc_GRK5 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 5 Back     alignment and domain information
>cd05103 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 2 Back     alignment and domain information
>cd05053 PTKc_FGFR Catalytic domain of the Protein Tyrosine Kinases, Fibroblast Growth Factor Receptors Back     alignment and domain information
>cd08224 STKc_Nek6_Nek7 Catalytic domain of the Protein Serine/Threonine Kinases, Never In Mitosis gene A-related kinase 6 and 7 Back     alignment and domain information
>cd05051 PTKc_DDR Catalytic domain of the Protein Tyrosine Kinases, Discoidin Domain Receptors Back     alignment and domain information
>cd05630 STKc_GRK6 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 6 Back     alignment and domain information
>KOG0690 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05054 PTKc_VEGFR Catalytic domain of the Protein Tyrosine Kinases, Vascular Endothelial Growth Factor Receptors Back     alignment and domain information
>cd05052 PTKc_Abl Catalytic domain of the Protein Tyrosine Kinase, Abelson kinase Back     alignment and domain information
>cd05087 PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases 1 and 3 Back     alignment and domain information
>cd05148 PTKc_Srm_Brk Catalytic domain of the Protein Tyrosine Kinases, Srm and Brk Back     alignment and domain information
>cd05061 PTKc_InsR Catalytic domain of the Protein Tyrosine Kinase, Insulin Receptor Back     alignment and domain information
>cd05071 PTKc_Src Catalytic domain of the Protein Tyrosine Kinase, Src Back     alignment and domain information
>cd08529 STKc_FA2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii FA2 and similar domains Back     alignment and domain information
>PF00069 Pkinase: Protein kinase domain Protein kinase; unclassified specificity Back     alignment and domain information
>cd05093 PTKc_TrkB Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase B Back     alignment and domain information
>cd05580 STKc_PKA Catalytic domain of the Protein Serine/Threonine Kinase, cAMP-dependent protein kinase Back     alignment and domain information
>cd08221 STKc_Nek9 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 9 Back     alignment and domain information
>cd06646 STKc_MAP4K5 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 5 Back     alignment and domain information
>cd05067 PTKc_Lck_Blk Catalytic domain of the Protein Tyrosine Kinases, Lymphocyte-specific kinase and Blk Back     alignment and domain information
>cd06619 PKc_MKK5 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 5 Back     alignment and domain information
>cd05086 PTKc_Aatyk2 Catalytic domain of the Protein Tyrosine Kinase, Apoptosis-associated tyrosine kinase 2 Back     alignment and domain information
>PTZ00036 glycogen synthase kinase; Provisional Back     alignment and domain information
>cd05088 PTKc_Tie2 Catalytic domain of the Protein Tyrosine Kinase, Tie2 Back     alignment and domain information
>cd05070 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyrosine Kinases, Fyn and Yrk Back     alignment and domain information
>cd05048 PTKc_Ror Catalytic Domain of the Protein Tyrosine Kinases, Receptor tyrosine kinase-like Orphan Receptors Back     alignment and domain information
>cd05049 PTKc_Trk Catalytic domain of the Protein Tyrosine Kinases, Tropomyosin Related Kinases Back     alignment and domain information
>cd07872 STKc_PCTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-2 kinase Back     alignment and domain information
>cd05116 PTKc_Syk Catalytic domain of the Protein Tyrosine Kinase, Spleen tyrosine kinase Back     alignment and domain information
>KOG2345 consensus Serine/threonine protein kinase/TGF-beta stimulated factor [Transcription; Lipid transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>cd05034 PTKc_Src_like Catalytic domain of Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05111 PTK_HER3 Pseudokinase domain of the Protein Tyrosine Kinase, HER3 Back     alignment and domain information
>cd05115 PTKc_Zap-70 Catalytic domain of the Protein Tyrosine Kinase, Zeta-chain-associated protein of 70kDa Back     alignment and domain information
>KOG0666 consensus Cyclin C-dependent kinase CDK8 [Transcription] Back     alignment and domain information
>cd07876 STKc_JNK2 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 2 Back     alignment and domain information
>cd05069 PTKc_Yes Catalytic domain of the Protein Tyrosine Kinase, Yes Back     alignment and domain information
>cd05032 PTKc_InsR_like Catalytic domain of Insulin Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05101 PTKc_FGFR2 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 2 Back     alignment and domain information
>cd05085 PTKc_Fer Catalytic domain of the Protein Tyrosine Kinase, Fer Back     alignment and domain information
>cd07847 STKc_CDKL1_4 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 1 and 4 Back     alignment and domain information
>cd06638 STKc_myosinIIIA Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIA myosin Back     alignment and domain information
>cd05039 PTKc_Csk_like Catalytic domain of C-terminal Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>PTZ00266 NIMA-related protein kinase; Provisional Back     alignment and domain information
>cd07878 STKc_p38beta_MAPK11 Catalytic domain of the Serine/Threonine Kinase, p38beta Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd05045 PTKc_RET Catalytic domain of the Protein Tyrosine Kinase, REarranged during Transfection protein Back     alignment and domain information
>cd05089 PTKc_Tie1 Catalytic domain of the Protein Tyrosine Kinase, Tie1 Back     alignment and domain information
>cd05091 PTKc_Ror2 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 2 Back     alignment and domain information
>cd06622 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS2-like dual-specificity MAP kinase kinases Back     alignment and domain information
>cd05055 PTKc_PDGFR Catalytic domain of the Protein Tyrosine Kinases, Platelet Derived Growth Factor Receptors Back     alignment and domain information
>cd05079 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information
>PHA03211 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd05109 PTKc_HER2 Catalytic domain of the Protein Tyrosine Kinase, HER2 Back     alignment and domain information
>cd05076 PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>cd05098 PTKc_FGFR1 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 1 Back     alignment and domain information
>cd08229 STKc_Nek7 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 7 Back     alignment and domain information
>cd05073 PTKc_Hck Catalytic domain of the Protein Tyrosine Kinase, Hematopoietic cell kinase Back     alignment and domain information
>cd05063 PTKc_EphR_A2 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A2 Back     alignment and domain information
>cd06617 PKc_MKK3_6 Catalytic domain of the dual-specificity Protein Kinases, MAP kinase kinases 3 and 6 Back     alignment and domain information
>cd06625 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06632 STKc_MEKK1_plant Catalytic domain of the Protein Serine/Threonine Kinase, Plant MAP/ERK kinase kinase 1 Back     alignment and domain information
>cd05036 PTKc_ALK_LTK Catalytic domain of the Protein Tyrosine Kinases, Anaplastic Lymphoma Kinase and Leukocyte Tyrosine Kinase Back     alignment and domain information
>cd06631 STKc_YSK4 Catalytic domain of the Protein Serine/Threonine Kinase, Yeast Sps1/Ste20-related kinase 4 Back     alignment and domain information
>cd07861 STKc_CDK1_euk Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 1 from higher eukaryotes-like Back     alignment and domain information
>KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05065 PTKc_EphR_B Catalytic domain of the Protein Tyrosine Kinases, Class EphB Ephrin Receptors Back     alignment and domain information
>cd05080 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>cd05043 PTK_Ryk Pseudokinase domain of Ryk (Receptor related to tyrosine kinase) Back     alignment and domain information
>cd05094 PTKc_TrkC Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase C Back     alignment and domain information
>cd07874 STKc_JNK3 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 3 Back     alignment and domain information
>KOG4257 consensus Focal adhesion tyrosine kinase FAK, contains FERM domain [Signal transduction mechanisms] Back     alignment and domain information
>cd07841 STKc_CDK7 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 7 Back     alignment and domain information
>cd06637 STKc_TNIK Catalytic domain of the Protein Serine/Threonine Kinase, Traf2- and Nck-interacting kinase Back     alignment and domain information
>cd05099 PTKc_FGFR4 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 4 Back     alignment and domain information
>cd05037 PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>cd05047 PTKc_Tie Catalytic domain of Tie Protein Tyrosine Kinases Back     alignment and domain information
>cd05050 PTKc_Musk Catalytic domain of the Protein Tyrosine Kinase, Muscle-specific kinase Back     alignment and domain information
>cd06656 STKc_PAK3 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 3 Back     alignment and domain information
>cd08227 PK_STRAD_alpha Pseudokinase domain of STE20-related kinase adapter protein alpha Back     alignment and domain information
>KOG4717 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0667 consensus Dual-specificity tyrosine-phosphorylation regulated kinase [General function prediction only] Back     alignment and domain information
>PHA03209 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd00192 PTKc Catalytic domain of Protein Tyrosine Kinases Back     alignment and domain information
>cd05057 PTKc_EGFR_like Catalytic domain of Epidermal Growth Factor Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd08217 STKc_Nek2 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 2 Back     alignment and domain information
>cd06643 STKc_SLK Catalytic domain of the Protein Serine/Threonine Kinase, Ste20-like kinase Back     alignment and domain information
>cd05046 PTK_CCK4 Pseudokinase domain of the Protein Tyrosine Kinase, Colon Carcinoma Kinase 4 Back     alignment and domain information
>cd06645 STKc_MAP4K3 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 3 Back     alignment and domain information
>cd07875 STKc_JNK1 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 1 Back     alignment and domain information
>cd05112 PTKc_Itk Catalytic domain of the Protein Tyrosine Kinase, Interleukin-2-inducible T-cell Kinase Back     alignment and domain information
>cd05040 PTKc_Ack_like Catalytic domain of the Protein Tyrosine Kinase, Activated Cdc42-associated kinase Back     alignment and domain information
>PRK09188 serine/threonine protein kinase; Provisional Back     alignment and domain information
>cd05609 STKc_MAST Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine kinase Back     alignment and domain information
>cd07863 STKc_CDK4 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 4 Back     alignment and domain information
>cd07832 STKc_CCRK Catalytic domain of the Serine/Threonine Kinase, Cell Cycle-Related Kinase Back     alignment and domain information
>cd05041 PTKc_Fes_like Catalytic domain of Fes-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05100 PTKc_FGFR3 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 3 Back     alignment and domain information
>cd07846 STKc_CDKL2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 2 and 3 Back     alignment and domain information
>cd06620 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>cd06652 STKc_MEKK2 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 2 Back     alignment and domain information
>KOG0607 consensus MAP kinase-interacting kinase and related serine/threonine protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd06621 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>cd08223 STKc_Nek4 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 4 Back     alignment and domain information
>cd06654 STKc_PAK1 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 1 Back     alignment and domain information
>KOG0579 consensus Ste20-like serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd06611 STKc_SLK_like Catalytic domain of Ste20-like kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd08219 STKc_Nek3 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 3 Back     alignment and domain information
>cd05633 STKc_GRK3 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 3 Back     alignment and domain information
>cd05092 PTKc_TrkA Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase A Back     alignment and domain information
>cd05038 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>cd08218 STKc_Nek1 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 1 Back     alignment and domain information
>cd06628 STKc_MAPKKK_Byr2_like Catalytic domain of fungal Byr2-like MAP Kinase Kinase Kinases Back     alignment and domain information
>cd06639 STKc_myosinIIIB Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIB myosin Back     alignment and domain information
>cd05060 PTKc_Syk_like Catalytic domain of Spleen Tyrosine Kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>KOG0986 consensus G protein-coupled receptor kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05578 STKc_Yank1 Catalytic domain of the Protein Serine/Threonine Kinase, Yank1 Back     alignment and domain information
>cd05082 PTKc_Csk Catalytic domain of the Protein Tyrosine Kinase, C-terminal Src kinase Back     alignment and domain information
>cd06644 STKc_STK10_LOK Catalytic domain of the Protein Serine/Threonine Kinase, STK10 or Lymphocyte-oriented kinase Back     alignment and domain information
>cd07873 STKc_PCTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-1 kinase Back     alignment and domain information
>cd05077 PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information
>cd06626 STKc_MEKK4 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 4 Back     alignment and domain information
>cd06624 STKc_ASK Catalytic domain of the Protein Serine/Threonine Kinase, Apoptosis signal-regulating kinase Back     alignment and domain information
>cd05574 STKc_phototropin_like Catalytic domain of Phototropin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>PHA03207 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd07868 STKc_CDK8 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 8 Back     alignment and domain information
>cd05074 PTKc_Tyro3 Catalytic domain of the Protein Tyrosine Kinase, Tyro3 Back     alignment and domain information
>cd06651 STKc_MEKK3 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 3 Back     alignment and domain information
>cd07844 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like Serine/Threonine Kinases Back     alignment and domain information
>cd05147 RIO1_euk RIO kinase family; eukaryotic RIO1, catalytic domain Back     alignment and domain information
>cd05058 PTKc_Met_Ron Catalytic domain of the Protein Tyrosine Kinases, Met and Ron Back     alignment and domain information
>cd06629 STKc_MAPKKK_Bck1_like Catalytic domain of fungal Bck1-like MAP Kinase Kinase Kinases Back     alignment and domain information
>cd07839 STKc_CDK5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 5 Back     alignment and domain information
>cd07870 STKc_PFTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-2 kinase Back     alignment and domain information
>cd05606 STKc_beta_ARK Catalytic domain of the Protein Serine/Threonine Kinase, beta-adrenergic receptor kinase Back     alignment and domain information
>cd05056 PTKc_FAK Catalytic domain of the Protein Tyrosine Kinase, Focal Adhesion Kinase Back     alignment and domain information
>cd06612 STKc_MST1_2 Catalytic domain of the Protein Serine/Threonine Kinases, Mammalian Ste20-like protein kinase 1 and 2 Back     alignment and domain information
>KOG0199 consensus ACK and related non-receptor tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd05083 PTKc_Chk Catalytic domain of the Protein Tyrosine Kinase, Csk homologous kinase Back     alignment and domain information
>cd07833 STKc_CDKL Catalytic domain of Cyclin-Dependent protein Kinase Like Serine/Threonine Kinases Back     alignment and domain information
>cd05613 STKc_MSK1_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 1 Back     alignment and domain information
>cd06613 STKc_MAP4K3_like Catalytic domain of Mitogen-activated protein kinase kinase kinase kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07860 STKc_CDK2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase 2 and 3 Back     alignment and domain information
>cd06627 STKc_Cdc7_like Catalytic domain of Cell division control protein 7-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd08530 STKc_CNK2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii CNK2, and similar domains Back     alignment and domain information
>cd07843 STKc_CDC2L1 Catalytic domain of the Serine/Threonine Kinase, Cell Division Cycle 2-like 1 Back     alignment and domain information
>cd05110 PTKc_HER4 Catalytic domain of the Protein Tyrosine Kinase, HER4 Back     alignment and domain information
>cd06630 STKc_MEKK1 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 1 Back     alignment and domain information
>KOG1152 consensus Signal transduction serine/threonine kinase with PAS/PAC sensor domain [Signal transduction mechanisms] Back     alignment and domain information
>cd06623 PKc_MAPKK_plant_like Catalytic domain of Plant dual-specificity MAP kinase kinases and similar proteins Back     alignment and domain information
>cd08528 STKc_Nek10 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 10 Back     alignment and domain information
>cd07837 STKc_CdkB_plant Catalytic domain of the Serine/Threonine Kinase, Plant B-type Cyclin-Dependent protein Kinase Back     alignment and domain information
>cd06605 PKc_MAPKK Catalytic domain of the dual-specificity Protein Kinase, Mitogen-Activated Protein Kinase Kinase Back     alignment and domain information
>cd08220 STKc_Nek8 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 8 Back     alignment and domain information
>cd08215 STKc_Nek Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase Back     alignment and domain information
>smart00219 TyrKc Tyrosine kinase, catalytic domain Back     alignment and domain information
>cd06642 STKc_STK25-YSK1 Catalytic domain of the Protein Serine/Threonine Kinase, STK25 or Yeast Sps1/Ste20-related kinase 1 Back     alignment and domain information
>cd06641 STKc_MST3 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 3 Back     alignment and domain information
>cd06640 STKc_MST4 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 4 Back     alignment and domain information
>cd06655 STKc_PAK2 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 2 Back     alignment and domain information
>cd05044 PTKc_c-ros Catalytic domain of the Protein Tyrosine Kinase, C-ros Back     alignment and domain information
>cd06609 STKc_MST3_like Catalytic domain of Mammalian Ste20-like protein kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07842 STKc_CDK8_like Catalytic domain of Cyclin-Dependent protein Kinase 8-like Serine/Threonine Kinases Back     alignment and domain information
>cd06658 STKc_PAK5 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 5 Back     alignment and domain information
>PHA03210 serine/threonine kinase US3; Provisional Back     alignment and domain information
>KOG1035 consensus eIF-2alpha kinase GCN2 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd07867 STKc_CDC2L6 Catalytic domain of Serine/Threonine Kinase, Cell Division Cycle 2-like 6 Back     alignment and domain information
>cd06610 STKc_OSR1_SPAK Catalytic domain of the Protein Serine/Threonine Kinases, Oxidative stress response kinase and Ste20-related proline alanine-rich kinase Back     alignment and domain information
>cd06608 STKc_myosinIII_like Catalytic domain of Class III myosin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05078 PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>cd06653 STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07877 STKc_p38alpha_MAPK14 Catalytic domain of the Serine/Threonine Kinase, p38alpha Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd05577 STKc_GRK Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase Back     alignment and domain information
>cd05572 STKc_cGK_PKG Catalytic domain of the Protein Serine/Threonine Kinase, cGMP-dependent protein kinase Back     alignment and domain information
>cd07864 STKc_CDK12 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 12 Back     alignment and domain information
>cd06917 STKc_NAK1_like Catalytic domain of Fungal Nak1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>PLN00009 cyclin-dependent kinase A; Provisional Back     alignment and domain information
>cd06606 STKc_MAPKKK Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase Back     alignment and domain information
>KOG0984 consensus Mitogen-activated protein kinase (MAPK) kinase MKK3/MKK6 [Signal transduction mechanisms] Back     alignment and domain information
>cd05579 STKc_MAST_like Catalytic domain of Microtubule-associated serine/threonine kinase-like proteins Back     alignment and domain information
>cd08225 STKc_Nek5 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 5 Back     alignment and domain information
>cd06636 STKc_MAP4K4_6 Catalytic domain of the Protein Serine/Threonine Kinases, Mitogen-Activated Protein Kinase Kinase Kinase Kinase 4 and 6 Back     alignment and domain information
>cd07836 STKc_Pho85 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Pho85 Back     alignment and domain information
>cd05145 RIO1_like RIO kinase family; RIO1, RIO3 and similar proteins, catalytic domain Back     alignment and domain information
>cd07880 STKc_p38gamma_MAPK12 Catalytic domain of the Serine/Threonine Kinase, p38gamma Mitogen-Activated Protein Kinase Back     alignment and domain information
>PTZ00284 protein kinase; Provisional Back     alignment and domain information
>KOG1151 consensus Tousled-like protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd06607 STKc_TAO Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids proteins Back     alignment and domain information
>KOG0669 consensus Cyclin T-dependent kinase CDK9 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd06647 STKc_PAK_I Catalytic domain of the Protein Serine/Threonine Kinase, Group I p21-activated kinase Back     alignment and domain information
>cd06659 STKc_PAK6 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 6 Back     alignment and domain information
>KOG4645 consensus MAPKKK (MAP kinase kinase kinase) SSK2 and related serine/threonine protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd07865 STKc_CDK9 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 9 Back     alignment and domain information
>cd07840 STKc_CDK9_like Catalytic domain of Cyclin-Dependent protein Kinase 9-like Serine/Threonine Kinases Back     alignment and domain information
>cd05581 STKc_PDK1 Catalytic domain of the Protein Serine/Threonine Kinase, Phosphoinositide-dependent kinase 1 Back     alignment and domain information
>cd07845 STKc_CDK10 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 10 Back     alignment and domain information
>cd07835 STKc_CDK1_like Catalytic domain of Cyclin-Dependent protein Kinase 1-like Serine/Threonine Kinases Back     alignment and domain information
>KOG4279 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0587 consensus Traf2- and Nck-interacting kinase and related germinal center kinase (GCK) family protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd07855 STKc_ERK5 Catalytic domain of the Serine/Threonine Kinase, Extracellular signal-Regulated Kinase 5 Back     alignment and domain information
>cd07850 STKc_JNK Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase Back     alignment and domain information
>cd05122 PKc_STE Catalytic domain of STE family Protein Kinases Back     alignment and domain information
>cd07856 STKc_Sty1_Hog1 Catalytic domain of the Serine/Threonine Kinases, Fungal Mitogen-Activated Protein Kinases Sty1 and Hog1 Back     alignment and domain information
>cd08226 PK_STRAD_beta Pseudokinase domain of STE20-related kinase adapter protein beta Back     alignment and domain information
>KOG0608 consensus Warts/lats-like serine threonine kinases [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd07852 STKc_MAPK15 Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase 15 Back     alignment and domain information
>cd05611 STKc_Rim15_like Catalytic domain of fungal Rim15-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06614 STKc_PAK Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase Back     alignment and domain information
>PLN03224 probable serine/threonine protein kinase; Provisional Back     alignment and domain information
>KOG0664 consensus Nemo-like MAPK-related serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd06657 STKc_PAK4 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 4 Back     alignment and domain information
>cd05583 STKc_MSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase Back     alignment and domain information
>cd06635 STKc_TAO1 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 1 Back     alignment and domain information
>cd07834 STKc_MAPK Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd07831 STKc_MOK Catalytic domain of the Serine/Threonine Kinase, MAPK/MAK/MRK Overlapping Kinase Back     alignment and domain information
>cd08216 PK_STRAD Pseudokinase domain of STE20-related kinase adapter protein Back     alignment and domain information
>KOG0200 consensus Fibroblast/platelet-derived growth factor receptor and related receptor tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd06648 STKc_PAK_II Catalytic domain of the Protein Serine/Threonine Kinase, Group II p21-activated kinase Back     alignment and domain information
>cd07849 STKc_ERK1_2_like Catalytic domain of Extracellular signal-Regulated Kinase 1 and 2-like Serine/Threonine Kinases Back     alignment and domain information
>cd07858 STKc_TEY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TEY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>cd07838 STKc_CDK4_6_like Catalytic domain of Cyclin-Dependent protein Kinase 4 and 6-like Serine/Threonine Kinases Back     alignment and domain information
>cd07857 STKc_MPK1 Catalytic domain of the Serine/Threonine Kinase, Fungal Mitogen-Activated Protein Kinase MPK1 Back     alignment and domain information
>PTZ00024 cyclin-dependent protein kinase; Provisional Back     alignment and domain information
>cd06616 PKc_MKK4 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 4 Back     alignment and domain information
>KOG0983 consensus Mitogen-activated protein kinase (MAPK) kinase MKK7/JNKK2 [Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>cd07830 STKc_MAK_like Catalytic domain of Male germ cell-Associated Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>cd07879 STKc_p38delta_MAPK13 Catalytic domain of the Serine/Threonine Kinase, p38delta Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd05123 STKc_AGC Catalytic domain of AGC family Protein Serine/Threonine Kinases Back     alignment and domain information
>PHA03390 pk1 serine/threonine-protein kinase 1; Provisional Back     alignment and domain information
>cd07866 STKc_BUR1 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Bypass UAS Requirement 1 and similar proteins Back     alignment and domain information
>cd05118 STKc_CMGC Catalytic domain of CMGC family Serine/Threonine Kinases Back     alignment and domain information
>cd08222 STKc_Nek11 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 11 Back     alignment and domain information
>cd07829 STKc_CDK_like Catalytic domain of Cyclin-Dependent protein Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>cd07851 STKc_p38 Catalytic domain of the Serine/Threonine Kinase, p38 Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd06633 STKc_TAO3 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 3 Back     alignment and domain information
>PHA02882 putative serine/threonine kinase; Provisional Back     alignment and domain information
>cd06634 STKc_TAO2 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 2 Back     alignment and domain information
>KOG0614 consensus cGMP-dependent protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1006 consensus Mitogen-activated protein kinase (MAPK) kinase MKK4 [Signal transduction mechanisms] Back     alignment and domain information
>cd06618 PKc_MKK7 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 7 Back     alignment and domain information
>KOG0696 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0604 consensus MAP kinase-activated protein kinase 2 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0695 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PRK10345 hypothetical protein; Provisional Back     alignment and domain information
>KOG0668 consensus Casein kinase II, alpha subunit [Signal transduction mechanisms; Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>cd07854 STKc_MAPK4_6 Catalytic domain of the Serine/Threonine Kinases, Mitogen-Activated Protein Kinases 4 and 6 Back     alignment and domain information
>KOG0596 consensus Dual specificity; serine/threonine and tyrosine kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd05576 STKc_RPK118_like Catalytic domain of the Protein Serine/Threonine Kinases, RPK118 and similar proteins Back     alignment and domain information
>KOG1345 consensus Serine/threonine kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0576 consensus Mitogen-activated protein kinase kinase kinase kinase (MAP4K), germinal center kinase family [Signal transduction mechanisms] Back     alignment and domain information
>smart00221 STYKc Protein kinase; unclassified specificity Back     alignment and domain information
>PLN03225 Serine/threonine-protein kinase SNT7; Provisional Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>smart00090 RIO RIO-like kinase Back     alignment and domain information
>cd00180 PKc Catalytic domain of Protein Kinases Back     alignment and domain information
>PRK12274 serine/threonine protein kinase; Provisional Back     alignment and domain information
>cd05144 RIO2_C RIO kinase family; RIO2, C-terminal catalytic domain Back     alignment and domain information
>PRK14879 serine/threonine protein kinase; Provisional Back     alignment and domain information
>KOG1024 consensus Receptor-like protein tyrosine kinase RYK/derailed [Signal transduction mechanisms] Back     alignment and domain information
>PRK10359 lipopolysaccharide core biosynthesis protein; Provisional Back     alignment and domain information
>PRK09605 bifunctional UGMP family protein/serine/threonine protein kinase; Validated Back     alignment and domain information
>smart00220 S_TKc Serine/Threonine protein kinases, catalytic domain Back     alignment and domain information
>KOG1165 consensus Casein kinase (serine/threonine/tyrosine protein kinase) [Signal transduction mechanisms] Back     alignment and domain information
>TIGR03724 arch_bud32 Kae1-associated kinase Bud32 Back     alignment and domain information
>KOG1163 consensus Casein kinase (serine/threonine/tyrosine protein kinase) [Signal transduction mechanisms] Back     alignment and domain information
>KOG1027 consensus Serine/threonine protein kinase and endoribonuclease ERN1/IRE1, sensor of the unfolded protein response pathway [Signal transduction mechanisms] Back     alignment and domain information
>KOG0671 consensus LAMMER dual specificity kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG0603 consensus Ribosomal protein S6 kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1290 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0665 consensus Jun-N-terminal kinase (JNK) [Signal transduction mechanisms] Back     alignment and domain information
>cd05119 RIO RIO kinase family, catalytic domain Back     alignment and domain information
>KOG1167 consensus Serine/threonine protein kinase of the CDC7 subfamily involved in DNA synthesis, repair and recombination [Replication, recombination and repair] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG1164 consensus Casein kinase (serine/threonine/tyrosine protein kinase) [Signal transduction mechanisms] Back     alignment and domain information
>cd05120 APH_ChoK_like Aminoglycoside 3'-phosphotransferase (APH) and Choline Kinase (ChoK) family Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>PRK01723 3-deoxy-D-manno-octulosonic-acid kinase; Reviewed Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>COG0515 SPS1 Serine/threonine protein kinase [General function prediction only / Signal transduction mechanisms / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0670 consensus U4/U6-associated splicing factor PRP4 [RNA processing and modification] Back     alignment and domain information
>TIGR01982 UbiB 2-polyprenylphenol 6-hydroxylase Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG1166 consensus Mitotic checkpoint serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PRK04750 ubiB putative ubiquinone biosynthesis protein UbiB; Reviewed Back     alignment and domain information
>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0590 consensus Checkpoint kinase and related serine/threonine protein kinases [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd05151 ChoK Choline Kinase (ChoK) Back     alignment and domain information
>KOG0603 consensus Ribosomal protein S6 kinase [Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd05146 RIO3_euk RIO kinase family; eukaryotic RIO3, catalytic domain Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd05154 ACAD10_11_like Acyl-CoA dehydrogenase (ACAD) 10 and 11, N-terminal domain, and similar proteins Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>COG3642 Mn2+-dependent serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG4158 consensus BRPK/PTEN-induced protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG3087 consensus Serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PF14531 Kinase-like: Kinase-like; PDB: 3DZO_A 2W1Z_A 3BYV_A 3Q5Z_A 3Q60_A Back     alignment and domain information
>KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG1023 consensus Natriuretic peptide receptor, guanylate cyclase [Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PRK15123 lipopolysaccharide core heptose(I) kinase RfaP; Provisional Back     alignment and domain information
>PF01163 RIO1: RIO1 family; InterPro: IPR018934 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG0590 consensus Checkpoint kinase and related serine/threonine protein kinases [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG0601 consensus Cyclin-dependent kinase WEE1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG0606 consensus Microtubule-associated serine/threonine kinase and related proteins [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>PF08263 LRRNT_2: Leucine rich repeat N-terminal domain; InterPro: IPR013210 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG1243 consensus Protein kinase [General function prediction only] Back     alignment and domain information
>PF06293 Kdo: Lipopolysaccharide kinase (Kdo/WaaP) family; InterPro: IPR010440 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases Back     alignment and domain information
>COG0661 AarF Predicted unusual protein kinase [General function prediction only] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>smart00750 KIND kinase non-catalytic C-lobe domain Back     alignment and domain information
>COG0478 RIO-like serine/threonine protein kinase fused to N-terminal HTH domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0601 consensus Cyclin-dependent kinase WEE1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1266 consensus Protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>TIGR02172 Fb_sc_TIGR02172 Fibrobacter succinogenes paralogous family TIGR02172 Back     alignment and domain information
>KOG3741 consensus Poly(A) ribonuclease subunit [RNA processing and modification] Back     alignment and domain information
>PRK09902 hypothetical protein; Provisional Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG1235 consensus Predicted unusual protein kinase [General function prediction only] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>COG1718 RIO1 Serine/threonine protein kinase involved in cell cycle control [Signal transduction mechanisms / Cell division and chromosome partitioning] Back     alignment and domain information
>cd05150 APH Aminoglycoside 3'-phosphotransferase (APH) Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query577
3tl8_A 349 The Avrptob-Bak1 Complex Reveals Two Structurally S 1e-29
3uim_A 326 Structural Basis For The Impact Of Phosphorylation 4e-29
2qkw_B 321 Structural Basis For Activation Of Plant Immunity B 5e-27
3hgk_A 327 Crystal Structure Of Effect Protein Avrptob Complex 5e-27
2oib_A 301 Crystal Structure Of Irak4 Kinase Domain Apo Form L 4e-19
2nru_A 307 Crystal Structure Of Irak-4 Length = 307 4e-19
2nry_A 307 Crystal Structure Of Irak-4 Length = 307 4e-19
3p86_A 309 Crystal Structure Of Ctr1 Kinase Domain Mutant D676 2e-18
2o8y_A 298 Apo Irak4 Kinase Domain Length = 298 8e-18
3ppz_A 309 Crystal Structure Of Ctr1 Kinase Domain In Complex 1e-17
3qgw_A 286 Crystal Structure Of Itk Kinase Bound To An Inhibit 2e-13
4hct_A 269 Crystal Structure Of Itk In Complex With Compound 5 4e-13
1sm2_A 264 Crystal Structure Of The Phosphorylated Interleukin 4e-13
3v5j_A 266 Crystal Structure Of Interleukin-2 Inducible T-Cell 4e-13
3dtc_A 271 Crystal Structure Of Mixed-Lineage Kinase Mlk1 Comp 9e-13
3miy_A 266 X-Ray Crystal Structure Of Itk Complexed With Sunit 2e-12
3t9t_A 267 Crystal Structure Of Btk Mutant (F435t,K596r) Compl 2e-12
3com_A 314 Crystal Structure Of Mst1 Kinase Length = 314 7e-12
4f0f_A287 Crystal Structure Of The Roco4 Kinase Domain Bound 8e-12
4f1m_A 287 Crystal Structure Of The G1179s Roco4 Kinase Domain 1e-11
4f1o_A 287 Crystal Structure Of The L1180t Mutant Roco4 Kinase 1e-11
2fb8_A 281 Structure Of The B-Raf Kinase Domain Bound To Sb-59 2e-11
4h58_A 275 Braf In Complex With Compound 3 Length = 275 2e-11
3q96_A 282 B-Raf Kinase Domain In Complex With A Tetrahydronap 2e-11
4dbn_A 284 Crystal Structure Of The Kinase Domain Of Human B-R 2e-11
1uwj_A 276 The Complex Of Mutant V599e B-raf And Bay439006 Len 2e-11
3d4q_A 307 Pyrazole-Based Inhibitors Of B-Raf Kinase Length = 2e-11
3ii5_A 306 The Complex Of Wild-Type B-Raf With Pyrazolo Pyrimi 3e-11
1uwh_A 276 The Complex Of Wild Type B-Raf And Bay439006 Length 3e-11
3idp_A 300 B-Raf V600e Kinase Domain In Complex With An Aminoi 3e-11
4gs6_A 315 Irreversible Inhibition Of Tak1 Kinase By 5z-7-oxoz 3e-11
4g9r_A 307 B-Raf V600e Kinase Domain Bound To A Type Ii Dihydr 4e-11
2eva_A 307 Structural Basis For The Interaction Of Tak1 Kinase 4e-11
3c4c_A 280 B-Raf Kinase In Complex With Plx4720 Length = 280 6e-11
4fk3_A 292 B-Raf Kinase V600e Oncogenic Mutant In Complex With 8e-11
3dae_A 283 Crystal Structure Of Phosphorylated Snf1 Kinase Dom 8e-11
3hyh_A 275 Crystal Structure Of The Protein Kinase Domain Of Y 8e-11
3mn3_A 271 An Inhibited Conformation For The Protein Kinase Do 9e-11
2fh9_A 274 Structure And Dimerization Of The Kinase Domain Fro 9e-11
3og7_A 289 B-Raf Kinase V600e Oncogenic Mutant In Complex With 2e-10
3coh_A268 Crystal Structure Of Aurora-A In Complex With A Pen 2e-10
2bfy_A 284 Complex Of Aurora-B With Incenp And Hesperidin. Len 4e-10
2bfx_B 284 Mechanism Of Aurora-B Activation By Incenp And Inhi 4e-10
2vrx_A 285 Structure Of Aurora B Kinase In Complex With Zm4474 4e-10
2r0i_A 327 Crystal Structure Of A Kinase Mark2PAR-1 Mutant Len 5e-10
1zmu_A 327 Catalytic And Ubiqutin-Associated Domains Of Mark2P 5e-10
3mpm_A267 Lck Complexed With A Pyrazolopyrimidine Length = 26 5e-10
1zmw_A 327 Catalytic And Ubiqutin-Associated Domains Of Mark2P 5e-10
2wtw_A 285 Aurora-A Inhibitor Structure (2nd Crystal Form) Len 6e-10
2wtv_A 285 Aurora-A Inhibitor Structure Length = 285 7e-10
2wqb_A 324 Structure Of The Tie2 Kinase Domain In Complex With 7e-10
2hak_A 328 Catalytic And Ubiqutin-Associated Domains Of Mark1P 7e-10
3iec_A 319 Helicobacter Pylori Caga Inhibits Par1MARK FAMILY K 8e-10
3nrm_A 283 Imidazo[1,2-A]pyrazine-Based Aurora Kinase Inhibito 9e-10
1zmv_A 327 Catalytic And Ubiqutin-Associated Domains Of Mark2P 9e-10
2wzj_A 327 Catalytic And Uba Domain Of Kinase Mark2(PAR-1) K82 1e-09
3h0y_A268 Aurora A In Complex With A Bisanilinopyrimidine Len 1e-09
3qbn_A 281 Structure Of Human Aurora A In Complex With A Diami 1e-09
3s95_A 310 Crystal Structure Of The Human Limk1 Kinase Domain 1e-09
1yi6_A 276 C-Term Tail Segment Of Human Tyrosine Kinase (258-5 1e-09
3pls_A 298 Ron In Complex With Ligand Amp-Pnp Length = 298 2e-09
2zm1_A 285 Crystal Structure Of Imidazo Pyrazin 1 Bound To The 2e-09
3r21_A271 Design, Synthesis, And Biological Evaluation Of Pyr 2e-09
2bdf_A 279 Src Kinase In Complex With Inhibitor Ap23451 Length 2e-09
3kxz_A 287 The Complex Crystal Structure Of Lck With A Probe M 2e-09
3kmm_A 288 Structure Of Human Lck Kinase With A Small Molecule 2e-09
2og8_A265 Crystal Structure Of Aminoquinazoline 36 Bound To L 2e-09
3bys_A277 Co-Crystal Structure Of Lck And Aminopyrimidine Ami 2e-09
1mq4_A272 Crystal Structure Of Aurora-A Protein Kinase Length 2e-09
3unz_A 279 Aurora A In Complex With Rpm1679 Length = 279 2e-09
2ofu_A273 X-Ray Crystal Structure Of 2-Aminopyrimidine Carbam 2e-09
3lck_A271 The Kinase Domain Of Human Lymphocyte Kinase (Lck), 2e-09
2pl0_A 289 Lck Bound To Imatinib Length = 289 2e-09
2of2_A271 Crystal Structure Of Furanopyrimidine 8 Bound To Lc 2e-09
2h8h_A 535 Src Kinase In Complex With A Quinazoline Inhibitor 2e-09
1y57_A 452 Structure Of Unphosphorylated C-Src In Complex With 2e-09
3bym_A272 X-Ray Co-Crystal Structure Aminobenzimidazole Triaz 2e-09
1fmk_A 452 Crystal Structure Of Human Tyrosine-Protein Kinase 2e-09
1qpe_A 279 Structural Analysis Of The Lymphocyte-Specific Kina 2e-09
2ofv_A 277 Crystal Structure Of Aminoquinazoline 1 Bound To Lc 2e-09
3h4j_B 336 Crystal Structure Of Pombe Ampk Kdaid Fragment Leng 2e-09
3ha6_A268 Crystal Structure Of Aurora A In Complex With Tpx2 2e-09
2j50_A 280 Structure Of Aurora-2 In Complex With Pha-739358 Le 2e-09
2x6d_A 285 Aurora-A Bound To An Inhibitor Length = 285 2e-09
3o50_A267 Crystal Structure Of Benzamide 9 Bound To Auroraa L 2e-09
2xng_A 283 Structure Of Aurora-A Bound To A Selective Imidazop 2e-09
3e5a_A268 Crystal Structure Of Aurora A In Complex With Vx-68 2e-09
2w1d_A 275 Structure Determination Of Aurora Kinase In Complex 2e-09
3g6h_A 286 Src Thr338ile Inhibited In The Dfg-Asp-Out Conforma 3e-09
3dqw_A 286 C-Src Kinase Domain Thr338ile Mutant In Complex Wit 3e-09
1ol5_A 282 Structure Of Aurora-A 122-403, Phosphorylated On Th 3e-09
2dwb_A 285 Aurora-A Kinase Complexed With Amppnp Length = 285 3e-09
1ksw_A 452 Structure Of Human C-Src Tyrosine Kinase (Thr338gly 3e-09
2w1c_A 275 Structure Determination Of Aurora Kinase In Complex 3e-09
1qpd_A 279 Structural Analysis Of The Lymphocyte-specific Kina 3e-09
2wqe_A262 Structure Of S155r Aurora-A Somatic Mutant Length = 3e-09
2w5a_A 279 Human Nek2 Kinase Adp-Bound Length = 279 3e-09
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 3e-09
2j4z_A 306 Structure Of Aurora-2 In Complex With Pha-680626 Le 3e-09
3u4w_A 275 Src In Complex With Dna-Templated Macrocyclic Inhib 3e-09
3svv_A 286 Crystal Structure Of T338c C-Src Covalently Bound T 3e-09
2oiq_A 286 Crystal Structure Of Chicken C-Src Kinase Domain In 3e-09
2jav_A 279 Human Kinase With Pyrrole-Indolinone Ligand Length 3e-09
4a4x_A 279 Nek2-Ede Bound To Cct248662 Length = 279 3e-09
3d7u_B 277 Structural Basis For The Recognition Of C-Src By It 3e-09
2qnj_A 328 Kinase And Ubiquitin-Associated Domains Of Mark3PAR 3e-09
4aw5_A 291 Complex Of The Ephb4 Kinase Domain With An Oxindole 3e-09
2qok_A 373 Human Epha3 Kinase And Juxtamembrane Region, Y596f: 4e-09
3fe3_A 328 Crystal Structure Of The Kinase Mark3PAR-1: T211a-S 4e-09
2xru_A 280 Aurora-A T288e Complexed With Pha-828300 Length = 2 4e-09
2c6e_A 283 Aurora A Kinase Activated Mutant (T287d) In Complex 4e-09
1muo_A 297 Crystal Structure Of Aurora-2, An Oncogenic Serine- 4e-09
2vwu_A 302 Ephb4 Kinase Domain Inhibitor Complex Length = 302 4e-09
1yoj_A 283 Crystal Structure Of Src Kinase Domain Length = 283 4e-09
4apc_A 350 Crystal Structure Of Human Nima-Related Kinase 1 (N 4e-09
2qq7_A 286 Crystal Structure Of Drug Resistant Src Kinase Doma 5e-09
1yol_A 283 Crystal Structure Of Src Kinase Domain In Complex W 5e-09
3fdn_A 279 Structure-Based Drug Design Of Novel Aurora Kinase 5e-09
1fvr_A 327 Tie2 Kinase Domain Length = 327 5e-09
2oo8_X 317 Synthesis, Structural Analysis, And Sar Studies Of 5e-09
3sxr_A 268 Crystal Structure Of Bmx Non-Receptor Tyrosine Kina 5e-09
3lau_A 287 Crystal Structure Of Aurora2 Kinase In Complex With 5e-09
2c6d_A 275 Aurora A Kinase Activated Mutant (T287d) In Complex 6e-09
2dq7_X 283 Crystal Structure Of Fyn Kinase Domain Complexed Wi 6e-09
3oez_A 286 Crystal Structure Of The L317i Mutant Of The Chicke 6e-09
2bmc_A 306 Aurora-2 T287d T288d Complexed With Pha-680632 Leng 6e-09
2hwo_A 286 Crystal Structure Of Src Kinase Domain In Complex W 6e-09
3dzq_A 361 Human Epha3 Kinase Domain In Complex With Inhibitor 7e-09
3d7t_A269 Structural Basis For The Recognition Of C-Src By It 7e-09
3a4o_X 286 Lyn Kinase Domain Length = 286 7e-09
1byg_A278 Kinase Domain Of Human C-Terminal Src Kinase (Csk) 7e-09
2qoo_A 373 Human Epha3 Kinase And Juxtamembrane Region, Y596f: 7e-09
2qoc_A 344 Human Epha3 Kinase Domain, Phosphorylated, Amp-Pnp 7e-09
1y8g_A 327 Catalytic And Ubiqutin-Associated Domains Of Mark2P 7e-09
2g15_A 318 Structural Characterization Of Autoinhibited C-Met 8e-09
2qoi_A 373 Human Epha3 Kinase And Juxtamembrane Region, Y596f: 8e-09
3d7u_A263 Structural Basis For The Recognition Of C-Src By It 8e-09
4gg5_A 319 Crystal Structure Of Cmet In Complex With Novel Inh 8e-09
3geq_A 286 Structural Basis For The Chemical Rescue Of Src Kin 8e-09
2fo0_A 495 Organization Of The Sh3-Sh2 Unit In Active And Inac 9e-09
2wgj_A 306 X-Ray Structure Of Pf-02341066 Bound To The Kinase 9e-09
1k9a_A450 Crystal Structure Analysis Of Full-Length Carboxyl- 9e-09
2wd1_A 292 Human C-Met Kinase In Complex With Azaindole Inhibi 9e-09
2qof_A 373 Human Epha3 Kinase And Juxtamembrane Region, Y596f 9e-09
2qod_A 373 Human Epha3 Kinase And Juxtamembrane Region, Y602f 9e-09
3q6w_A 307 Structure Of Dually-phosphorylated Met Receptor Kin 9e-09
3q6u_A 308 Structure Of The Apo Met Receptor Kinase In The Dua 9e-09
2qol_A 373 Human Epha3 Kinase And Juxtamembrane Region, Y596:y 9e-09
2gsf_A 373 The Human Epha3 Receptor Tyrosine Kinase And Juxtam 9e-09
1opl_A 537 Structural Basis For The Auto-Inhibition Of C-Abl T 1e-08
2xne_A272 Structure Of Aurora-A Bound To An Imidazopyrazine I 1e-08
3fxx_A 371 Human Epha3 Kinase And Juxtamembrane Region Bound T 1e-08
3lq8_A 302 Structure Of The Kinase Domain Of C-Met Bound To Xl 1e-08
2rfn_A 310 X-ray Structure Of C-met With Inhibitor. Length = 3 1e-08
1ol6_A 282 Structure Of Unphosphorylated D274n Mutant Of Auror 1e-08
3i5n_A 309 Crystal Structure Of C-Met With Triazolopyridazine 1e-08
3daj_A272 Crystal Structure Of Aurora A Complexed With An Inh 1e-08
3f66_A 298 Human C-Met Kinase In Complex With Quinoxaline Inhi 1e-08
3d14_A272 Crystal Structure Of Mouse Aurora A (Asn186->gly, L 1e-08
3omv_A 307 Crystal Structure Of C-Raf (Raf-1) Length = 307 1e-08
2zv7_A 279 Lyn Tyrosine Kinase Domain, Apo Form Length = 279 1e-08
1opk_A 495 Structural Basis For The Auto-Inhibition Of C-Abl T 2e-08
3k54_A 283 Structures Of Human Bruton's Tyrosine Kinase In Act 2e-08
2ptk_A 453 Chicken Src Tyrosine Kinase Length = 453 2e-08
3niz_A 311 Cryptosporidium Parvum Cyclin-Dependent Kinase Cgd5 2e-08
2qkr_A 313 Cryptosporidium Parvum Cyclin-Dependent Kinase Cgd5 2e-08
3gen_A 283 The 1.6 A Crystal Structure Of Human Bruton's Tyros 2e-08
3pix_A 274 Crystal Structure Of Btk Kinase Domain Complexed Wi 2e-08
3ocs_A 271 Crystal Structure Of Bruton's Tyrosine Kinase In Co 2e-08
3oct_A265 Crystal Structure Of Bruton's Tyrosine Kinase Mutan 2e-08
1k2p_A 263 Crystal Structure Of Bruton's Tyrosine Kinase Domai 2e-08
3p08_A 267 Crystal Structure Of The Human Btk Kinase Domain Le 2e-08
3c1x_A 373 Crystal Structure Of The Tyrosine Kinase Domain Of 2e-08
3a4p_A 319 Human C-Met Kinase Domain Complexed With 6-Benzylox 2e-08
1mqb_A 333 Crystal Structure Of Ephrin A2 (Epha2) Receptor Pro 2e-08
3dkg_A 317 Sgx Clone 5698a109kfg1h1 Length = 317 2e-08
3qti_A 314 C-Met Kinase In Complex With Nvp-Bvu972 Length = 31 3e-08
3qrj_A277 The Crystal Structure Of Human Abl1 Kinase Domain T 3e-08
2v7a_A 286 Crystal Structure Of The T315i Abl Mutant In Comple 3e-08
1r0p_A 312 Crystal Structure Of The Tyrosine Kinase Domain Of 3e-08
3dkc_A 317 Sgx Clone 5698a65kfg1h1 Length = 317 3e-08
2f4j_A 287 Structure Of The Kinase Domain Of An Imatinib-Resis 3e-08
3gvu_A292 The Crystal Structure Of Human Abl2 In Complex With 3e-08
2buj_A 317 Crystal Structure Of The Human Serine-Threonine Kin 3e-08
2hyy_A273 Human Abl Kinase Domain In Complex With Imatinib (S 3e-08
3cth_A 314 Crystal Structure Of The Tyrosine Kinase Domain Of 3e-08
3qri_A277 The Crystal Structure Of Human Abl1 Kinase Domain I 3e-08
2gqg_A278 X-Ray Crystal Structure Of Dasatinib (Bms-354825) B 3e-08
2e2b_A 293 Crystal Structure Of The C-Abl Kinase Domain In Com 3e-08
2g2f_A 287 A Src-Like Inactive Conformation In The Abl Tyrosin 4e-08
2hz0_A270 Abl Kinase Domain In Complex With Nvp-Aeg082 Length 4e-08
3pyy_A 298 Discovery And Characterization Of A Cell-Permeable, 4e-08
1u5q_A 348 Crystal Structure Of The Tao2 Kinase Domain: Activa 4e-08
2hzi_A277 Abl Kinase Domain In Complex With Pd180970 Length = 4e-08
2hiw_A 287 Crystal Structure Of Inactive Conformation Abl Kina 4e-08
2g1t_A 287 A Src-Like Inactive Conformation In The Abl Tyrosin 4e-08
2h6d_A 276 Protein Kinase Domain Of The Human 5'-Amp-Activated 5e-08
2yza_A 276 Crystal Structure Of Kinase Domain Of Human 5'-Amp- 6e-08
2gcd_A 309 Tao2 Kinase Domain-Staurosporine Structure Length = 6e-08
3dk6_A 293 Crystal Structure Of Mutant Abl Kinase Domain In Co 6e-08
2qon_A 373 Human Epha3 Kinase And Juxtamembrane Region, Y596f: 6e-08
4bbe_A 298 Aminoalkylpyrimidine Inhibitor Complexes With Jak2 7e-08
2qob_A 344 Human Epha3 Kinase Domain, Base Structure Length = 7e-08
3dk7_A 277 Crystal Structure Of Mutant Abl Kinase Domain In Co 7e-08
3oy3_A 284 Crystal Structure Of Abl T315i Mutant Kinase Domain 8e-08
2z60_A 288 Crystal Structure Of The T315i Mutant Of Abl Kinase 8e-08
1luf_A 343 Crystal Structure Of The Musk Tyrosine Kinase: Insi 8e-08
2qo7_A 373 Human Epha3 Kinase And Juxtamembrane Region, Dephos 9e-08
3oxz_A 284 Crystal Structure Of Abl Kinase Domain Bound With A 9e-08
2qoh_A 288 Crystal Structure Of Abl Kinase Bound With Ppy-a Le 9e-08
1fpu_A 293 Crystal Structure Of Abl Kinase Domain In Complex W 9e-08
3cok_A 278 Crystal Structure Of Plk4 Kinase Length = 278 1e-07
3dk3_A 293 Crystal Structure Of Mutant Abl Kinase Domain In Co 1e-07
1b6c_B 342 Crystal Structure Of The Cytoplasmic Domain Of The 1e-07
4agu_A 311 Crystal Structure Of The Human Cdkl1 Kinase Domain 1e-07
3jy9_A 311 Janus Kinase 2 Inhibitors Length = 311 1e-07
3io7_A 313 2-Aminopyrazolo[1,5-A]pyrimidines As Potent And Sel 1e-07
1py5_A 326 Crystal Structure Of Tgf-Beta Receptor I Kinase Wit 1e-07
2hel_A 306 Crystal Structure Of A Mutant Epha4 Kinase Domain ( 1e-07
1ua2_A 346 Crystal Structure Of Human Cdk7 Length = 346 1e-07
3kul_B 325 Kinase Domain Of Human Ephrin Type-A Receptor 8 (Ep 1e-07
3kul_A 325 Kinase Domain Of Human Ephrin Type-A Receptor 8 (Ep 1e-07
2p0c_A 313 Catalytic Domain Of The Proto-Oncogene Tyrosine-Pro 1e-07
4gt4_A 308 Structure Of Unliganded, Inactive Ror2 Kinase Domai 1e-07
3tzm_A 309 Tgf-Beta Receptor Type 1 In Complex With Sb431542 L 1e-07
2w1i_A 326 Structure Determination Of Aurora Kinase In Complex 2e-07
1ob3_A 288 Structure Of P. Falciparum Pfpk5 Length = 288 2e-07
1rw8_A 301 Crystal Structure Of Tgf-Beta Receptor I Kinase Wit 2e-07
1v0o_A 288 Structure Of P. Falciparum Pfpk5-Indirubin-5-Sulpho 2e-07
3zzw_A289 Crystal Structure Of The Kinase Domain Of Ror2 Leng 2e-07
2wot_A 306 Alk5 In Complex With 4-((5,6-Dimethyl-2-(2-Pyridyl) 2e-07
1v0b_A 288 Crystal Structure Of The T198a Mutant Of Pfpk5 Leng 2e-07
2xyu_A 285 Crystal Structure Of Epha4 Kinase Domain In Complex 2e-07
3nz0_A 302 Non-Phosphorylated Tyk2 Kinase With Cmp6 Length = 3 2e-07
3ugc_A 295 Structural Basis Of Jak2 Inhibition By The Type Ii 2e-07
1vjy_A 303 Crystal Structure Of A Naphthyridine Inhibitor Of H 2e-07
1jpa_A 312 Crystal Structure Of Unphosphorylated Ephb2 Recepto 2e-07
4e4m_A 302 Jak2 Kinase (Jh1 Domain) In Complex With Compound 3 2e-07
2pz5_A 324 Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D 2e-07
2y6m_A 291 Crystal Structure Of Epha4 Kinase Domain Length = 2 2e-07
4hge_A 300 Jak2 Kinase (Jh1 Domain) In Complex With Compound 8 2e-07
3lpb_A 295 Crystal Structure Of Jak2 Complexed With A Potent 2 2e-07
3nyx_A 302 Non-Phosphorylated Tyk2 Jh1 Domain With Quinoline-T 2e-07
4aqc_A 301 Triazolopyridine-Based Inhibitor Of Janus Kinase 2 2e-07
2b7a_A 293 The Structural Basis Of Janus Kinase 2 Inhibition B 2e-07
3my0_A 305 Crystal Structure Of The Acvrl1 (Alk1) Kinase Domai 2e-07
3rvg_A 303 Crystals Structure Of Jak2 With A 1-Amino-5h-Pyrido 2e-07
3tjc_A 298 Co-Crystal Structure Of Jak2 With Thienopyridine 8 2e-07
3q32_A 301 Structure Of Janus Kinase 2 With A Pyrrolotriazine 2e-07
3e62_A 293 Fragment Based Discovery Of Jak-2 Inhibitors Length 2e-07
2x7f_A 326 Crystal Structure Of The Kinase Domain Of Human Tra 3e-07
3g51_A 325 Structural Diversity Of The Active Conformation Of 3e-07
4el9_A 305 Structure Of N-Terminal Kinase Domain Of Rsk2 With 3e-07
2j51_A 325 Crystal Structure Of Human Ste20-Like Kinase Bound 3e-07
3ubd_A 304 Structure Of N-Terminal Domain Of Rsk2 Kinase In Co 3e-07
2xa4_A 298 Inhibitors Of Jak2 Kinase Domain Length = 298 3e-07
2jfm_A 325 Crystal Structure Of Human Ste20-Like Kinase (Unlig 3e-07
2jfl_A 325 Crystal Structure Of Human Ste20-Like Kinase ( Diph 3e-07
2hen_A 286 Crystal Structure Of The Ephb2 Receptor Kinase Doma 3e-07
1koa_A 491 Twitchin Kinase Fragment (C.Elegans), Autoregulated 4e-07
1fot_A 318 Structure Of The Unliganded Camp-Dependent Protein 4e-07
3uto_A 573 Twitchin Kinase Region From C.Elegans (Fn31-Nl-Kin- 4e-07
2f57_A 317 Crystal Structure Of The Human P21-activated Kinase 4e-07
2ivv_A 314 Crystal Structure Of Phosphorylated Ret Tyrosine Ki 4e-07
2rei_A 318 Kinase Domain Of Human Ephrin Type-a Receptor 7 (ep 5e-07
3cd3_A 377 Crystal Structure Of Phosphorylated Human Feline Sa 6e-07
2y94_A 476 Structure Of An Active Form Of Mammalian Ampk Lengt 6e-07
3bkb_A 377 Crystal Structure Of Human Feline Sarcoma Viral Onc 6e-07
1zy4_A 303 Crystal Structure Of Eif2alpha Protein Kinase Gcn2: 6e-07
4fr4_A 384 Crystal Structure Of Human SerineTHREONINE-Protein 6e-07
2r2p_A 295 Kinase Domain Of Human Ephrin Type-A Receptor 5 (Ep 7e-07
3gqi_A 326 Crystal Structure Of Activated Receptor Tyrosine Ki 7e-07
4bc6_A 293 Crystal Structure Of Human Serine Threonine Kinase- 7e-07
3kxx_A 317 Structure Of The Mutant Fibroblast Growth Factor Re 7e-07
2x4f_A 373 The Crystal Structure Of The Human Myosin Light Cha 7e-07
2j7t_A 302 Crystal Structure Of Human Serine Threonine Kinase- 8e-07
2pzr_A 324 Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D 8e-07
2uv2_A 287 Crystal Structure Of Human Ste20-Like Kinase Bound 8e-07
2pzp_A 324 Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D 8e-07
2pvy_A 324 Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D 9e-07
3cly_A 334 Crystal Structure Of Fgf Receptor 2 (Fgfr2) Kinase 9e-07
2ivt_A 314 Crystal Structure Of Phosphorylated Ret Tyrosine Ki 9e-07
2psq_A 370 Crystal Structure Of Unphosphorylated Unactivated W 9e-07
2ivs_A 314 Crystal Structure Of Non-Phosphorylated Ret Tyrosin 9e-07
3tt0_A 382 Co-Structure Of Fibroblast Growth Factor Receptor 1 1e-06
3q4z_A 306 Structure Of Unphosphorylated Pak1 Kinase Domain Le 1e-06
4asz_A 299 Crystal Structure Of Apo Trkb Kinase Domain Length 1e-06
2qlu_A 314 Crystal Structure Of Activin Receptor Type Ii Kinas 1e-06
3b2t_A 311 Structure Of Phosphotransferase Length = 311 1e-06
1gjo_A 316 The Fgfr2 Tyrosine Kinase Domain Length = 316 1e-06
2pwl_A 324 Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D 1e-06
3ri1_A 313 Crystal Structure Of The Catalytic Domain Of Fgfr2 1e-06
1zxe_A 303 Crystal Structure Of Eif2alpha Protein Kinase Gcn2: 1e-06
4aaa_A 331 Crystal Structure Of The Human Cdkl2 Kinase Domain 2e-06
2iw8_A 302 Structure Of Human Thr160-Phospho Cdk2-Cyclin A F82 2e-06
3gql_A 326 Crystal Structure Of Activated Receptor Tyrosine Ki 2e-06
1fgk_A 310 Crystal Structure Of The Tyrosine Kinase Domain Of 2e-06
4f63_A 309 Crystal Structure Of Human Fibroblast Growth Factor 2e-06
3h9r_A 330 Crystal Structure Of The Kinase Domain Of Type I Ac 2e-06
3js2_A 317 Crystal Structure Of Minimal Kinase Domain Of Fibro 2e-06
3c4f_A 302 Fgfr Tyrosine Kinase Domain In Complex With 3-(3- M 2e-06
3rhx_B 306 Crystal Structure Of The Catalytic Domain Of Fgfr1 2e-06
1f3m_C 297 Crystal Structure Of Human SerineTHREONINE KINASE P 2e-06
2pvf_A 334 Crystal Structure Of Tyrosine Phosphorylated Activa 2e-06
2i1m_A 333 Cfms Tyrosine Kinase (Tie2 Kid) In Complex With An 2e-06
3riz_A 772 Crystal Structure Of The Plant Steroid Receptor Bri 2e-06
3riz_A772 Crystal Structure Of The Plant Steroid Receptor Bri 9e-05
3rgx_A 768 Structural Insight Into Brassinosteroid Perception 2e-06
3rgx_A768 Structural Insight Into Brassinosteroid Perception 9e-05
4aoj_A 329 Human Trka In Complex With The Inhibitor Az-23 Leng 2e-06
4e6d_A 298 Jak2 Kinase (Jh1 Domain) Triple Mutant In Complex W 2e-06
2z7q_A 321 Crystal Structure Of The N-Terminal Kinase Domain O 2e-06
3fxz_A 297 Crystal Structure Of Pak1 Kinase Domain With Ruthen 2e-06
4erw_A 306 Cdk2 In Complex With Staurosporine Length = 306 3e-06
1a06_A 332 Calmodulin-Dependent Protein Kinase From Rat Length 3e-06
3orx_A 316 Pdk1 Mutant Bound To Allosteric Disulfide Fragment 3e-06
3q52_A 306 Structure Of Phosphorylated Pak1 Kinase Domain Leng 3e-06
1ogu_A 302 Structure Of Human Thr160-phospho Cdk2/cyclin A Com 3e-06
1h1p_A 303 Structure Of Human Thr160-Phospho Cdk2CYCLIN A COMP 3e-06
2y7j_A 365 Structure Of Human Phosphorylase Kinase, Gamma 2 Le 3e-06
3pxf_A 306 Cdk2 In Complex With Two Molecules Of 8-Anilino-1-N 3e-06
3mtf_A 301 Crystal Structure Of The Acvr1 Kinase In Complex Wi 3e-06
1e9h_A 297 Thr 160 Phosphorylated Cdk2-Human Cyclin A3 Complex 3e-06
3ezr_A 300 Cdk-2 With Indazole Inhibitor 17 Bound At Its Activ 3e-06
4fg7_A 293 Crystal Structure Of Human Calcium/calmodulin-depen 3e-06
4eoq_A 301 Thr 160 Phosphorylated Cdk2 Wt - Human Cyclin A3 Co 3e-06
1oit_A 299 Imidazopyridines: A Potent And Selective Class Of C 3e-06
4bcq_A 301 Structure Of Cdk2 In Complex With Cyclin A And A 2- 3e-06
4h1j_A 293 Crystal Structure Of Pyk2 With The Pyrazole 13a Len 3e-06
2r5t_A 373 Crystal Structure Of Inactive Serum And Glucocortic 3e-06
4eos_A 300 Thr 160 Phosphorylated Cdk2 Wt - Human Cyclin A3 Co 3e-06
1pf8_A 298 Crystal Structure Of Human Cyclin-dependent Kinase 3e-06
4dym_A 301 Crystal Structure Of The Acvr1 Kinase Domain In Com 3e-06
4i3z_A 296 Structure Of Pcdk2CYCLINA BOUND TO ADP AND 2 MAGNES 3e-06
1gii_A 298 Human Cyclin Dependent Kinase 2 Complexed With The 3e-06
1w98_A 298 The Structural Basis Of Cdk2 Activation By Cyclin E 3e-06
1qmz_A 299 Phosphorylated Cdk2-Cyclyin A-Substrate Peptide Com 3e-06
4fg8_A 315 Crystal Structure Of Human Calcium/calmodulin-depen 3e-06
1yhv_A 297 Crystal Structure Of Pak1 Kinase Domain With Two Po 3e-06
3bht_A 300 Structure Of Phosphorylated Thr160 Cdk2CYCLIN A IN 3e-06
4eop_A 300 Thr 160 Phosphorylated Cdk2 Q131e - Human Cyclin A3 3e-06
2jgz_A 289 Crystal Structure Of Phospho-Cdk2 In Complex With C 3e-06
1gz8_A 299 Human Cyclin Dependent Kinase 2 Complexed With The 3e-06
2w17_A 299 Cdk2 In Complex With The Imidazole Pyrimidine Amide 3e-06
1jst_A 298 Phosphorylated Cyclin-Dependent Kinase-2 Bound To C 3e-06
3pj8_A 299 Structure Of Cdk2 In Complex With A Pyrazolo[4,3-D] 3e-06
1fin_A 298 Cyclin A-Cyclin-Dependent Kinase 2 Complex Length = 3e-06
4fg9_A 320 Crystal Structure Of Human Calcium/calmodulin-depen 3e-06
4eoo_A 299 Thr 160 Phosphorylated Cdk2 Q131e - Human Cyclin A3 3e-06
3qhr_A 298 Structure Of A Pcdk2CYCLINA TRANSITION-State Mimic 4e-06
4f0i_A 300 Crystal Structure Of Apo Trka Length = 300 4e-06
1vyw_A 309 Structure Of Cdk2CYCLIN A WITH PNU-292137 Length = 4e-06
3fzo_A 277 Crystal Structure Of Pyk2-Apo, Proline-Rich Tyrosin 4e-06
3cc6_A 281 Crystal Structure Of Kinase Domain Of Protein Tyros 4e-06
4eon_A 300 Thr 160 Phosphorylated Cdk2 H84s, Q85m, Q131e - Hum 4e-06
4eom_A 301 Thr 160 Phosphorylated Cdk2 H84s, Q85m, Q131e - Hum 4e-06
4gt5_A 306 Crystal Structure Of The Inactive Trka Kinase Domai 4e-06
4eoi_A 299 Thr 160 Phosphorylated Cdk2 K89d, Q131e - Human Cyc 4e-06
2bva_A 292 Crystal Structure Of The Human P21-Activated Kinase 4e-06
2iw6_A 302 Structure Of Human Thr160-Phospho Cdk2-Cyclin A Com 4e-06
2phk_A 277 The Crystal Structure Of A Phosphorylase Kinase Pep 4e-06
4eoj_A 302 Thr 160 Phosphorylated Cdk2 H84s, Q85m, K89d - Huma 4e-06
2x4z_A 296 Crystal Structure Of The Human P21-Activated Kinase 4e-06
2r4b_A 321 Erbb4 Kinase Domain Complexed With A Thienopyrimidi 4e-06
3ma6_A 298 Crystal Structure Of Kinase Domain Of Tgcdpk1 In Pr 5e-06
4eok_A 300 Thr 160 Phosphorylated Cdk2 H84s, Q85m, K89d - Huma 5e-06
3dak_A 290 Crystal Structure Of Domain-Swapped Osr1 Kinase Dom 5e-06
2q0b_A 324 Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D 5e-06
4fie_A 423 Full-Length Human Pak4 Length = 423 5e-06
3i79_A 484 Calcium-Dependent Protein Kinase 1 From Toxoplasma 5e-06
1zyc_A 303 Crystal Structure Of Eif2alpha Protein Kinase Gcn2: 5e-06
1ql6_A 298 The Catalytic Mechanism Of Phosphorylase Kinase Pro 6e-06
2cdz_A 303 Crystal Structure Of The Human P21-Activated Kinase 6e-06
1phk_A 298 Two Structures Of The Catalytic Domain Of Phosphory 6e-06
2q0n_A 301 Structure Of Human P21 Activating Kinase 4 (Pak4) I 6e-06
3ku2_A 507 Crystal Structure Of Inactivated Form Of Cdpk1 From 6e-06
4e7w_A 394 Structure Of Gsk3 From Ustilago Maydis Length = 394 6e-06
3hx4_A 508 Crystal Structure Of Cdpk1 Of Toxoplasma Gondii, Tg 6e-06
2vwi_A 303 Structure Of The Osr1 Kinase, A Hypertension Drug T 7e-06
3fme_A 290 Crystal Structure Of Human Mitogen-Activated Protei 7e-06
4e1z_A 291 Structure Of Mouse Tyk-2 Complexed To A 3-Aminoinda 7e-06
2py3_A 324 Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D 7e-06
4e20_A 290 Structure Of Mouse Tyk-2 Complexed To A 3-Aminoinda 8e-06
4af3_A 292 Human Aurora B Kinase In Complex With Incenp And Vx 8e-06
3bbt_B 328 Crystal Structure Of The Erbb4 Kinase In Complex Wi 8e-06
4fif_A 346 Catalytic Domain Of Human Pak4 With Rpkplvdp Peptid 8e-06
3bea_A 333 Cfms Tyrosine Kinase (Tie2 Kid) In Complex With A P 8e-06
1pyx_A 422 Gsk-3 Beta Complexed With Amp-Pnp Length = 422 9e-06
1q3d_A 424 Gsk-3 Beta Complexed With Staurosporine Length = 42 9e-06
3vn9_A 340 Rifined Crystal Structure Of Non-Phosphorylated Map 9e-06
2xik_A 294 Structure Of Human Ysk1 (Yeast Sps1-Ste20-Related K 9e-06
3lxn_A 318 Structural And Thermodynamic Characterization Of Th 9e-06
2hk5_A270 Hck Kinase In Complex With Lck Targetted Inhibitor 9e-06
1i09_A 420 Structure Of Glycogen Synthase Kinase-3 (Gsk3b) Len 9e-06
3say_A 430 Crystal Structure Of Human Glycogen Synthase Kinase 9e-06
1q5k_A 414 Crystal Structure Of Glycogen Synthase Kinase 3 In 9e-06
1mrv_A 339 Crystal Structure Of An Inactive Akt2 Kinase Domain 9e-06
1r0e_A 391 Glycogen Synthase Kinase-3 Beta In Complex With 3-I 9e-06
4acc_A 465 Gsk3b In Complex With Inhibitor Length = 465 1e-05
3nup_A 307 Cdk6 (Monomeric) In Complex With Inhibitor Length = 1e-05
1qcf_A 454 Crystal Structure Of Hck In Complex With A Src Fami 1e-05
1bi8_A 326 Mechanism Of G1 Cyclin Dependent Kinase Inhibition 1e-05
3zrk_A 371 Identification Of 2-(4-Pyridyl)thienopyridinones As 1e-05
3q4t_A 322 Crystal Structure Of Activin Receptor Type-Iia (Acv 1e-05
3mtl_A 324 Crystal Structure Of The Pctaire1 Kinase In Complex 1e-05
3zhp_C 294 Human Mst3 (stk24) In Complex With Mo25beta Length 1e-05
1gng_A 378 Glycogen Synthase Kinase-3 Beta (Gsk3) Complex With 1e-05
4afj_A 367 5-Aryl-4-Carboxamide-1,3-Oxazoles: Potent And Selec 1e-05
3f88_A 349 Glycogen Synthase Kinase 3beta Inhibitor Complex Le 1e-05
2o5k_A 372 Crystal Structure Of Gsk3beta In Complex With A Ben 1e-05
3igo_A 486 Crystal Structure Of Cryptosporidium Parvum Cdpk1, 1e-05
3f7z_A 350 X-ray Co-crystal Structure Of Glycogen Synthase Kin 1e-05
3a60_A 327 Crystal Structure Of Unphosphorylated P70s6k1 (Form 1e-05
3zdi_A 350 Glycogen Synthase Kinase 3 Beta Complexed With Axin 1e-05
4dit_A 382 Crystal Structure Of Gsk3beta In Complex With A Imi 1e-05
3sd0_A 350 Identification Of A Glycogen Synthase Kinase-3b Inh 1e-05
3a62_A 327 Crystal Structure Of Phosphorylated P70s6k1 Length 1e-05
4fvp_A 289 Crystal Structure Of The Jak2 Pseudokinase Domain ( 1e-05
2ow3_A 352 Glycogen Synthase Kinase-3 Beta In Complex With Bis 1e-05
1jow_B 308 Crystal Structure Of A Complex Of Human Cdk6 And A 1e-05
3gb2_A 353 Gsk3beta Inhibitor Complex Length = 353 1e-05
3ll6_A 337 Crystal Structure Of The Human Cyclin G Associated 1e-05
1gzn_A 335 Structure Of Pkb Kinase Domain Length = 335 1e-05
1gzk_A 315 Molecular Mechanism For The Regulation Of Protein K 1e-05
3dfa_A286 Crystal Structure Of Kinase Domain Of Calcium-depen 1e-05
3v5q_A 297 Discovery Of A Selective Trk Inhibitor With Efficac 2e-05
3ckw_A 304 Crystal Structure Of Sterile 20-Like Kinase 3 (Mst3 2e-05
1oir_A 299 Imidazopyridines: A Potent And Selective Class Of C 2e-05
1h01_A 298 Cdk2 In Complex With A Disubstituted 2, 4-Bis Anili 2e-05
2wei_A287 Crystal Structure Of The Kinase Domain Of Cryptospo 2e-05
1o6k_A 336 Structure Of Activated Form Of Pkb Kinase Domain S4 2e-05
3e87_A 335 Crystal Structures Of The Kinase Domain Of Akt2 In 2e-05
3ckx_A 304 Crystal Structure Of Sterile 20-Like Kinase 3 (Mst3 2e-05
2r7b_A 312 Crystal Structure Of The Phosphoinositide-Dependent 2e-05
3qc4_A 314 Pdk1 In Complex With Dfg-Out Inhibitor Xxx Length = 2e-05
1z5m_A 286 Crystal Structure Of N1-[3-[[5-bromo-2-[[3-[(1-pyrr 2e-05
1h1w_A 289 High Resolution Crystal Structure Of The Human Pdk1 2e-05
2jc6_A 334 Crystal Structure Of Human Calmodulin-Dependent Pro 2e-05
3a7f_A 303 Human Mst3 Kinase Length = 303 2e-05
4dc2_A 396 Structure Of Pkc In Complex With A Substrate Peptid 2e-05
2xch_A 309 Crystal Structure Of Pdk1 In Complex With A Pyrazol 2e-05
3iop_A 312 Pdk-1 In Complex With The Inhibitor Compound-8i Len 2e-05
1uu3_A 310 Structure Of Human Pdk1 Kinase Domain In Complex Wi 2e-05
1uu9_A 286 Structure Of Human Pdk1 Kinase Domain In Complex Wi 2e-05
3h9o_A 311 Phosphoinositide-Dependent Protein Kinase 1 (Pdk-1) 2e-05
4a07_A 311 Human Pdk1 Kinase Domain In Complex With Allosteric 2e-05
3sc1_A 311 Novel Isoquinolone Pdk1 Inhibitors Discovered Throu 2e-05
3hrc_A 311 Crystal Structure Of A Mutant Of Human Pdk1 Kinase 2e-05
2biy_A 310 Structure Of Pdk1-S241a Mutant Kinase Domain Length 2e-05
4fvr_A 289 Crystal Structure Of The Jak2 Pseudokinase Domain M 2e-05
3nus_A 286 Phosphoinositide-Dependent Kinase-1 (Pdk1) With Fra 2e-05
1yvj_A 290 Crystal Structure Of The Jak3 Kinase Domain In Comp 2e-05
2jdo_A 342 Structure Of Pkb-Beta (Akt2) Complexed With Isoquin 2e-05
3rwp_A 311 Discovery Of A Novel, Potent And Selective Inhibito 2e-05
1o6l_A 337 Crystal Structure Of An Activated Akt/protein Kinas 2e-05
3nun_A 292 Phosphoinositide-Dependent Kinase-1 (Pdk1) With Lea 2e-05
1ad5_A438 Src Family Kinase Hck-Amp-Pnp Complex Length = 438 2e-05
3nax_A 311 Pdk1 In Complex With Inhibitor Mp7 Length = 311 3e-05
3i7c_A 484 Calcium-Dependent Protein Kinase 1 From Toxoplasma 3e-05
3nay_A 311 Pdk1 In Complex With Inhibitor Mp6 Length = 311 3e-05
3pjc_A 315 Crystal Structure Of Jak3 Complexed With A Potent A 3e-05
4hvd_A 314 Jak3 Kinase Domain In Complex With 2-cyclopropyl-5h 3e-05
3lxk_A 327 Structural And Thermodynamic Characterization Of Th 3e-05
2wel_A 327 Crystal Structure Of Su6656-Bound CalciumCALMODULIN 3e-05
3pwy_A 311 Crystal Structure Of An Extender (Spd28345)-Modifie 4e-05
2wqm_A 310 Structure Of Apo Human Nek7 Length = 310 4e-05
3soa_A 444 Full-Length Human Camkii Length = 444 4e-05
2vz6_A 313 Structure Of Human Calcium Calmodulin Dependent Pro 4e-05
2vn9_A 301 Crystal Structure Of Human Calcium Calmodulin Depen 4e-05
1uv5_A 350 Glycogen Synthase Kinase 3 Beta Complexed With 6-Br 4e-05
4ec8_A 373 Structure Of Full Length Cdk9 In Complex With Cycli 4e-05
1h8f_A 352 Glycogen Synthase Kinase 3 Beta. Length = 352 5e-05
4e4l_A 302 Jak1 Kinase (Jh1 Domain) In Complex With Compound 3 5e-05
3blh_A 331 Crystal Structure Of Human Cdk9CYCLINT1 Length = 33 5e-05
3eyg_A 290 Crystal Structures Of Jak1 And Jak2 Inhibitor Compl 5e-05
3ocb_A 341 Akt1 Kinase Domain With Pyrrolopyrimidine Inhibitor 5e-05
2ogv_A 317 Crystal Structure Of The Autoinhibited Human C-Fms 6e-05
3mi9_A 351 Crystal Structure Of Hiv-1 Tat Complexed With Human 6e-05
1omw_A 689 Crystal Structure Of The Complex Between G Protein- 6e-05
3psc_A 695 Bovine Grk2 In Complex With Gbetagamma Subunits Len 6e-05
3cik_A 689 Human Grk2 In Complex With Gbetagamma Subunits Leng 6e-05
3zh8_A 349 A Novel Small Molecule Apkc Inhibitor Length = 349 6e-05
3krw_A 688 Human Grk2 In Complex With Gbetgamma Subunits And B 6e-05
1zrz_A 364 Crystal Structure Of The Catalytic Domain Of Atypic 6e-05
3mdy_A 337 Crystal Structure Of The Cytoplasmic Domain Of The 6e-05
3a8w_A 345 Crystal Structure Of Pkciota Kinase Domain Length = 7e-05
4gv1_A 340 Pkb Alpha In Complex With Azd5363 Length = 340 7e-05
2xck_A 309 Crystal Structure Of Pdk1 In Complex With A Pyrazol 7e-05
3cqu_A 342 Crystal Structure Of Akt-1 Complexed With Substrate 7e-05
1o9u_A 350 Glycogen Synthase Kinase 3 Beta Complexed With Axin 7e-05
4ic7_A 442 Crystal Structure Of The Erk5 Kinase Domain In Comp 7e-05
4ejn_A 446 Crystal Structure Of Autoinhibited Form Of Akt1 In 7e-05
3o96_A 446 Crystal Structure Of Human Akt1 With An Allosteric 8e-05
3lcd_A 329 Inhibitor Bound To A Dfg-In Structure Of The Kinase 8e-05
2w9f_B 306 Crystal Structure Of Cdk4 In Complex With A D-Type 9e-05
3g33_A 308 Crystal Structure Of Cdk4CYCLIN D3 Length = 308 9e-05
3g2f_A 336 Crystal Structure Of The Kinase Domain Of Bone Morp 9e-05
2w99_B 306 Crystal Structure Of Cdk4 In Complex With A D-Type 9e-05
2w96_B 306 Crystal Structure Of Cdk4 In Complex With A D-Type 9e-05
4b99_A 398 Crystal Structure Of Mapk7 (Erk5) With Inhibitor Le 9e-05
1rjb_A 344 Crystal Structure Of Flt3 Length = 344 1e-04
3uc3_A 361 The Crystal Structure Of Snf1-Related Kinase 2.3 Le 1e-04
2r0u_A 323 Crystal Structure Of Chek1 In Complex With Inhibito 1e-04
2hog_A 322 Crystal Structure Of Chek1 In Complex With Inhibito 1e-04
3ggf_A 301 Crystal Structure Of Human SerineTHREONINE-Protein 1e-04
2c30_A 321 Crystal Structure Of The Human P21-Activated Kinase 2e-04
3is5_A285 Crystal Structure Of Cdpk Kinase Domain From Toxopl 2e-04
2br1_A 297 Structure-Based Design Of Novel Chk1 Inhibitors: In 2e-04
1ia8_A 289 The 1.7 A Crystal Structure Of Human Cell Cycle Che 2e-04
1zlt_A 295 Crystal Structure Of Chk1 Complexed With A Hymenald 2e-04
2b9h_A 353 Crystal Structure Of Fus3 With A Docking Motif From 2e-04
2f9g_A 353 Crystal Structure Of Fus3 Phosphorylated On Tyr182 2e-04
3txo_A 353 Pkc Eta Kinase In Complex With A Naphthyridine Leng 2e-04
4bcf_A 331 Structure Of Cdk9 In Complex With Cyclin T And A 2- 2e-04
2b9f_A 353 Crystal Structure Of Non-Phosphorylated Fus3 Length 2e-04
3nie_A 429 Crystal Structure Of Pf11_0147 Length = 429 2e-04
1zys_A 273 Co-Crystal Structure Of Checkpoint Kinase Chk1 With 2e-04
4fsn_A 278 Crystal Structure Of The Chk1 Length = 278 2e-04
4fsm_A 279 Crystal Structure Of The Chk1 Length = 279 2e-04
3ot3_A 273 X-Ray Crystal Structure Of Compound 22k Bound To Hu 2e-04
4fsw_A 279 Crystal Structure Of The Chk1 Length = 279 2e-04
3qup_A 323 Inhibitor Bound Structure Of The Kinase Domain Of T 2e-04
2x8e_A 276 Discovery Of A Novel Class Of Triazolones As Checkp 2e-04
4ft3_A 279 Crystal Structure Of The Chk1 Length = 279 2e-04
2e9v_A 268 Structure Of H-Chk1 Complexed With A859017 Length = 2e-04
2ayp_A 269 Crystal Structure Of Chk1 With An Indol Inhibitor L 2e-04
4fsy_A 279 Crystal Structure Of The Chk1 Length = 279 2e-04
4fsz_A 279 Crystal Structure Of The Chk1 Length = 279 2e-04
3zut_A 362 The Structure Of Ost1 (D160a) Kinase Length = 362 2e-04
2ghg_A 269 H-Chk1 Complexed With A431994 Length = 269 2e-04
3jvr_A 271 Characterization Of The Chk1 Allosteric Inhibitor B 2e-04
2ydj_A 276 Discovery Of Checkpoint Kinase Inhibitor Azd7762 By 2e-04
4fst_A 269 Crystal Structure Of The Chk1 Length = 269 2e-04
3enm_A 316 The Structure Of The Map2k Mek6 Reveals An Autoinhi 3e-04
4fsu_A 279 Crystal Structure Of The Chk1 Length = 279 3e-04
3zuu_A 362 The Structure Of Ost1 (D160a, S175d) Kinase In Comp 3e-04
3f3z_A 277 Crystal Structure Of Cryptosporidium Parvum Calcium 3e-04
2qg5_A 294 Cryptosporidium Parvum Calcium Dependent Protein Ki 3e-04
3lij_A 494 Crystal Structure Of Full Length Cpcdpk3 (Cgd5_820) 3e-04
3ujg_A 361 Crystal Structure Of Snrk2.6 In Complex With Hab1 L 3e-04
3rgf_A 405 Crystal Structure Of Human Cdk8CYCC Length = 405 4e-04
3kmw_A271 Crystal Structure Of The IlkALPHA-Parvin Core Compl 4e-04
2y4i_B 319 Ksr2-Mek1 Heterodimer Length = 319 4e-04
2i0v_A 335 C-Fms Tyrosine Kinase In Complex With A Quinolone I 4e-04
3aln_A 327 Crystal Structure Of Human Non-Phosphorylated Mkk4 5e-04
2pk9_A 317 Structure Of The Pho85-pho80 Cdk-cyclin Complex Of 5e-04
1x8b_A 289 Structure Of Human Wee1a Kinase: Kinase Domain Comp 6e-04
3zgw_A 347 Crystal Structure Of Maternal Embryonic Leucine Zip 6e-04
3bi6_A 287 Wee1 Kinase Complex With Inhibitor Pd352396 Length 6e-04
1h4l_A 292 Structure And Regulation Of The Cdk5-P25(Nck5a) Com 6e-04
2in6_A 287 Wee1 Kinase Complex With Inhibitor Pd311839 Length 6e-04
3fpq_A290 Crystal Structure Of The Kinase Domain Of Wnk1 Leng 7e-04
2z2w_A 285 Humand Wee1 Kinase Complexed With Inhibitor Pf03357 7e-04
2acx_A 576 Crystal Structure Of G Protein Coupled Receptor Kin 7e-04
2v7o_A 336 Crystal Structure Of Human Calcium-Calmodulin-Depen 8e-04
>pdb|3TL8|A Chain A, The Avrptob-Bak1 Complex Reveals Two Structurally Similar Kinaseinteracting Domains In A Single Type Iii Effector Length = 349 Back     alignment and structure

Iteration: 1

Score = 127 bits (320), Expect = 1e-29, Method: Compositional matrix adjust. Identities = 65/173 (37%), Positives = 100/173 (57%), Gaps = 1/173 (0%) Query: 400 YTVASLQTATNSFSQEFLIGEGSLGRVYRAEFANGKIMAVKKIDNAALSLQEEDNFLEAV 459 +++ LQ A+++FS + ++G G G+VY+ A+G ++AVK++ E F V Sbjct: 28 FSLRELQVASDNFSNKNILGRGGFGKVYKGRLADGTLVAVKRLKEERXQ-GGELQFQTEV 86 Query: 460 SNMSRLRHPNIVTLAGYCAEHGQRLLVYEYVGNGNLHDMLHFADDSSKNLTWNARVRVAL 519 +S H N++ L G+C +RLLVY Y+ NG++ L +S L W R R+AL Sbjct: 87 EMISMAVHRNLLRLRGFCMTPTERLLVYPYMANGSVASCLRERPESQPPLDWPKRQRIAL 146 Query: 520 GTARALEYLHEVCLPSVVHRNFKSANILLDDELNPHLSDCGLAALTPNTERQV 572 G+AR L YLH+ C P ++HR+ K+ANILLD+E + D GLA L + V Sbjct: 147 GSARGLAYLHDHCDPKIIHRDVKAANILLDEEFEAVVGDFGLAKLMDYKDXHV 199
>pdb|3UIM|A Chain A, Structural Basis For The Impact Of Phosphorylation On Plant Receptor- Like Kinase Bak1 Activation Length = 326 Back     alignment and structure
>pdb|2QKW|B Chain B, Structural Basis For Activation Of Plant Immunity By Bacterial Effector Protein Avrpto Length = 321 Back     alignment and structure
>pdb|3HGK|A Chain A, Crystal Structure Of Effect Protein Avrptob Complexed With Kinase Pto Length = 327 Back     alignment and structure
>pdb|2OIB|A Chain A, Crystal Structure Of Irak4 Kinase Domain Apo Form Length = 301 Back     alignment and structure
>pdb|2NRU|A Chain A, Crystal Structure Of Irak-4 Length = 307 Back     alignment and structure
>pdb|2NRY|A Chain A, Crystal Structure Of Irak-4 Length = 307 Back     alignment and structure
>pdb|3P86|A Chain A, Crystal Structure Of Ctr1 Kinase Domain Mutant D676n In Complex With Staurosporine Length = 309 Back     alignment and structure
>pdb|2O8Y|A Chain A, Apo Irak4 Kinase Domain Length = 298 Back     alignment and structure
>pdb|3PPZ|A Chain A, Crystal Structure Of Ctr1 Kinase Domain In Complex With Staurosporine Length = 309 Back     alignment and structure
>pdb|3QGW|A Chain A, Crystal Structure Of Itk Kinase Bound To An Inhibitor Length = 286 Back     alignment and structure
>pdb|4HCT|A Chain A, Crystal Structure Of Itk In Complex With Compound 52 Length = 269 Back     alignment and structure
>pdb|1SM2|A Chain A, Crystal Structure Of The Phosphorylated Interleukin-2 Tyrosine Kinase Catalytic Domain Length = 264 Back     alignment and structure
>pdb|3V5J|A Chain A, Crystal Structure Of Interleukin-2 Inducible T-Cell Kinase Itk Catalytic Domain With Thienopyrazolylindole Inhibitor 090 Length = 266 Back     alignment and structure
>pdb|3DTC|A Chain A, Crystal Structure Of Mixed-Lineage Kinase Mlk1 Complexed With Compound 16 Length = 271 Back     alignment and structure
>pdb|3MIY|A Chain A, X-Ray Crystal Structure Of Itk Complexed With Sunitinib Length = 266 Back     alignment and structure
>pdb|3T9T|A Chain A, Crystal Structure Of Btk Mutant (F435t,K596r) Complexed With Imidazo[1,5-A]quinoxaline Length = 267 Back     alignment and structure
>pdb|3COM|A Chain A, Crystal Structure Of Mst1 Kinase Length = 314 Back     alignment and structure
>pdb|4F0F|A Chain A, Crystal Structure Of The Roco4 Kinase Domain Bound To Appcp From D. Discoideum Length = 287 Back     alignment and structure
>pdb|4F1M|A Chain A, Crystal Structure Of The G1179s Roco4 Kinase Domain Bound To Appcp From D. Discoideum Length = 287 Back     alignment and structure
>pdb|4F1O|A Chain A, Crystal Structure Of The L1180t Mutant Roco4 Kinase Domain From D. Discoideum Bound To Appcp Length = 287 Back     alignment and structure
>pdb|2FB8|A Chain A, Structure Of The B-Raf Kinase Domain Bound To Sb-590885 Length = 281 Back     alignment and structure
>pdb|4H58|A Chain A, Braf In Complex With Compound 3 Length = 275 Back     alignment and structure
>pdb|3Q96|A Chain A, B-Raf Kinase Domain In Complex With A Tetrahydronaphthalene Inhibitor Length = 282 Back     alignment and structure
>pdb|4DBN|A Chain A, Crystal Structure Of The Kinase Domain Of Human B-Raf With A [1, 3]thiazolo[5,4-B]pyridine Derivative Length = 284 Back     alignment and structure
>pdb|1UWJ|A Chain A, The Complex Of Mutant V599e B-raf And Bay439006 Length = 276 Back     alignment and structure
>pdb|3D4Q|A Chain A, Pyrazole-Based Inhibitors Of B-Raf Kinase Length = 307 Back     alignment and structure
>pdb|3II5|A Chain A, The Complex Of Wild-Type B-Raf With Pyrazolo Pyrimidine Inhibitor Length = 306 Back     alignment and structure
>pdb|1UWH|A Chain A, The Complex Of Wild Type B-Raf And Bay439006 Length = 276 Back     alignment and structure
>pdb|3IDP|A Chain A, B-Raf V600e Kinase Domain In Complex With An Aminoisoquinoline Inhibitor Length = 300 Back     alignment and structure
>pdb|4GS6|A Chain A, Irreversible Inhibition Of Tak1 Kinase By 5z-7-oxozeaenol Length = 315 Back     alignment and structure
>pdb|4G9R|A Chain A, B-Raf V600e Kinase Domain Bound To A Type Ii Dihydroquinazoline Inhibitor Length = 307 Back     alignment and structure
>pdb|2EVA|A Chain A, Structural Basis For The Interaction Of Tak1 Kinase With Its Activating Protein Tab1 Length = 307 Back     alignment and structure
>pdb|3C4C|A Chain A, B-Raf Kinase In Complex With Plx4720 Length = 280 Back     alignment and structure
>pdb|4FK3|A Chain A, B-Raf Kinase V600e Oncogenic Mutant In Complex With Plx3203 Length = 292 Back     alignment and structure
>pdb|3DAE|A Chain A, Crystal Structure Of Phosphorylated Snf1 Kinase Domain Length = 283 Back     alignment and structure
>pdb|3HYH|A Chain A, Crystal Structure Of The Protein Kinase Domain Of Yeast Amp-Activated Protein Kinase Snf1 Length = 275 Back     alignment and structure
>pdb|3MN3|A Chain A, An Inhibited Conformation For The Protein Kinase Domain Of The Saccharomyces Cerevisiae Ampk Homolog Snf1 Length = 271 Back     alignment and structure
>pdb|2FH9|A Chain A, Structure And Dimerization Of The Kinase Domain From Yeast Snf1 Length = 274 Back     alignment and structure
>pdb|3OG7|A Chain A, B-Raf Kinase V600e Oncogenic Mutant In Complex With Plx4032 Length = 289 Back     alignment and structure
>pdb|3COH|A Chain A, Crystal Structure Of Aurora-A In Complex With A Pentacyclic Inhibitor Length = 268 Back     alignment and structure
>pdb|2BFY|A Chain A, Complex Of Aurora-B With Incenp And Hesperidin. Length = 284 Back     alignment and structure
>pdb|2VRX|A Chain A, Structure Of Aurora B Kinase In Complex With Zm447439 Length = 285 Back     alignment and structure
>pdb|2R0I|A Chain A, Crystal Structure Of A Kinase Mark2PAR-1 Mutant Length = 327 Back     alignment and structure
>pdb|1ZMU|A Chain A, Catalytic And Ubiqutin-Associated Domains Of Mark2PAR-1: Wild Type Length = 327 Back     alignment and structure
>pdb|3MPM|A Chain A, Lck Complexed With A Pyrazolopyrimidine Length = 267 Back     alignment and structure
>pdb|1ZMW|A Chain A, Catalytic And Ubiqutin-Associated Domains Of Mark2PAR-1: T208aS212A INACTIVE DOUBLE MUTANT Length = 327 Back     alignment and structure
>pdb|2WTW|A Chain A, Aurora-A Inhibitor Structure (2nd Crystal Form) Length = 285 Back     alignment and structure
>pdb|2WTV|A Chain A, Aurora-A Inhibitor Structure Length = 285 Back     alignment and structure
>pdb|2WQB|A Chain A, Structure Of The Tie2 Kinase Domain In Complex With A Thiazolopyrimidine Inhibitor Length = 324 Back     alignment and structure
>pdb|2HAK|A Chain A, Catalytic And Ubiqutin-Associated Domains Of Mark1PAR-1 Length = 328 Back     alignment and structure
>pdb|3IEC|A Chain A, Helicobacter Pylori Caga Inhibits Par1MARK FAMILY KINASES BY Mimicking Host Substrates Length = 319 Back     alignment and structure
>pdb|3NRM|A Chain A, Imidazo[1,2-A]pyrazine-Based Aurora Kinase Inhibitors Length = 283 Back     alignment and structure
>pdb|1ZMV|A Chain A, Catalytic And Ubiqutin-Associated Domains Of Mark2PAR-1: K82r Mutant Length = 327 Back     alignment and structure
>pdb|2WZJ|A Chain A, Catalytic And Uba Domain Of Kinase Mark2(PAR-1) K82r, T208e Double Mutant Length = 327 Back     alignment and structure
>pdb|3H0Y|A Chain A, Aurora A In Complex With A Bisanilinopyrimidine Length = 268 Back     alignment and structure
>pdb|3QBN|A Chain A, Structure Of Human Aurora A In Complex With A Diaminopyrimidine Length = 281 Back     alignment and structure
>pdb|3S95|A Chain A, Crystal Structure Of The Human Limk1 Kinase Domain In Complex With Staurosporine Length = 310 Back     alignment and structure
>pdb|1YI6|A Chain A, C-Term Tail Segment Of Human Tyrosine Kinase (258-533) Length = 276 Back     alignment and structure
>pdb|3PLS|A Chain A, Ron In Complex With Ligand Amp-Pnp Length = 298 Back     alignment and structure
>pdb|2ZM1|A Chain A, Crystal Structure Of Imidazo Pyrazin 1 Bound To The Kinase Domain Of Human Lck, (Auto-Phosphorylated On Tyr394) Length = 285 Back     alignment and structure
>pdb|3R21|A Chain A, Design, Synthesis, And Biological Evaluation Of Pyrazolopyridine- Sulfonamides As Potent Multiple-Mitotic Kinase (Mmk) Inhibitors (Part I) Length = 271 Back     alignment and structure
>pdb|2BDF|A Chain A, Src Kinase In Complex With Inhibitor Ap23451 Length = 279 Back     alignment and structure
>pdb|3KXZ|A Chain A, The Complex Crystal Structure Of Lck With A Probe Molecule W259 Length = 287 Back     alignment and structure
>pdb|3KMM|A Chain A, Structure Of Human Lck Kinase With A Small Molecule Inhibitor Length = 288 Back     alignment and structure
>pdb|2OG8|A Chain A, Crystal Structure Of Aminoquinazoline 36 Bound To Lck Length = 265 Back     alignment and structure
>pdb|3BYS|A Chain A, Co-Crystal Structure Of Lck And Aminopyrimidine Amide 10b Length = 277 Back     alignment and structure
>pdb|1MQ4|A Chain A, Crystal Structure Of Aurora-A Protein Kinase Length = 272 Back     alignment and structure
>pdb|3UNZ|A Chain A, Aurora A In Complex With Rpm1679 Length = 279 Back     alignment and structure
>pdb|2OFU|A Chain A, X-Ray Crystal Structure Of 2-Aminopyrimidine Carbamate 43 Bound To Lck Length = 273 Back     alignment and structure
>pdb|3LCK|A Chain A, The Kinase Domain Of Human Lymphocyte Kinase (Lck), Activated Form (Auto-Phosphorylated On Tyr394) Length = 271 Back     alignment and structure
>pdb|2PL0|A Chain A, Lck Bound To Imatinib Length = 289 Back     alignment and structure
>pdb|2OF2|A Chain A, Crystal Structure Of Furanopyrimidine 8 Bound To Lck Length = 271 Back     alignment and structure
>pdb|2H8H|A Chain A, Src Kinase In Complex With A Quinazoline Inhibitor Length = 535 Back     alignment and structure
>pdb|1Y57|A Chain A, Structure Of Unphosphorylated C-Src In Complex With An Inhibitor Length = 452 Back     alignment and structure
>pdb|3BYM|A Chain A, X-Ray Co-Crystal Structure Aminobenzimidazole Triazine 1 Bound To Lck Length = 272 Back     alignment and structure
>pdb|1FMK|A Chain A, Crystal Structure Of Human Tyrosine-Protein Kinase C-Src Length = 452 Back     alignment and structure
>pdb|1QPE|A Chain A, Structural Analysis Of The Lymphocyte-Specific Kinase Lck In Complex With Non-Selective And Src Family Selective Kinase Inhibitors Length = 279 Back     alignment and structure
>pdb|2OFV|A Chain A, Crystal Structure Of Aminoquinazoline 1 Bound To Lck Length = 277 Back     alignment and structure
>pdb|3H4J|B Chain B, Crystal Structure Of Pombe Ampk Kdaid Fragment Length = 336 Back     alignment and structure
>pdb|3HA6|A Chain A, Crystal Structure Of Aurora A In Complex With Tpx2 And Compound 10 Length = 268 Back     alignment and structure
>pdb|2J50|A Chain A, Structure Of Aurora-2 In Complex With Pha-739358 Length = 280 Back     alignment and structure
>pdb|2X6D|A Chain A, Aurora-A Bound To An Inhibitor Length = 285 Back     alignment and structure
>pdb|3O50|A Chain A, Crystal Structure Of Benzamide 9 Bound To Auroraa Length = 267 Back     alignment and structure
>pdb|2XNG|A Chain A, Structure Of Aurora-A Bound To A Selective Imidazopyrazine Inhibitor Length = 283 Back     alignment and structure
>pdb|3E5A|A Chain A, Crystal Structure Of Aurora A In Complex With Vx-680 And Tpx2 Length = 268 Back     alignment and structure
>pdb|2W1D|A Chain A, Structure Determination Of Aurora Kinase In Complex With Inhibitor Length = 275 Back     alignment and structure
>pdb|3G6H|A Chain A, Src Thr338ile Inhibited In The Dfg-Asp-Out Conformation Length = 286 Back     alignment and structure
>pdb|3DQW|A Chain A, C-Src Kinase Domain Thr338ile Mutant In Complex With Atpgs Length = 286 Back     alignment and structure
>pdb|1OL5|A Chain A, Structure Of Aurora-A 122-403, Phosphorylated On Thr287, Thr288 And Bound To Tpx2 1-43 Length = 282 Back     alignment and structure
>pdb|2DWB|A Chain A, Aurora-A Kinase Complexed With Amppnp Length = 285 Back     alignment and structure
>pdb|1KSW|A Chain A, Structure Of Human C-Src Tyrosine Kinase (Thr338gly Mutant) In Complex With N6-Benzyl Adp Length = 452 Back     alignment and structure
>pdb|2W1C|A Chain A, Structure Determination Of Aurora Kinase In Complex With Inhibitor Length = 275 Back     alignment and structure
>pdb|1QPD|A Chain A, Structural Analysis Of The Lymphocyte-specific Kinase Lck In Complex With Non-selective And Src Family Selective Kinase Inhibitors Length = 279 Back     alignment and structure
>pdb|2WQE|A Chain A, Structure Of S155r Aurora-A Somatic Mutant Length = 262 Back     alignment and structure
>pdb|2W5A|A Chain A, Human Nek2 Kinase Adp-Bound Length = 279 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|2J4Z|A Chain A, Structure Of Aurora-2 In Complex With Pha-680626 Length = 306 Back     alignment and structure
>pdb|3U4W|A Chain A, Src In Complex With Dna-Templated Macrocyclic Inhibitor Mc4b Length = 275 Back     alignment and structure
>pdb|3SVV|A Chain A, Crystal Structure Of T338c C-Src Covalently Bound To Vinylsulfonamide- Pyrazolopyrimidine 9 Length = 286 Back     alignment and structure
>pdb|2OIQ|A Chain A, Crystal Structure Of Chicken C-Src Kinase Domain In Complex With The Cancer Drug Imatinib. Length = 286 Back     alignment and structure
>pdb|2JAV|A Chain A, Human Kinase With Pyrrole-Indolinone Ligand Length = 279 Back     alignment and structure
>pdb|4A4X|A Chain A, Nek2-Ede Bound To Cct248662 Length = 279 Back     alignment and structure
>pdb|3D7U|B Chain B, Structural Basis For The Recognition Of C-Src By Its Inactivator Csk Length = 277 Back     alignment and structure
>pdb|2QNJ|A Chain A, Kinase And Ubiquitin-Associated Domains Of Mark3PAR-1 Length = 328 Back     alignment and structure
>pdb|4AW5|A Chain A, Complex Of The Ephb4 Kinase Domain With An Oxindole Inhibitor Length = 291 Back     alignment and structure
>pdb|2QOK|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596f:y602f:s768a Triple Mutant Length = 373 Back     alignment and structure
>pdb|3FE3|A Chain A, Crystal Structure Of The Kinase Mark3PAR-1: T211a-S215a Double Mutant Length = 328 Back     alignment and structure
>pdb|2XRU|A Chain A, Aurora-A T288e Complexed With Pha-828300 Length = 280 Back     alignment and structure
>pdb|2C6E|A Chain A, Aurora A Kinase Activated Mutant (T287d) In Complex With A 5-Aminopyrimidinyl Quinazoline Inhibitor Length = 283 Back     alignment and structure
>pdb|1MUO|A Chain A, Crystal Structure Of Aurora-2, An Oncogenic Serine- Threonine Kinase Length = 297 Back     alignment and structure
>pdb|2VWU|A Chain A, Ephb4 Kinase Domain Inhibitor Complex Length = 302 Back     alignment and structure
>pdb|1YOJ|A Chain A, Crystal Structure Of Src Kinase Domain Length = 283 Back     alignment and structure
>pdb|4APC|A Chain A, Crystal Structure Of Human Nima-Related Kinase 1 (Nek1) Length = 350 Back     alignment and structure
>pdb|2QQ7|A Chain A, Crystal Structure Of Drug Resistant Src Kinase Domain With Irreversible Inhibitor Length = 286 Back     alignment and structure
>pdb|1YOL|A Chain A, Crystal Structure Of Src Kinase Domain In Complex With Cgp77675 Length = 283 Back     alignment and structure
>pdb|3FDN|A Chain A, Structure-Based Drug Design Of Novel Aurora Kinase A Inhibitors: Structure Basis For Potency And Specificity Length = 279 Back     alignment and structure
>pdb|1FVR|A Chain A, Tie2 Kinase Domain Length = 327 Back     alignment and structure
>pdb|2OO8|X Chain X, Synthesis, Structural Analysis, And Sar Studies Of Triazine Derivatives As Potent, Selective Tie-2 Inhibitors Length = 317 Back     alignment and structure
>pdb|3SXR|A Chain A, Crystal Structure Of Bmx Non-Receptor Tyrosine Kinase Complex With Dasatinib Length = 268 Back     alignment and structure
>pdb|3LAU|A Chain A, Crystal Structure Of Aurora2 Kinase In Complex With A Gsk3beta Inhibitor Length = 287 Back     alignment and structure
>pdb|2C6D|A Chain A, Aurora A Kinase Activated Mutant (T287d) In Complex With Adpnp Length = 275 Back     alignment and structure
>pdb|2DQ7|X Chain X, Crystal Structure Of Fyn Kinase Domain Complexed With Staurosporine Length = 283 Back     alignment and structure
>pdb|3OEZ|A Chain A, Crystal Structure Of The L317i Mutant Of The Chicken C-Src Tyrosine Kinase Domain Complexed With Imatinib Length = 286 Back     alignment and structure
>pdb|2BMC|A Chain A, Aurora-2 T287d T288d Complexed With Pha-680632 Length = 306 Back     alignment and structure
>pdb|2HWO|A Chain A, Crystal Structure Of Src Kinase Domain In Complex With Covalent Inhibitor Length = 286 Back     alignment and structure
>pdb|3DZQ|A Chain A, Human Epha3 Kinase Domain In Complex With Inhibitor Awl-Ii- 38.3 Length = 361 Back     alignment and structure
>pdb|3D7T|A Chain A, Structural Basis For The Recognition Of C-Src By Its Inactivator Csk Length = 269 Back     alignment and structure
>pdb|3A4O|X Chain X, Lyn Kinase Domain Length = 286 Back     alignment and structure
>pdb|1BYG|A Chain A, Kinase Domain Of Human C-Terminal Src Kinase (Csk) In Complex With Inhibitor Staurosporine Length = 278 Back     alignment and structure
>pdb|2QOO|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596f:y602f:y742f Triple Mutant Length = 373 Back     alignment and structure
>pdb|2QOC|A Chain A, Human Epha3 Kinase Domain, Phosphorylated, Amp-Pnp Bound Structure Length = 344 Back     alignment and structure
>pdb|1Y8G|A Chain A, Catalytic And Ubiqutin-Associated Domains Of Mark2PAR-1: Inactive Double Mutant With Selenomethionine Length = 327 Back     alignment and structure
>pdb|2G15|A Chain A, Structural Characterization Of Autoinhibited C-Met Kinase Length = 318 Back     alignment and structure
>pdb|2QOI|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596f:y602f Double Mutant Length = 373 Back     alignment and structure
>pdb|3D7U|A Chain A, Structural Basis For The Recognition Of C-Src By Its Inactivator Csk Length = 263 Back     alignment and structure
>pdb|4GG5|A Chain A, Crystal Structure Of Cmet In Complex With Novel Inhibitor Length = 319 Back     alignment and structure
>pdb|3GEQ|A Chain A, Structural Basis For The Chemical Rescue Of Src Kinase Activity Length = 286 Back     alignment and structure
>pdb|2WGJ|A Chain A, X-Ray Structure Of Pf-02341066 Bound To The Kinase Domain Of C-Met Length = 306 Back     alignment and structure
>pdb|1K9A|A Chain A, Crystal Structure Analysis Of Full-Length Carboxyl-Terminal Src Kinase At 2.5 A Resolution Length = 450 Back     alignment and structure
>pdb|2WD1|A Chain A, Human C-Met Kinase In Complex With Azaindole Inhibitor Length = 292 Back     alignment and structure
>pdb|2QOF|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596f Mutant Length = 373 Back     alignment and structure
>pdb|2QOD|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y602f Mutant Length = 373 Back     alignment and structure
>pdb|3Q6W|A Chain A, Structure Of Dually-phosphorylated Met Receptor Kinase In Complex With An Mk-2461 Analog With Specificity For The Activated Receptor Length = 307 Back     alignment and structure
>pdb|3Q6U|A Chain A, Structure Of The Apo Met Receptor Kinase In The Dually-Phosphorylated, Activated State Length = 308 Back     alignment and structure
>pdb|2QOL|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596:y602:s768g Triple Mutant Length = 373 Back     alignment and structure
>pdb|2GSF|A Chain A, The Human Epha3 Receptor Tyrosine Kinase And Juxtamembrane Region Length = 373 Back     alignment and structure
>pdb|1OPL|A Chain A, Structural Basis For The Auto-Inhibition Of C-Abl Tyrosine Kinase Length = 537 Back     alignment and structure
>pdb|2XNE|A Chain A, Structure Of Aurora-A Bound To An Imidazopyrazine Inhibitor Length = 272 Back     alignment and structure
>pdb|3FXX|A Chain A, Human Epha3 Kinase And Juxtamembrane Region Bound To Substrate Kqwdnye[ptyr]iw Length = 371 Back     alignment and structure
>pdb|3LQ8|A Chain A, Structure Of The Kinase Domain Of C-Met Bound To Xl880 (Gsk1 Length = 302 Back     alignment and structure
>pdb|2RFN|A Chain A, X-ray Structure Of C-met With Inhibitor. Length = 310 Back     alignment and structure
>pdb|1OL6|A Chain A, Structure Of Unphosphorylated D274n Mutant Of Aurora-a Length = 282 Back     alignment and structure
>pdb|3I5N|A Chain A, Crystal Structure Of C-Met With Triazolopyridazine Inhibitor 13 Length = 309 Back     alignment and structure
>pdb|3DAJ|A Chain A, Crystal Structure Of Aurora A Complexed With An Inhibitor Discovered Through Site-Directed Dynamic Tethering Length = 272 Back     alignment and structure
>pdb|3F66|A Chain A, Human C-Met Kinase In Complex With Quinoxaline Inhibitor Length = 298 Back     alignment and structure
>pdb|3D14|A Chain A, Crystal Structure Of Mouse Aurora A (Asn186->gly, Lys240->arg, Met302- >leu) In Complex With 1-{5-[2-(Thieno[3,2-D]pyrimidin-4-Ylamino)- Ethyl]- Thiazol-2-Yl}-3-(3-Trifluoromethyl-Phenyl)-Urea Length = 272 Back     alignment and structure
>pdb|3OMV|A Chain A, Crystal Structure Of C-Raf (Raf-1) Length = 307 Back     alignment and structure
>pdb|2ZV7|A Chain A, Lyn Tyrosine Kinase Domain, Apo Form Length = 279 Back     alignment and structure
>pdb|1OPK|A Chain A, Structural Basis For The Auto-Inhibition Of C-Abl Tyrosine Kinase Length = 495 Back     alignment and structure
>pdb|3K54|A Chain A, Structures Of Human Bruton's Tyrosine Kinase In Active And Inactive Conformations Suggests A Mechanism Of Activation For Tec Family Kinases Length = 283 Back     alignment and structure
>pdb|2PTK|A Chain A, Chicken Src Tyrosine Kinase Length = 453 Back     alignment and structure
>pdb|3NIZ|A Chain A, Cryptosporidium Parvum Cyclin-Dependent Kinase Cgd5_2510 With Adp Bound Length = 311 Back     alignment and structure
>pdb|2QKR|A Chain A, Cryptosporidium Parvum Cyclin-Dependent Kinase Cgd5_2510 With Indirubin 3'-Monoxime Bound Length = 313 Back     alignment and structure
>pdb|3GEN|A Chain A, The 1.6 A Crystal Structure Of Human Bruton's Tyrosine Kinase Bound To A Pyrrolopyrimidine-Containing Compound Length = 283 Back     alignment and structure
>pdb|3PIX|A Chain A, Crystal Structure Of Btk Kinase Domain Complexed With 2-Isopropyl-7- (4-Methyl-Piperazin-1-Yl)-4-(5-Methyl-2h-Pyrazol-3- Ylamino)-2h- Phthalazin-1-One Length = 274 Back     alignment and structure
>pdb|3OCS|A Chain A, Crystal Structure Of Bruton's Tyrosine Kinase In Complex With Inhibitor Cgi1746 Length = 271 Back     alignment and structure
>pdb|3OCT|A Chain A, Crystal Structure Of Bruton's Tyrosine Kinase Mutant V555r In Complex With Dasatinib Length = 265 Back     alignment and structure
>pdb|1K2P|A Chain A, Crystal Structure Of Bruton's Tyrosine Kinase Domain Length = 263 Back     alignment and structure
>pdb|3P08|A Chain A, Crystal Structure Of The Human Btk Kinase Domain Length = 267 Back     alignment and structure
>pdb|3C1X|A Chain A, Crystal Structure Of The Tyrosine Kinase Domain Of The Hepatocyte Growth Factor Receptor C-Met In Complex With A Pyrrolotriazine Based Inhibitor Length = 373 Back     alignment and structure
>pdb|3A4P|A Chain A, Human C-Met Kinase Domain Complexed With 6-Benzyloxyquinoline Inhibitor Length = 319 Back     alignment and structure
>pdb|1MQB|A Chain A, Crystal Structure Of Ephrin A2 (Epha2) Receptor Protein Kinase Length = 333 Back     alignment and structure
>pdb|3DKG|A Chain A, Sgx Clone 5698a109kfg1h1 Length = 317 Back     alignment and structure
>pdb|3QTI|A Chain A, C-Met Kinase In Complex With Nvp-Bvu972 Length = 314 Back     alignment and structure
>pdb|3QRJ|A Chain A, The Crystal Structure Of Human Abl1 Kinase Domain T315i Mutant In Complex With Dcc-2036 Length = 277 Back     alignment and structure
>pdb|2V7A|A Chain A, Crystal Structure Of The T315i Abl Mutant In Complex With The Inhibitor Pha-739358 Length = 286 Back     alignment and structure
>pdb|1R0P|A Chain A, Crystal Structure Of The Tyrosine Kinase Domain Of The Hepatocyte Growth Factor Receptor C-Met In Complex With The Microbial Alkaloid K-252a Length = 312 Back     alignment and structure
>pdb|3DKC|A Chain A, Sgx Clone 5698a65kfg1h1 Length = 317 Back     alignment and structure
>pdb|2F4J|A Chain A, Structure Of The Kinase Domain Of An Imatinib-Resistant Abl Mutant In Complex With The Aurora Kinase Inhibitor Vx-680 Length = 287 Back     alignment and structure
>pdb|3GVU|A Chain A, The Crystal Structure Of Human Abl2 In Complex With Gleevec Length = 292 Back     alignment and structure
>pdb|2BUJ|A Chain A, Crystal Structure Of The Human Serine-Threonine Kinase 16 In Complex With Staurosporine Length = 317 Back     alignment and structure
>pdb|2HYY|A Chain A, Human Abl Kinase Domain In Complex With Imatinib (Sti571, Glivec) Length = 273 Back     alignment and structure
>pdb|3CTH|A Chain A, Crystal Structure Of The Tyrosine Kinase Domain Of The Hepatocyte Growth Factor Receptor C-Met In Complex With A Aminopyridine Based Inhibitor Length = 314 Back     alignment and structure
>pdb|3QRI|A Chain A, The Crystal Structure Of Human Abl1 Kinase Domain In Complex With Dcc- 2036 Length = 277 Back     alignment and structure
>pdb|2GQG|A Chain A, X-Ray Crystal Structure Of Dasatinib (Bms-354825) Bound To Activated Abl Kinase Domain Length = 278 Back     alignment and structure
>pdb|2E2B|A Chain A, Crystal Structure Of The C-Abl Kinase Domain In Complex With Inno-406 Length = 293 Back     alignment and structure
>pdb|2G2F|A Chain A, A Src-Like Inactive Conformation In The Abl Tyrosine Kinase Domain Length = 287 Back     alignment and structure
>pdb|2HZ0|A Chain A, Abl Kinase Domain In Complex With Nvp-Aeg082 Length = 270 Back     alignment and structure
>pdb|3PYY|A Chain A, Discovery And Characterization Of A Cell-Permeable, Small-Molecule C- Abl Kinase Activator That Binds To The Myristoyl Binding Site Length = 298 Back     alignment and structure
>pdb|1U5Q|A Chain A, Crystal Structure Of The Tao2 Kinase Domain: Activation And Specifity Of A Ste20p Map3k Length = 348 Back     alignment and structure
>pdb|2HZI|A Chain A, Abl Kinase Domain In Complex With Pd180970 Length = 277 Back     alignment and structure
>pdb|2HIW|A Chain A, Crystal Structure Of Inactive Conformation Abl Kinase Catalytic Domain Complexed With Type Ii Inhibitor Length = 287 Back     alignment and structure
>pdb|2G1T|A Chain A, A Src-Like Inactive Conformation In The Abl Tyrosine Kinase Domain Length = 287 Back     alignment and structure
>pdb|2H6D|A Chain A, Protein Kinase Domain Of The Human 5'-Amp-Activated Protein Kinase Catalytic Subunit Alpha-2 (Ampk Alpha-2 Chain) Length = 276 Back     alignment and structure
>pdb|2YZA|A Chain A, Crystal Structure Of Kinase Domain Of Human 5'-Amp-Activated Protein Kinase Alpha-2 Subunit Mutant (T172d) Length = 276 Back     alignment and structure
>pdb|2GCD|A Chain A, Tao2 Kinase Domain-Staurosporine Structure Length = 309 Back     alignment and structure
>pdb|3DK6|A Chain A, Crystal Structure Of Mutant Abl Kinase Domain In Complex With Small Molecule Fragment Length = 293 Back     alignment and structure
>pdb|2QON|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596f:y602f:y742a Triple Mutant Length = 373 Back     alignment and structure
>pdb|4BBE|A Chain A, Aminoalkylpyrimidine Inhibitor Complexes With Jak2 Length = 298 Back     alignment and structure
>pdb|2QOB|A Chain A, Human Epha3 Kinase Domain, Base Structure Length = 344 Back     alignment and structure
>pdb|3DK7|A Chain A, Crystal Structure Of Mutant Abl Kinase Domain In Complex With Small Molecule Fragment Length = 277 Back     alignment and structure
>pdb|3OY3|A Chain A, Crystal Structure Of Abl T315i Mutant Kinase Domain Bound With A Dfg- Out Inhibitor Ap24589 Length = 284 Back     alignment and structure
>pdb|2Z60|A Chain A, Crystal Structure Of The T315i Mutant Of Abl Kinase Bound With Ppy-A Length = 288 Back     alignment and structure
>pdb|1LUF|A Chain A, Crystal Structure Of The Musk Tyrosine Kinase: Insights Into Receptor Autoregulation Length = 343 Back     alignment and structure
>pdb|2QO7|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Dephosphorylated, Amp-Pnp Bound Length = 373 Back     alignment and structure
>pdb|3OXZ|A Chain A, Crystal Structure Of Abl Kinase Domain Bound With A Dfg-Out Inhibitor Ap24534 Length = 284 Back     alignment and structure
>pdb|2QOH|A Chain A, Crystal Structure Of Abl Kinase Bound With Ppy-a Length = 288 Back     alignment and structure
>pdb|1FPU|A Chain A, Crystal Structure Of Abl Kinase Domain In Complex With A Small Molecule Inhibitor Length = 293 Back     alignment and structure
>pdb|3COK|A Chain A, Crystal Structure Of Plk4 Kinase Length = 278 Back     alignment and structure
>pdb|3DK3|A Chain A, Crystal Structure Of Mutant Abl Kinase Domain In Complex With Small Molecule Fragment Length = 293 Back     alignment and structure
>pdb|1B6C|B Chain B, Crystal Structure Of The Cytoplasmic Domain Of The Type I Tgf-Beta Receptor In Complex With Fkbp12 Length = 342 Back     alignment and structure
>pdb|4AGU|A Chain A, Crystal Structure Of The Human Cdkl1 Kinase Domain Length = 311 Back     alignment and structure
>pdb|3JY9|A Chain A, Janus Kinase 2 Inhibitors Length = 311 Back     alignment and structure
>pdb|3IO7|A Chain A, 2-Aminopyrazolo[1,5-A]pyrimidines As Potent And Selective Inhibitors Of Jak2 Length = 313 Back     alignment and structure
>pdb|1PY5|A Chain A, Crystal Structure Of Tgf-Beta Receptor I Kinase With Inhibitor Length = 326 Back     alignment and structure
>pdb|2HEL|A Chain A, Crystal Structure Of A Mutant Epha4 Kinase Domain (Y742a) Length = 306 Back     alignment and structure
>pdb|1UA2|A Chain A, Crystal Structure Of Human Cdk7 Length = 346 Back     alignment and structure
>pdb|3KUL|B Chain B, Kinase Domain Of Human Ephrin Type-A Receptor 8 (Epha8) Length = 325 Back     alignment and structure
>pdb|3KUL|A Chain A, Kinase Domain Of Human Ephrin Type-A Receptor 8 (Epha8) Length = 325 Back     alignment and structure
>pdb|2P0C|A Chain A, Catalytic Domain Of The Proto-Oncogene Tyrosine-Protein Kina Length = 313 Back     alignment and structure
>pdb|4GT4|A Chain A, Structure Of Unliganded, Inactive Ror2 Kinase Domain Length = 308 Back     alignment and structure
>pdb|3TZM|A Chain A, Tgf-Beta Receptor Type 1 In Complex With Sb431542 Length = 309 Back     alignment and structure
>pdb|2W1I|A Chain A, Structure Determination Of Aurora Kinase In Complex With Inhibitor Length = 326 Back     alignment and structure
>pdb|1OB3|A Chain A, Structure Of P. Falciparum Pfpk5 Length = 288 Back     alignment and structure
>pdb|1RW8|A Chain A, Crystal Structure Of Tgf-Beta Receptor I Kinase With Atp Site Inhibitor Length = 301 Back     alignment and structure
>pdb|1V0O|A Chain A, Structure Of P. Falciparum Pfpk5-Indirubin-5-Sulphonate Ligand Complex Length = 288 Back     alignment and structure
>pdb|3ZZW|A Chain A, Crystal Structure Of The Kinase Domain Of Ror2 Length = 289 Back     alignment and structure
>pdb|2WOT|A Chain A, Alk5 In Complex With 4-((5,6-Dimethyl-2-(2-Pyridyl)-3- Pyridyl)oxy)-N-(3,4,5-Trimethoxyphenyl)pyridin-2-Amine Length = 306 Back     alignment and structure
>pdb|1V0B|A Chain A, Crystal Structure Of The T198a Mutant Of Pfpk5 Length = 288 Back     alignment and structure
>pdb|2XYU|A Chain A, Crystal Structure Of Epha4 Kinase Domain In Complex With Vuf 12058 Length = 285 Back     alignment and structure
>pdb|3NZ0|A Chain A, Non-Phosphorylated Tyk2 Kinase With Cmp6 Length = 302 Back     alignment and structure
>pdb|3UGC|A Chain A, Structural Basis Of Jak2 Inhibition By The Type Ii Inhibtor Nvp-Bbt594 Length = 295 Back     alignment and structure
>pdb|1VJY|A Chain A, Crystal Structure Of A Naphthyridine Inhibitor Of Human Tgf- Beta Type I Receptor Length = 303 Back     alignment and structure
>pdb|1JPA|A Chain A, Crystal Structure Of Unphosphorylated Ephb2 Receptor Tyrosine Kinase And Juxtamembrane Region Length = 312 Back     alignment and structure
>pdb|4E4M|A Chain A, Jak2 Kinase (Jh1 Domain) In Complex With Compound 30 Length = 302 Back     alignment and structure
>pdb|2PZ5|A Chain A, Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase Domain Harboring The Pathogenic N549t Mutation Responsible For Pfeiffer Syndrome Length = 324 Back     alignment and structure
>pdb|2Y6M|A Chain A, Crystal Structure Of Epha4 Kinase Domain Length = 291 Back     alignment and structure
>pdb|4HGE|A Chain A, Jak2 Kinase (Jh1 Domain) In Complex With Compound 8 Length = 300 Back     alignment and structure
>pdb|3LPB|A Chain A, Crystal Structure Of Jak2 Complexed With A Potent 2,8-Diaryl Quinoxaline Inhibitor Length = 295 Back     alignment and structure
>pdb|3NYX|A Chain A, Non-Phosphorylated Tyk2 Jh1 Domain With Quinoline-Thiadiazole- Thiophene Inhibitor Length = 302 Back     alignment and structure
>pdb|4AQC|A Chain A, Triazolopyridine-Based Inhibitor Of Janus Kinase 2 Length = 301 Back     alignment and structure
>pdb|2B7A|A Chain A, The Structural Basis Of Janus Kinase 2 Inhibition By A Potent And Specific Pan-Janus Kinase Inhibitor Length = 293 Back     alignment and structure
>pdb|3MY0|A Chain A, Crystal Structure Of The Acvrl1 (Alk1) Kinase Domain Bound To Ldn- 193189 Length = 305 Back     alignment and structure
>pdb|3RVG|A Chain A, Crystals Structure Of Jak2 With A 1-Amino-5h-Pyrido[4,3-B]indol-4- Carboxamide Inhibitor Length = 303 Back     alignment and structure
>pdb|3TJC|A Chain A, Co-Crystal Structure Of Jak2 With Thienopyridine 8 Length = 298 Back     alignment and structure
>pdb|3Q32|A Chain A, Structure Of Janus Kinase 2 With A Pyrrolotriazine Inhibitor Length = 301 Back     alignment and structure
>pdb|3E62|A Chain A, Fragment Based Discovery Of Jak-2 Inhibitors Length = 293 Back     alignment and structure
>pdb|2X7F|A Chain A, Crystal Structure Of The Kinase Domain Of Human Traf2- And Nck-Interacting Kinase With Wee1chk1 Inhibitor Length = 326 Back     alignment and structure
>pdb|3G51|A Chain A, Structural Diversity Of The Active Conformation Of The N- Terminal Kinase Domain Of P90 Ribosomal S6 Kinase 2 Length = 325 Back     alignment and structure
>pdb|4EL9|A Chain A, Structure Of N-Terminal Kinase Domain Of Rsk2 With Afzelin Length = 305 Back     alignment and structure
>pdb|2J51|A Chain A, Crystal Structure Of Human Ste20-Like Kinase Bound To 5- Amino-3-((4-(Aminosulfonyl)phenyl)amino)-N-(2,6- Difluorophenyl)-1h-1,2,4-Triazole-1-Carbothioamide Length = 325 Back     alignment and structure
>pdb|3UBD|A Chain A, Structure Of N-Terminal Domain Of Rsk2 Kinase In Complex With Flavonoid Glycoside Sl0101 Length = 304 Back     alignment and structure
>pdb|2XA4|A Chain A, Inhibitors Of Jak2 Kinase Domain Length = 298 Back     alignment and structure
>pdb|2JFM|A Chain A, Crystal Structure Of Human Ste20-Like Kinase (Unliganded Form) Length = 325 Back     alignment and structure
>pdb|2JFL|A Chain A, Crystal Structure Of Human Ste20-Like Kinase ( Diphosphorylated Form) Bound To 5- Amino-3-((4-( Aminosulfonyl)phenyl)amino)-N-(2,6- Difluorophenyl)-1h-1,2, 4-Triazole-1-Carbothioamide Length = 325 Back     alignment and structure
>pdb|2HEN|A Chain A, Crystal Structure Of The Ephb2 Receptor Kinase Domain In Complex With Adp Length = 286 Back     alignment and structure
>pdb|1KOA|A Chain A, Twitchin Kinase Fragment (C.Elegans), Autoregulated Protein Kinase And Immunoglobulin Domains Length = 491 Back     alignment and structure
>pdb|1FOT|A Chain A, Structure Of The Unliganded Camp-Dependent Protein Kinase Catalytic Subunit From Saccharomyces Cerevisiae Length = 318 Back     alignment and structure
>pdb|3UTO|A Chain A, Twitchin Kinase Region From C.Elegans (Fn31-Nl-Kin-Crd-Ig26) Length = 573 Back     alignment and structure
>pdb|2F57|A Chain A, Crystal Structure Of The Human P21-activated Kinase 5 Length = 317 Back     alignment and structure
>pdb|2IVV|A Chain A, Crystal Structure Of Phosphorylated Ret Tyrosine Kinase Domain Complexed With The Inhibitor Pp1 Length = 314 Back     alignment and structure
>pdb|2REI|A Chain A, Kinase Domain Of Human Ephrin Type-a Receptor 7 (epha7) Length = 318 Back     alignment and structure
>pdb|3CD3|A Chain A, Crystal Structure Of Phosphorylated Human Feline Sarcoma Viral Oncogene Homologue (V-Fes) In Complex With Staurosporine And A Consensus Peptide Length = 377 Back     alignment and structure
>pdb|2Y94|A Chain A, Structure Of An Active Form Of Mammalian Ampk Length = 476 Back     alignment and structure
>pdb|3BKB|A Chain A, Crystal Structure Of Human Feline Sarcoma Viral Oncogene Homologue (V- Fes) Length = 377 Back     alignment and structure
>pdb|1ZY4|A Chain A, Crystal Structure Of Eif2alpha Protein Kinase Gcn2: R794g Hyperactivating Mutant In Apo Form. Length = 303 Back     alignment and structure
>pdb|4FR4|A Chain A, Crystal Structure Of Human SerineTHREONINE-Protein Kinase 32a (Yank1) Length = 384 Back     alignment and structure
>pdb|2R2P|A Chain A, Kinase Domain Of Human Ephrin Type-A Receptor 5 (Epha5) Length = 295 Back     alignment and structure
>pdb|3GQI|A Chain A, Crystal Structure Of Activated Receptor Tyrosine Kinase In Complex With Substrates Length = 326 Back     alignment and structure
>pdb|4BC6|A Chain A, Crystal Structure Of Human Serine Threonine Kinase-10 Bound To Novel Bosutinib Isoform 1, Previously Thought To Be Bosutinib Length = 293 Back     alignment and structure
>pdb|3KXX|A Chain A, Structure Of The Mutant Fibroblast Growth Factor Receptor 1 Length = 317 Back     alignment and structure
>pdb|2X4F|A Chain A, The Crystal Structure Of The Human Myosin Light Chain Kinase Loc340156. Length = 373 Back     alignment and structure
>pdb|2J7T|A Chain A, Crystal Structure Of Human Serine Threonine Kinase-10 Bound To Su11274 Length = 302 Back     alignment and structure
>pdb|2PZR|A Chain A, Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase Domain Harboring The Pathogenic K641r Mutation Responsible For Pfeiffer Syndrome Length = 324 Back     alignment and structure
>pdb|2PZP|A Chain A, Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase Domain Harboring The Pathogenic K526e Mutation Responsible For Crouzon Syndrome Length = 324 Back     alignment and structure
>pdb|2PVY|A Chain A, Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase Domain Harboring The Pathogenic K659n Mutation Responsible For An Unclassified Craniosynostosis Syndrome. Length = 324 Back     alignment and structure
>pdb|3CLY|A Chain A, Crystal Structure Of Fgf Receptor 2 (Fgfr2) Kinase Domains Trapped In Trans-Phosphorylation Reaction Length = 334 Back     alignment and structure
>pdb|2IVT|A Chain A, Crystal Structure Of Phosphorylated Ret Tyrosine Kinase Domain Length = 314 Back     alignment and structure
>pdb|2PSQ|A Chain A, Crystal Structure Of Unphosphorylated Unactivated Wild Type Fgf Receptor 2 (Fgfr2) Kinase Domain Length = 370 Back     alignment and structure
>pdb|2IVS|A Chain A, Crystal Structure Of Non-Phosphorylated Ret Tyrosine Kinase Domain Length = 314 Back     alignment and structure
>pdb|3TT0|A Chain A, Co-Structure Of Fibroblast Growth Factor Receptor 1 Kinase Domain With 3-(2,6-Dichloro-3, 5-Dimethoxy-Phenyl)-1-{6-[4-(4-Ethyl-Piperazin-1- Yl)-Phenylamino]-Pyrimidin-4-Yl}-1-Methyl-Urea (Bgj398) Length = 382 Back     alignment and structure
>pdb|3Q4Z|A Chain A, Structure Of Unphosphorylated Pak1 Kinase Domain Length = 306 Back     alignment and structure
>pdb|4ASZ|A Chain A, Crystal Structure Of Apo Trkb Kinase Domain Length = 299 Back     alignment and structure
>pdb|2QLU|A Chain A, Crystal Structure Of Activin Receptor Type Ii Kinase Domain From Human Length = 314 Back     alignment and structure
>pdb|3B2T|A Chain A, Structure Of Phosphotransferase Length = 311 Back     alignment and structure
>pdb|1GJO|A Chain A, The Fgfr2 Tyrosine Kinase Domain Length = 316 Back     alignment and structure
>pdb|2PWL|A Chain A, Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase Domain Harboring The Pathogenic N549h Mutation Responsible For Crouzon Syndrome. Length = 324 Back     alignment and structure
>pdb|3RI1|A Chain A, Crystal Structure Of The Catalytic Domain Of Fgfr2 Kinase In Complex With Arq 069 Length = 313 Back     alignment and structure
>pdb|1ZXE|A Chain A, Crystal Structure Of Eif2alpha Protein Kinase Gcn2: D835n Inactivating Mutant In Apo Form Length = 303 Back     alignment and structure
>pdb|4AAA|A Chain A, Crystal Structure Of The Human Cdkl2 Kinase Domain Length = 331 Back     alignment and structure
>pdb|2IW8|A Chain A, Structure Of Human Thr160-Phospho Cdk2-Cyclin A F82h-L83v- H84d Mutant With An O6-Cyclohexylmethylguanine Inhibitor Length = 302 Back     alignment and structure
>pdb|3GQL|A Chain A, Crystal Structure Of Activated Receptor Tyrosine Kinase In Complex With Substrates Length = 326 Back     alignment and structure
>pdb|1FGK|A Chain A, Crystal Structure Of The Tyrosine Kinase Domain Of Fibroblast Growth Factor Receptor 1 Length = 310 Back     alignment and structure
>pdb|4F63|A Chain A, Crystal Structure Of Human Fibroblast Growth Factor Receptor 1 Kinase Domain In Complex With Compound 1 Length = 309 Back     alignment and structure
>pdb|3H9R|A Chain A, Crystal Structure Of The Kinase Domain Of Type I Activin Receptor (Acvr1) In Complex With Fkbp12 And Dorsomorphin Length = 330 Back     alignment and structure
>pdb|3JS2|A Chain A, Crystal Structure Of Minimal Kinase Domain Of Fibroblast Growth Factor Receptor 1 In Complex With 5-(2-Thienyl) Nicotinic Acid Length = 317 Back     alignment and structure
>pdb|3C4F|A Chain A, Fgfr Tyrosine Kinase Domain In Complex With 3-(3- Methoxybenzyl)-7-Azaindole Length = 302 Back     alignment and structure
>pdb|3RHX|B Chain B, Crystal Structure Of The Catalytic Domain Of Fgfr1 Kinase In Complex With Arq 069 Length = 306 Back     alignment and structure
>pdb|1F3M|C Chain C, Crystal Structure Of Human SerineTHREONINE KINASE PAK1 Length = 297 Back     alignment and structure
>pdb|2PVF|A Chain A, Crystal Structure Of Tyrosine Phosphorylated Activated Fgf Receptor 2 (Fgfr2) Kinase Domain In Complex With Atp Analog And Substrate Peptide Length = 334 Back     alignment and structure
>pdb|2I1M|A Chain A, Cfms Tyrosine Kinase (Tie2 Kid) In Complex With An Arylamide Inhibitor Length = 333 Back     alignment and structure
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|4AOJ|A Chain A, Human Trka In Complex With The Inhibitor Az-23 Length = 329 Back     alignment and structure
>pdb|4E6D|A Chain A, Jak2 Kinase (Jh1 Domain) Triple Mutant In Complex With Compound 7 Length = 298 Back     alignment and structure
>pdb|2Z7Q|A Chain A, Crystal Structure Of The N-Terminal Kinase Domain Of Human Rsk-1 Bound To Amp-Pcp Length = 321 Back     alignment and structure
>pdb|3FXZ|A Chain A, Crystal Structure Of Pak1 Kinase Domain With Ruthenium Complex Lambda-Fl172 Length = 297 Back     alignment and structure
>pdb|4ERW|A Chain A, Cdk2 In Complex With Staurosporine Length = 306 Back     alignment and structure
>pdb|1A06|A Chain A, Calmodulin-Dependent Protein Kinase From Rat Length = 332 Back     alignment and structure
>pdb|3ORX|A Chain A, Pdk1 Mutant Bound To Allosteric Disulfide Fragment Inhibitor 1f8 Length = 316 Back     alignment and structure
>pdb|3Q52|A Chain A, Structure Of Phosphorylated Pak1 Kinase Domain Length = 306 Back     alignment and structure
>pdb|1OGU|A Chain A, Structure Of Human Thr160-phospho Cdk2/cyclin A Complexed With A 2-arylamino-4-cyclohexylmethyl-5-nitroso-6- aminopyrimidine Inhibitor Length = 302 Back     alignment and structure
>pdb|1H1P|A Chain A, Structure Of Human Thr160-Phospho Cdk2CYCLIN A COMPLEXED With The Inhibitor Nu2058 Length = 303 Back     alignment and structure
>pdb|2Y7J|A Chain A, Structure Of Human Phosphorylase Kinase, Gamma 2 Length = 365 Back     alignment and structure
>pdb|3PXF|A Chain A, Cdk2 In Complex With Two Molecules Of 8-Anilino-1-Naphthalene Sulfonate Length = 306 Back     alignment and structure
>pdb|3MTF|A Chain A, Crystal Structure Of The Acvr1 Kinase In Complex With A 2- Aminopyridine Inhibitor Length = 301 Back     alignment and structure
>pdb|1E9H|A Chain A, Thr 160 Phosphorylated Cdk2-Human Cyclin A3 Complex With The Inhibitor Indirubin-5-Sulphonate Bound Length = 297 Back     alignment and structure
>pdb|3EZR|A Chain A, Cdk-2 With Indazole Inhibitor 17 Bound At Its Active Site Length = 300 Back     alignment and structure
>pdb|4FG7|A Chain A, Crystal Structure Of Human Calcium/calmodulin-dependent Protein Kinase I 1-293 In Complex With Atp Length = 293 Back     alignment and structure
>pdb|4EOQ|A Chain A, Thr 160 Phosphorylated Cdk2 Wt - Human Cyclin A3 Complex With Atp Length = 301 Back     alignment and structure
>pdb|1OIT|A Chain A, Imidazopyridines: A Potent And Selective Class Of Cyclin-dependent Kinase Inhibitors Identified Through Structure-based Hybridisation Length = 299 Back     alignment and structure
>pdb|4BCQ|A Chain A, Structure Of Cdk2 In Complex With Cyclin A And A 2-amino-4- Heteroaryl-pyrimidine Inhibitor Length = 301 Back     alignment and structure
>pdb|4H1J|A Chain A, Crystal Structure Of Pyk2 With The Pyrazole 13a Length = 293 Back     alignment and structure
>pdb|2R5T|A Chain A, Crystal Structure Of Inactive Serum And Glucocorticoid- Regulated Kinase 1 In Complex With Amp-Pnp Length = 373 Back     alignment and structure
>pdb|4EOS|A Chain A, Thr 160 Phosphorylated Cdk2 Wt - Human Cyclin A3 Complex With The Inhibitor Ro3306 Length = 300 Back     alignment and structure
>pdb|1PF8|A Chain A, Crystal Structure Of Human Cyclin-dependent Kinase 2 Complexed With A Nucleoside Inhibitor Length = 298 Back     alignment and structure
>pdb|4DYM|A Chain A, Crystal Structure Of The Acvr1 Kinase Domain In Complex With The Imidazo[1,2-B]pyridazine Inhibitor K00135 Length = 301 Back     alignment and structure
>pdb|4I3Z|A Chain A, Structure Of Pcdk2CYCLINA BOUND TO ADP AND 2 MAGNESIUM IONS Length = 296 Back     alignment and structure
>pdb|1GII|A Chain A, Human Cyclin Dependent Kinase 2 Complexed With The Cdk4 Inhibitor Length = 298 Back     alignment and structure
>pdb|1W98|A Chain A, The Structural Basis Of Cdk2 Activation By Cyclin E Length = 298 Back     alignment and structure
>pdb|1QMZ|A Chain A, Phosphorylated Cdk2-Cyclyin A-Substrate Peptide Complex Length = 299 Back     alignment and structure
>pdb|4FG8|A Chain A, Crystal Structure Of Human Calcium/calmodulin-dependent Protein Kinase I 1-315 In Complex With Atp Length = 315 Back     alignment and structure
>pdb|1YHV|A Chain A, Crystal Structure Of Pak1 Kinase Domain With Two Point Mutations (K299r, T423e) Length = 297 Back     alignment and structure
>pdb|3BHT|A Chain A, Structure Of Phosphorylated Thr160 Cdk2CYCLIN A IN COMPLEX WITH THE Inhibitor Meriolin 3 Length = 300 Back     alignment and structure
>pdb|4EOP|A Chain A, Thr 160 Phosphorylated Cdk2 Q131e - Human Cyclin A3 Complex With The Inhibitor Ro3306 Length = 300 Back     alignment and structure
>pdb|2JGZ|A Chain A, Crystal Structure Of Phospho-Cdk2 In Complex With Cyclin B Length = 289 Back     alignment and structure
>pdb|1GZ8|A Chain A, Human Cyclin Dependent Kinase 2 Complexed With The Inhibitor 2-Amino-6-(3'-Methyl-2'-Oxo)butoxypurine Length = 299 Back     alignment and structure
>pdb|2W17|A Chain A, Cdk2 In Complex With The Imidazole Pyrimidine Amide, Compound (S)-8b Length = 299 Back     alignment and structure
>pdb|1JST|A Chain A, Phosphorylated Cyclin-Dependent Kinase-2 Bound To Cyclin A Length = 298 Back     alignment and structure
>pdb|3PJ8|A Chain A, Structure Of Cdk2 In Complex With A Pyrazolo[4,3-D]pyrimidine Bioisostere Of Roscovitine Length = 299 Back     alignment and structure
>pdb|1FIN|A Chain A, Cyclin A-Cyclin-Dependent Kinase 2 Complex Length = 298 Back     alignment and structure
>pdb|4FG9|A Chain A, Crystal Structure Of Human Calcium/calmodulin-dependent Protein Kinase I 1-320 In Complex With Atp Length = 320 Back     alignment and structure
>pdb|4EOO|A Chain A, Thr 160 Phosphorylated Cdk2 Q131e - Human Cyclin A3 Complex With Atp Length = 299 Back     alignment and structure
>pdb|3QHR|A Chain A, Structure Of A Pcdk2CYCLINA TRANSITION-State Mimic Length = 298 Back     alignment and structure
>pdb|4F0I|A Chain A, Crystal Structure Of Apo Trka Length = 300 Back     alignment and structure
>pdb|1VYW|A Chain A, Structure Of Cdk2CYCLIN A WITH PNU-292137 Length = 309 Back     alignment and structure
>pdb|3FZO|A Chain A, Crystal Structure Of Pyk2-Apo, Proline-Rich Tyrosine Kinase Length = 277 Back     alignment and structure
>pdb|3CC6|A Chain A, Crystal Structure Of Kinase Domain Of Protein Tyrosine Kinase 2 Beta (ptk2b) Length = 281 Back     alignment and structure
>pdb|4EON|A Chain A, Thr 160 Phosphorylated Cdk2 H84s, Q85m, Q131e - Human Cyclin A3 Complex With The Inhibitor Ro3306 Length = 300 Back     alignment and structure
>pdb|4EOM|A Chain A, Thr 160 Phosphorylated Cdk2 H84s, Q85m, Q131e - Human Cyclin A3 Complex With Atp Length = 301 Back     alignment and structure
>pdb|4GT5|A Chain A, Crystal Structure Of The Inactive Trka Kinase Domain Length = 306 Back     alignment and structure
>pdb|4EOI|A Chain A, Thr 160 Phosphorylated Cdk2 K89d, Q131e - Human Cyclin A3 Complex With The Inhibitor Ro3306 Length = 299 Back     alignment and structure
>pdb|2BVA|A Chain A, Crystal Structure Of The Human P21-Activated Kinase 4 Length = 292 Back     alignment and structure
>pdb|2IW6|A Chain A, Structure Of Human Thr160-Phospho Cdk2-Cyclin A Complexed With A Bisanilinopyrimidine Inhibitor Length = 302 Back     alignment and structure
>pdb|2PHK|A Chain A, The Crystal Structure Of A Phosphorylase Kinase Peptide Substrate Complex: Kinase Substrate Recognition Length = 277 Back     alignment and structure
>pdb|4EOJ|A Chain A, Thr 160 Phosphorylated Cdk2 H84s, Q85m, K89d - Human Cyclin A3 Complex With Atp Length = 302 Back     alignment and structure
>pdb|2X4Z|A Chain A, Crystal Structure Of The Human P21-Activated Kinase 4 In Complex With Pf-03758309 Length = 296 Back     alignment and structure
>pdb|2R4B|A Chain A, Erbb4 Kinase Domain Complexed With A Thienopyrimidine Inhibitor Length = 321 Back     alignment and structure
>pdb|3MA6|A Chain A, Crystal Structure Of Kinase Domain Of Tgcdpk1 In Presence Of 3brb-Pp1 Length = 298 Back     alignment and structure
>pdb|4EOK|A Chain A, Thr 160 Phosphorylated Cdk2 H84s, Q85m, K89d - Human Cyclin A3 Complex With The Inhibitor Nu6102 Length = 300 Back     alignment and structure
>pdb|3DAK|A Chain A, Crystal Structure Of Domain-Swapped Osr1 Kinase Domain Length = 290 Back     alignment and structure
>pdb|2Q0B|A Chain A, Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase Domain Harboring The Pathogenic E565a Mutation Responsible For Pfeiffer Syndrome Length = 324 Back     alignment and structure
>pdb|4FIE|A Chain A, Full-Length Human Pak4 Length = 423 Back     alignment and structure
>pdb|3I79|A Chain A, Calcium-Dependent Protein Kinase 1 From Toxoplasma Gondii (Tgcdpk1) Length = 484 Back     alignment and structure
>pdb|1ZYC|A Chain A, Crystal Structure Of Eif2alpha Protein Kinase Gcn2: Wild- Type In Apo Form. Length = 303 Back     alignment and structure
>pdb|1QL6|A Chain A, The Catalytic Mechanism Of Phosphorylase Kinase Probed By Mutational Studies Length = 298 Back     alignment and structure
>pdb|2CDZ|A Chain A, Crystal Structure Of The Human P21-Activated Kinase 4 In Complex With Cgp74514a Length = 303 Back     alignment and structure
>pdb|1PHK|A Chain A, Two Structures Of The Catalytic Domain Of Phosphorylase, Kinase: An Active Protein Kinase Complexed With Nucleotide, Substrate-Analogue And Product Length = 298 Back     alignment and structure
>pdb|2Q0N|A Chain A, Structure Of Human P21 Activating Kinase 4 (Pak4) In Complex With A Consensus Peptide Length = 301 Back     alignment and structure
>pdb|3KU2|A Chain A, Crystal Structure Of Inactivated Form Of Cdpk1 From Toxoplasma Gondii, Tgme49.101440 Length = 507 Back     alignment and structure
>pdb|4E7W|A Chain A, Structure Of Gsk3 From Ustilago Maydis Length = 394 Back     alignment and structure
>pdb|3HX4|A Chain A, Crystal Structure Of Cdpk1 Of Toxoplasma Gondii, Tgme49_101440, In Presence Of Calcium Length = 508 Back     alignment and structure
>pdb|2VWI|A Chain A, Structure Of The Osr1 Kinase, A Hypertension Drug Target Length = 303 Back     alignment and structure
>pdb|3FME|A Chain A, Crystal Structure Of Human Mitogen-Activated Protein Kinase Kinase 6 (Mek6) Activated Mutant (S207d, T211d) Length = 290 Back     alignment and structure
>pdb|4E1Z|A Chain A, Structure Of Mouse Tyk-2 Complexed To A 3-Aminoindazole Inhibitor Length = 291 Back     alignment and structure
>pdb|2PY3|A Chain A, Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase Domain Harboring The Pathogenic E565g Mutation Responsible For Pfeiffer Syndrome Length = 324 Back     alignment and structure
>pdb|4E20|A Chain A, Structure Of Mouse Tyk-2 Complexed To A 3-Aminoindazole Inhibitor Length = 290 Back     alignment and structure
>pdb|4AF3|A Chain A, Human Aurora B Kinase In Complex With Incenp And Vx-680 Length = 292 Back     alignment and structure
>pdb|3BBT|B Chain B, Crystal Structure Of The Erbb4 Kinase In Complex With Lapatinib Length = 328 Back     alignment and structure
>pdb|4FIF|A Chain A, Catalytic Domain Of Human Pak4 With Rpkplvdp Peptide Length = 346 Back     alignment and structure
>pdb|3BEA|A Chain A, Cfms Tyrosine Kinase (Tie2 Kid) In Complex With A Pyrimidinopyridone Inhibitor Length = 333 Back     alignment and structure
>pdb|1PYX|A Chain A, Gsk-3 Beta Complexed With Amp-Pnp Length = 422 Back     alignment and structure
>pdb|1Q3D|A Chain A, Gsk-3 Beta Complexed With Staurosporine Length = 424 Back     alignment and structure
>pdb|3VN9|A Chain A, Rifined Crystal Structure Of Non-Phosphorylated Map2k6 In A Putative Auto-Inhibition State Length = 340 Back     alignment and structure
>pdb|2XIK|A Chain A, Structure Of Human Ysk1 (Yeast Sps1-Ste20-Related Kinase 1) Length = 294 Back     alignment and structure
>pdb|3LXN|A Chain A, Structural And Thermodynamic Characterization Of The Tyk2 And Jak3 Kinase Domains In Complex With Cp-690550 And Cmp-6 Length = 318 Back     alignment and structure
>pdb|2HK5|A Chain A, Hck Kinase In Complex With Lck Targetted Inhibitor Pg- 1009247 Length = 270 Back     alignment and structure
>pdb|1I09|A Chain A, Structure Of Glycogen Synthase Kinase-3 (Gsk3b) Length = 420 Back     alignment and structure
>pdb|3SAY|A Chain A, Crystal Structure Of Human Glycogen Synthase Kinase 3 Beta (Gsk3b) In Complex With Inhibitor 142 Length = 430 Back     alignment and structure
>pdb|1Q5K|A Chain A, Crystal Structure Of Glycogen Synthase Kinase 3 In Complexed With Inhibitor Length = 414 Back     alignment and structure
>pdb|1MRV|A Chain A, Crystal Structure Of An Inactive Akt2 Kinase Domain Length = 339 Back     alignment and structure
>pdb|1R0E|A Chain A, Glycogen Synthase Kinase-3 Beta In Complex With 3-Indolyl-4- Arylmaleimide Inhibitor Length = 391 Back     alignment and structure
>pdb|4ACC|A Chain A, Gsk3b In Complex With Inhibitor Length = 465 Back     alignment and structure
>pdb|3NUP|A Chain A, Cdk6 (Monomeric) In Complex With Inhibitor Length = 307 Back     alignment and structure
>pdb|1QCF|A Chain A, Crystal Structure Of Hck In Complex With A Src Family- Selective Tyrosine Kinase Inhibitor Length = 454 Back     alignment and structure
>pdb|1BI8|A Chain A, Mechanism Of G1 Cyclin Dependent Kinase Inhibition From The Structures Cdk6-P19ink4d Inhibitor Complex Length = 326 Back     alignment and structure
>pdb|3ZRK|A Chain A, Identification Of 2-(4-Pyridyl)thienopyridinones As Gsk-3beta Inhibitors Length = 371 Back     alignment and structure
>pdb|3Q4T|A Chain A, Crystal Structure Of Activin Receptor Type-Iia (Acvr2a) Kinase Domain In Complex With Dorsomorphin Length = 322 Back     alignment and structure
>pdb|3MTL|A Chain A, Crystal Structure Of The Pctaire1 Kinase In Complex With Ind E804 Length = 324 Back     alignment and structure
>pdb|3ZHP|C Chain C, Human Mst3 (stk24) In Complex With Mo25beta Length = 294 Back     alignment and structure
>pdb|1GNG|A Chain A, Glycogen Synthase Kinase-3 Beta (Gsk3) Complex With Frattide Peptide Length = 378 Back     alignment and structure
>pdb|4AFJ|A Chain A, 5-Aryl-4-Carboxamide-1,3-Oxazoles: Potent And Selective Gsk-3 Inhibitors Length = 367 Back     alignment and structure
>pdb|3F88|A Chain A, Glycogen Synthase Kinase 3beta Inhibitor Complex Length = 349 Back     alignment and structure
>pdb|2O5K|A Chain A, Crystal Structure Of Gsk3beta In Complex With A Benzoimidazol Inhibitor Length = 372 Back     alignment and structure
>pdb|3IGO|A Chain A, Crystal Structure Of Cryptosporidium Parvum Cdpk1, Cgd3_920 Length = 486 Back     alignment and structure
>pdb|3F7Z|A Chain A, X-ray Co-crystal Structure Of Glycogen Synthase Kinase 3beta In Complex With An Inhibitor Length = 350 Back     alignment and structure
>pdb|3A60|A Chain A, Crystal Structure Of Unphosphorylated P70s6k1 (Form I) Length = 327 Back     alignment and structure
>pdb|3ZDI|A Chain A, Glycogen Synthase Kinase 3 Beta Complexed With Axin Peptide And Inhibitor 7d Length = 350 Back     alignment and structure
>pdb|4DIT|A Chain A, Crystal Structure Of Gsk3beta In Complex With A Imidazopyridine Inhibitor Length = 382 Back     alignment and structure
>pdb|3SD0|A Chain A, Identification Of A Glycogen Synthase Kinase-3b Inhibitor That Attenuates Hyperactivity In Clock Mutant Mice Length = 350 Back     alignment and structure
>pdb|3A62|A Chain A, Crystal Structure Of Phosphorylated P70s6k1 Length = 327 Back     alignment and structure
>pdb|4FVP|A Chain A, Crystal Structure Of The Jak2 Pseudokinase Domain (Apo Form) Length = 289 Back     alignment and structure
>pdb|2OW3|A Chain A, Glycogen Synthase Kinase-3 Beta In Complex With Bis- (Indole)maleimide Pyridinophane Inhibitor Length = 352 Back     alignment and structure
>pdb|1JOW|B Chain B, Crystal Structure Of A Complex Of Human Cdk6 And A Viral Cyclin Length = 308 Back     alignment and structure
>pdb|3GB2|A Chain A, Gsk3beta Inhibitor Complex Length = 353 Back     alignment and structure
>pdb|3LL6|A Chain A, Crystal Structure Of The Human Cyclin G Associated Kinase (gak) Length = 337 Back     alignment and structure
>pdb|1GZN|A Chain A, Structure Of Pkb Kinase Domain Length = 335 Back     alignment and structure
>pdb|1GZK|A Chain A, Molecular Mechanism For The Regulation Of Protein Kinase B Akt By Hydrophobic Motif Phosphorylation Length = 315 Back     alignment and structure
>pdb|3DFA|A Chain A, Crystal Structure Of Kinase Domain Of Calcium-dependent Protein Kinase Cgd3_920 From Cryptosporidium Parvum Length = 286 Back     alignment and structure
>pdb|3V5Q|A Chain A, Discovery Of A Selective Trk Inhibitor With Efficacy In Rodent Cancer Tumor Models Length = 297 Back     alignment and structure
>pdb|3CKW|A Chain A, Crystal Structure Of Sterile 20-Like Kinase 3 (Mst3, Stk24) Length = 304 Back     alignment and structure
>pdb|1OIR|A Chain A, Imidazopyridines: A Potent And Selective Class Of Cyclin-Dependent Kinase Inhibitors Identified Through Structure-Based Hybridisation Length = 299 Back     alignment and structure
>pdb|1H01|A Chain A, Cdk2 In Complex With A Disubstituted 2, 4-Bis Anilino Pyrimidine Cdk4 Inhibitor Length = 298 Back     alignment and structure
>pdb|2WEI|A Chain A, Crystal Structure Of The Kinase Domain Of Cryptosporidium Parvum Calcium Dependent Protein Kinase In Complex With 3- Mb-Pp1 Length = 287 Back     alignment and structure
>pdb|1O6K|A Chain A, Structure Of Activated Form Of Pkb Kinase Domain S474d With Gsk3 Peptide And Amp-Pnp Length = 336 Back     alignment and structure
>pdb|3E87|A Chain A, Crystal Structures Of The Kinase Domain Of Akt2 In Complex With Atp- Competitive Inhibitors Length = 335 Back     alignment and structure
>pdb|3CKX|A Chain A, Crystal Structure Of Sterile 20-Like Kinase 3 (Mst3, Stk24) In Complex With Staurosporine Length = 304 Back     alignment and structure
>pdb|2R7B|A Chain A, Crystal Structure Of The Phosphoinositide-Dependent Kinase- 1 (Pdk-1)catalytic Domain Bound To A Dibenzonaphthyridine Inhibitor Length = 312 Back     alignment and structure
>pdb|3QC4|A Chain A, Pdk1 In Complex With Dfg-Out Inhibitor Xxx Length = 314 Back     alignment and structure
>pdb|1Z5M|A Chain A, Crystal Structure Of N1-[3-[[5-bromo-2-[[3-[(1-pyrrolidinylcarbonyl) Amino]phenyl]amino]-4-pyrimidinyl]amino]propyl]-2,2- Dimethylpropanediamide Complexed With Human Pdk1 Length = 286 Back     alignment and structure
>pdb|1H1W|A Chain A, High Resolution Crystal Structure Of The Human Pdk1 Catalytic Domain Length = 289 Back     alignment and structure
>pdb|2JC6|A Chain A, Crystal Structure Of Human Calmodulin-Dependent Protein Kinase 1d Length = 334 Back     alignment and structure
>pdb|3A7F|A Chain A, Human Mst3 Kinase Length = 303 Back     alignment and structure
>pdb|4DC2|A Chain A, Structure Of Pkc In Complex With A Substrate Peptide From Par-3 Length = 396 Back     alignment and structure
>pdb|2XCH|A Chain A, Crystal Structure Of Pdk1 In Complex With A Pyrazoloquinazoline Inhibitor Length = 309 Back     alignment and structure
>pdb|3IOP|A Chain A, Pdk-1 In Complex With The Inhibitor Compound-8i Length = 312 Back     alignment and structure
>pdb|1UU3|A Chain A, Structure Of Human Pdk1 Kinase Domain In Complex With Ly333531 Length = 310 Back     alignment and structure
>pdb|1UU9|A Chain A, Structure Of Human Pdk1 Kinase Domain In Complex With Bim-3 Length = 286 Back     alignment and structure
>pdb|3H9O|A Chain A, Phosphoinositide-Dependent Protein Kinase 1 (Pdk-1) In Complex With Compound 9 Length = 311 Back     alignment and structure
>pdb|4A07|A Chain A, Human Pdk1 Kinase Domain In Complex With Allosteric Activator Ps171 Bound To The Pif-Pocket Length = 311 Back     alignment and structure
>pdb|3SC1|A Chain A, Novel Isoquinolone Pdk1 Inhibitors Discovered Through Fragment-Based Lead Discovery Length = 311 Back     alignment and structure
>pdb|3HRC|A Chain A, Crystal Structure Of A Mutant Of Human Pdk1 Kinase Domain In Complex With Atp Length = 311 Back     alignment and structure
>pdb|2BIY|A Chain A, Structure Of Pdk1-S241a Mutant Kinase Domain Length = 310 Back     alignment and structure
>pdb|4FVR|A Chain A, Crystal Structure Of The Jak2 Pseudokinase Domain Mutant V617f (Mg- Atp-Bound Form) Length = 289 Back     alignment and structure
>pdb|3NUS|A Chain A, Phosphoinositide-Dependent Kinase-1 (Pdk1) With Fragment8 Length = 286 Back     alignment and structure
>pdb|1YVJ|A Chain A, Crystal Structure Of The Jak3 Kinase Domain In Complex With A Staurosporine Analogue Length = 290 Back     alignment and structure
>pdb|2JDO|A Chain A, Structure Of Pkb-Beta (Akt2) Complexed With Isoquinoline-5- Sulfonic Acid (2-(2-(4-Chlorobenzyloxy) Ethylamino)ethyl) Amide Length = 342 Back     alignment and structure
>pdb|3RWP|A Chain A, Discovery Of A Novel, Potent And Selective Inhibitor Of 3- Phosphoinositide Dependent Kinase (Pdk1) Length = 311 Back     alignment and structure
>pdb|1O6L|A Chain A, Crystal Structure Of An Activated Akt/protein Kinase B (pkb-pif Chimera) Ternary Complex With Amp-pnp And Gsk3 Peptide Length = 337 Back     alignment and structure
>pdb|3NUN|A Chain A, Phosphoinositide-Dependent Kinase-1 (Pdk1) With Lead Compound Length = 292 Back     alignment and structure
>pdb|1AD5|A Chain A, Src Family Kinase Hck-Amp-Pnp Complex Length = 438 Back     alignment and structure
>pdb|3NAX|A Chain A, Pdk1 In Complex With Inhibitor Mp7 Length = 311 Back     alignment and structure
>pdb|3I7C|A Chain A, Calcium-Dependent Protein Kinase 1 From Toxoplasma Gondii (Tgcdpk1) In Complex With Bumped Kinase Inhibitor Na-Pp2 Length = 484 Back     alignment and structure
>pdb|3NAY|A Chain A, Pdk1 In Complex With Inhibitor Mp6 Length = 311 Back     alignment and structure
>pdb|3PJC|A Chain A, Crystal Structure Of Jak3 Complexed With A Potent Atp Site Inhibitor Showing High Selectivity Within The Janus Kinase Family Length = 315 Back     alignment and structure
>pdb|4HVD|A Chain A, Jak3 Kinase Domain In Complex With 2-cyclopropyl-5h-pyrrolo[2,3- B]pyrazine-7-carboxylic Acid ((s)-1,2,2-trimethyl-propyl)-amide Length = 314 Back     alignment and structure
>pdb|3LXK|A Chain A, Structural And Thermodynamic Characterization Of The Tyk2 And Jak3 Kinase Domains In Complex With Cp-690550 And Cmp-6 Length = 327 Back     alignment and structure
>pdb|2WEL|A Chain A, Crystal Structure Of Su6656-Bound CalciumCALMODULIN- Dependent Protein Kinase Ii Delta In Complex With Calmodulin Length = 327 Back     alignment and structure
>pdb|3PWY|A Chain A, Crystal Structure Of An Extender (Spd28345)-Modified Human Pdk1 Complex 2 Length = 311 Back     alignment and structure
>pdb|2WQM|A Chain A, Structure Of Apo Human Nek7 Length = 310 Back     alignment and structure
>pdb|3SOA|A Chain A, Full-Length Human Camkii Length = 444 Back     alignment and structure
>pdb|2VZ6|A Chain A, Structure Of Human Calcium Calmodulin Dependent Protein Kinase Type Ii Alpha (Camk2a) In Complex With Indirubin E804 Length = 313 Back     alignment and structure
>pdb|2VN9|A Chain A, Crystal Structure Of Human Calcium Calmodulin Dependent Protein Kinase Ii Delta Isoform 1, Camkd Length = 301 Back     alignment and structure
>pdb|1UV5|A Chain A, Glycogen Synthase Kinase 3 Beta Complexed With 6-Bromoindirubin-3'-Oxime Length = 350 Back     alignment and structure
>pdb|4EC8|A Chain A, Structure Of Full Length Cdk9 In Complex With Cyclint And Drb Length = 373 Back     alignment and structure
>pdb|1H8F|A Chain A, Glycogen Synthase Kinase 3 Beta. Length = 352 Back     alignment and structure
>pdb|4E4L|A Chain A, Jak1 Kinase (Jh1 Domain) In Complex With Compound 30 Length = 302 Back     alignment and structure
>pdb|3BLH|A Chain A, Crystal Structure Of Human Cdk9CYCLINT1 Length = 331 Back     alignment and structure
>pdb|3EYG|A Chain A, Crystal Structures Of Jak1 And Jak2 Inhibitor Complexes Length = 290 Back     alignment and structure
>pdb|3OCB|A Chain A, Akt1 Kinase Domain With Pyrrolopyrimidine Inhibitor Length = 341 Back     alignment and structure
>pdb|2OGV|A Chain A, Crystal Structure Of The Autoinhibited Human C-Fms Kinase Domain Length = 317 Back     alignment and structure
>pdb|3MI9|A Chain A, Crystal Structure Of Hiv-1 Tat Complexed With Human P-Tefb Length = 351 Back     alignment and structure
>pdb|1OMW|A Chain A, Crystal Structure Of The Complex Between G Protein-Coupled Receptor Kinase 2 And Heterotrimeric G Protein Beta 1 And Gamma 2 Subunits Length = 689 Back     alignment and structure
>pdb|3PSC|A Chain A, Bovine Grk2 In Complex With Gbetagamma Subunits Length = 695 Back     alignment and structure
>pdb|3CIK|A Chain A, Human Grk2 In Complex With Gbetagamma Subunits Length = 689 Back     alignment and structure
>pdb|3ZH8|A Chain A, A Novel Small Molecule Apkc Inhibitor Length = 349 Back     alignment and structure
>pdb|3KRW|A Chain A, Human Grk2 In Complex With Gbetgamma Subunits And Balanol (Soak) Length = 688 Back     alignment and structure
>pdb|1ZRZ|A Chain A, Crystal Structure Of The Catalytic Domain Of Atypical Protein Kinase C-Iota Length = 364 Back     alignment and structure
>pdb|3MDY|A Chain A, Crystal Structure Of The Cytoplasmic Domain Of The Bone Morp Protein Receptor Type-1b (Bmpr1b) In Complex With Fkbp12 An 193189 Length = 337 Back     alignment and structure
>pdb|3A8W|A Chain A, Crystal Structure Of Pkciota Kinase Domain Length = 345 Back     alignment and structure
>pdb|4GV1|A Chain A, Pkb Alpha In Complex With Azd5363 Length = 340 Back     alignment and structure
>pdb|2XCK|A Chain A, Crystal Structure Of Pdk1 In Complex With A Pyrazoloquinazoline Inhibitor Length = 309 Back     alignment and structure
>pdb|3CQU|A Chain A, Crystal Structure Of Akt-1 Complexed With Substrate Peptide And Inhibitor Length = 342 Back     alignment and structure
>pdb|1O9U|A Chain A, Glycogen Synthase Kinase 3 Beta Complexed With Axin Peptide Length = 350 Back     alignment and structure
>pdb|4IC7|A Chain A, Crystal Structure Of The Erk5 Kinase Domain In Complex With An Mkk5 Binding Fragment Length = 442 Back     alignment and structure
>pdb|4EJN|A Chain A, Crystal Structure Of Autoinhibited Form Of Akt1 In Complex With N-(4- (5-(3-Acetamidophenyl)-2-(2-Aminopyridin-3-Yl)-3h- Imidazo[4,5- B]pyridin-3-Yl)benzyl)-3-Fluorobenzamide Length = 446 Back     alignment and structure
>pdb|3O96|A Chain A, Crystal Structure Of Human Akt1 With An Allosteric Inhibitor Length = 446 Back     alignment and structure
>pdb|3LCD|A Chain A, Inhibitor Bound To A Dfg-In Structure Of The Kinase Domain Of Csf-1r Length = 329 Back     alignment and structure
>pdb|2W9F|B Chain B, Crystal Structure Of Cdk4 In Complex With A D-Type Cyclin Length = 306 Back     alignment and structure
>pdb|3G33|A Chain A, Crystal Structure Of Cdk4CYCLIN D3 Length = 308 Back     alignment and structure
>pdb|3G2F|A Chain A, Crystal Structure Of The Kinase Domain Of Bone Morphogenetic Protein Receptor Type Ii (Bmpr2) At 2.35 A Resolution Length = 336 Back     alignment and structure
>pdb|2W99|B Chain B, Crystal Structure Of Cdk4 In Complex With A D-Type Cyclin Length = 306 Back     alignment and structure
>pdb|2W96|B Chain B, Crystal Structure Of Cdk4 In Complex With A D-Type Cyclin Length = 306 Back     alignment and structure
>pdb|4B99|A Chain A, Crystal Structure Of Mapk7 (Erk5) With Inhibitor Length = 398 Back     alignment and structure
>pdb|1RJB|A Chain A, Crystal Structure Of Flt3 Length = 344 Back     alignment and structure
>pdb|3UC3|A Chain A, The Crystal Structure Of Snf1-Related Kinase 2.3 Length = 361 Back     alignment and structure
>pdb|2R0U|A Chain A, Crystal Structure Of Chek1 In Complex With Inhibitor 54 Length = 323 Back     alignment and structure
>pdb|2HOG|A Chain A, Crystal Structure Of Chek1 In Complex With Inhibitor 20 Length = 322 Back     alignment and structure
>pdb|3GGF|A Chain A, Crystal Structure Of Human SerineTHREONINE-Protein Kinase Mst4 In Complex With An Quinazolin Length = 301 Back     alignment and structure
>pdb|2C30|A Chain A, Crystal Structure Of The Human P21-Activated Kinase 6 Length = 321 Back     alignment and structure
>pdb|3IS5|A Chain A, Crystal Structure Of Cdpk Kinase Domain From Toxoplasma Gondii, Tgme49_018720 Length = 285 Back     alignment and structure
>pdb|2BR1|A Chain A, Structure-Based Design Of Novel Chk1 Inhibitors: Insights Into Hydrogen Bonding And Protein-Ligand Affinity Length = 297 Back     alignment and structure
>pdb|1IA8|A Chain A, The 1.7 A Crystal Structure Of Human Cell Cycle Checkpoint Kinase Chk1 Length = 289 Back     alignment and structure
>pdb|1ZLT|A Chain A, Crystal Structure Of Chk1 Complexed With A Hymenaldisine Analog Length = 295 Back     alignment and structure
>pdb|2B9H|A Chain A, Crystal Structure Of Fus3 With A Docking Motif From Ste7 Length = 353 Back     alignment and structure
>pdb|2F9G|A Chain A, Crystal Structure Of Fus3 Phosphorylated On Tyr182 Length = 353 Back     alignment and structure
>pdb|3TXO|A Chain A, Pkc Eta Kinase In Complex With A Naphthyridine Length = 353 Back     alignment and structure
>pdb|4BCF|A Chain A, Structure Of Cdk9 In Complex With Cyclin T And A 2-amino-4- Heteroaryl-pyrimidine Inhibitor Length = 331 Back     alignment and structure
>pdb|2B9F|A Chain A, Crystal Structure Of Non-Phosphorylated Fus3 Length = 353 Back     alignment and structure
>pdb|3NIE|A Chain A, Crystal Structure Of Pf11_0147 Length = 429 Back     alignment and structure
>pdb|1ZYS|A Chain A, Co-Crystal Structure Of Checkpoint Kinase Chk1 With A Pyrrolo-Pyridine Inhibitor Length = 273 Back     alignment and structure
>pdb|4FSN|A Chain A, Crystal Structure Of The Chk1 Length = 278 Back     alignment and structure
>pdb|4FSM|A Chain A, Crystal Structure Of The Chk1 Length = 279 Back     alignment and structure
>pdb|3OT3|A Chain A, X-Ray Crystal Structure Of Compound 22k Bound To Human Chk1 Kinase Domain Length = 273 Back     alignment and structure
>pdb|4FSW|A Chain A, Crystal Structure Of The Chk1 Length = 279 Back     alignment and structure
>pdb|3QUP|A Chain A, Inhibitor Bound Structure Of The Kinase Domain Of The Murine Receptor Tyrosine Kinase Tyro3 (Sky) Length = 323 Back     alignment and structure
>pdb|2X8E|A Chain A, Discovery Of A Novel Class Of Triazolones As Checkpoint Kinase Inhibitors - Hit To Lead Exploration Length = 276 Back     alignment and structure
>pdb|4FT3|A Chain A, Crystal Structure Of The Chk1 Length = 279 Back     alignment and structure
>pdb|2E9V|A Chain A, Structure Of H-Chk1 Complexed With A859017 Length = 268 Back     alignment and structure
>pdb|2AYP|A Chain A, Crystal Structure Of Chk1 With An Indol Inhibitor Length = 269 Back     alignment and structure
>pdb|4FSY|A Chain A, Crystal Structure Of The Chk1 Length = 279 Back     alignment and structure
>pdb|4FSZ|A Chain A, Crystal Structure Of The Chk1 Length = 279 Back     alignment and structure
>pdb|3ZUT|A Chain A, The Structure Of Ost1 (D160a) Kinase Length = 362 Back     alignment and structure
>pdb|2GHG|A Chain A, H-Chk1 Complexed With A431994 Length = 269 Back     alignment and structure
>pdb|3JVR|A Chain A, Characterization Of The Chk1 Allosteric Inhibitor Binding Site Length = 271 Back     alignment and structure
>pdb|2YDJ|A Chain A, Discovery Of Checkpoint Kinase Inhibitor Azd7762 By Structure Based Design And Optimization Of Thiophene Carboxamide Ureas Length = 276 Back     alignment and structure
>pdb|4FST|A Chain A, Crystal Structure Of The Chk1 Length = 269 Back     alignment and structure
>pdb|3ENM|A Chain A, The Structure Of The Map2k Mek6 Reveals An Autoinhibitory Dimer Length = 316 Back     alignment and structure
>pdb|4FSU|A Chain A, Crystal Structure Of The Chk1 Length = 279 Back     alignment and structure
>pdb|3ZUU|A Chain A, The Structure Of Ost1 (D160a, S175d) Kinase In Complex With Gold Length = 362 Back     alignment and structure
>pdb|3F3Z|A Chain A, Crystal Structure Of Cryptosporidium Parvum Calcium Dependent Protein Kinase Cgd7_1840 In Presence Of Indirubin E804 Length = 277 Back     alignment and structure
>pdb|2QG5|A Chain A, Cryptosporidium Parvum Calcium Dependent Protein Kinase Cgd7_1840 Length = 294 Back     alignment and structure
>pdb|3LIJ|A Chain A, Crystal Structure Of Full Length Cpcdpk3 (Cgd5_820) In Complex With Ca2+ And Amppnp Length = 494 Back     alignment and structure
>pdb|3UJG|A Chain A, Crystal Structure Of Snrk2.6 In Complex With Hab1 Length = 361 Back     alignment and structure
>pdb|3RGF|A Chain A, Crystal Structure Of Human Cdk8CYCC Length = 405 Back     alignment and structure
>pdb|3KMW|A Chain A, Crystal Structure Of The IlkALPHA-Parvin Core Complex (Mgatp) Length = 271 Back     alignment and structure
>pdb|2Y4I|B Chain B, Ksr2-Mek1 Heterodimer Length = 319 Back     alignment and structure
>pdb|2I0V|A Chain A, C-Fms Tyrosine Kinase In Complex With A Quinolone Inhibitor Length = 335 Back     alignment and structure
>pdb|3ALN|A Chain A, Crystal Structure Of Human Non-Phosphorylated Mkk4 Kinase Domain Complexed With Amp-Pnp Length = 327 Back     alignment and structure
>pdb|2PK9|A Chain A, Structure Of The Pho85-pho80 Cdk-cyclin Complex Of The Phosphate-responsive Signal Transduction Pathway Length = 317 Back     alignment and structure
>pdb|1X8B|A Chain A, Structure Of Human Wee1a Kinase: Kinase Domain Complexed With Inhibitor Pd0407824 Length = 289 Back     alignment and structure
>pdb|3BI6|A Chain A, Wee1 Kinase Complex With Inhibitor Pd352396 Length = 287 Back     alignment and structure
>pdb|1H4L|A Chain A, Structure And Regulation Of The Cdk5-P25(Nck5a) Complex Length = 292 Back     alignment and structure
>pdb|2IN6|A Chain A, Wee1 Kinase Complex With Inhibitor Pd311839 Length = 287 Back     alignment and structure
>pdb|3FPQ|A Chain A, Crystal Structure Of The Kinase Domain Of Wnk1 Length = 290 Back     alignment and structure
>pdb|2Z2W|A Chain A, Humand Wee1 Kinase Complexed With Inhibitor Pf0335770 Length = 285 Back     alignment and structure
>pdb|2ACX|A Chain A, Crystal Structure Of G Protein Coupled Receptor Kinase 6 Bound To Amppnp Length = 576 Back     alignment and structure
>pdb|2V7O|A Chain A, Crystal Structure Of Human Calcium-Calmodulin-Dependent Protein Kinase Ii Gamma Length = 336 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query577
3uim_A 326 Brassinosteroid insensitive 1-associated receptor; 4e-68
2qkw_B 321 Protein kinase; three-helix bundle motif, AVRPTO-P 3e-63
2nru_A 307 Interleukin-1 receptor-associated kinase 4; inhibi 1e-58
3soc_A 322 Activin receptor type-2A; structural genomics cons 3e-43
3p86_A 309 Serine/threonine-protein kinase CTR1; ETR1, ERS1, 4e-40
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-39
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-30
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 4e-30
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-29
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 5e-29
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 5e-24
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-21
3dtc_A271 Mitogen-activated protein kinase kinase kinase 9; 2e-38
3kmu_A271 ILK, integrin-linked kinase; cell adhesion, ANK re 7e-38
3g2f_A 336 Bone morphogenetic protein receptor type-2; kinase 2e-37
2eva_A 307 TAK1 kinase - TAB1 chimera fusion protein; transfe 1e-36
4f0f_A287 Serine/threonine-protein kinase ROCO4; LRRK2, ATP- 3e-36
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 4e-36
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-23
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-14
3s95_A 310 LIMK-1, LIM domain kinase 1; structural genomics, 2e-35
3gxj_A 303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 7e-35
3q4u_A 301 Activin receptor type-1; structural genomics conso 1e-34
3og7_A 289 AKAP9-BRAF fusion protein; proto-oncogene, V600E, 1e-33
3mdy_A 337 Bone morphogenetic protein receptor type-1B; compl 2e-33
1b6c_B 342 TGF-B superfamily receptor type I; complex (isomer 2e-33
2y4i_B 319 KSR2, HKSR2, kinase suppressor of RAS 2; transfera 4e-33
3lb7_A 307 RAF proto-oncogene serine/threonine-protein kinas; 8e-33
1t4h_A290 Serine/threonine-protein kinase WNK1; protein seri 7e-29
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-26
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 6e-25
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-23
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-22
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-22
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-22
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-21
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-18
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-14
3fdn_A 279 Serine/threonine-protein kinase 6; aurora kinase i 9e-25
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-24
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-23
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-23
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 4e-22
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 4e-22
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 6e-22
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 9e-22
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 3e-21
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 5e-21
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 3e-20
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 6e-20
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 4e-11
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-10
2vgo_A 284 Serine/threonine-protein kinase 12-A; nucleotide-b 1e-23
2w5a_A279 Serine/threonine-protein kinase NEK2; Ser/Thr prot 1e-23
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-23
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 6e-22
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-21
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-21
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-21
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-20
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 5e-20
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-19
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-18
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-15
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 7e-14
3cbl_A 377 C-FES, proto-oncogene tyrosine-protein kinase FES/ 3e-23
1x8b_A289 WEE1HU, WEE1-like protein kinase; cell cycle, tran 7e-23
4g3f_A 336 NF-kappa-beta-inducing kinase; non-RD kinase, prot 1e-22
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-22
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-21
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-21
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-19
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-19
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-18
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-12
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-12
2buj_A 317 Serine/threonine-protein kinase 16; transferase, A 2e-22
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-22
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 4e-22
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 4e-21
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-20
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 4e-19
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 4e-18
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 4e-18
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 4e-14
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-06
3cek_A 313 Dual specificity protein kinase TTK; HMPS1, PYT, E 4e-22
4apc_A 350 Serine/threonine-protein kinase NEK1; transferase; 4e-22
3p1a_A311 MYT1 kinase, membrane-associated tyrosine- and thr 5e-22
3dbq_A 343 Dual specificity protein kinase TTK; MPS1 structur 1e-21
2a19_B284 Interferon-induced, double-stranded RNA-activated 2e-21
3kfa_A 288 Tyrosine-protein kinase ABL1; CML, drug resistance 2e-21
3cok_A 278 Serine/threonine-protein kinase PLK4; POLO-like ki 2e-21
1xbb_A 291 Tyrosine-protein kinase SYK; gleevec, STI-571, ima 3e-21
2zmd_A 390 Dual specificity protein kinase TTK; MPS1, T686A, 4e-21
2pml_X 348 PFPK7, Ser/Thr protein kinase; phosphorylati trans 4e-21
2wqm_A 310 Serine/threonine-protein kinase NEK7; ATP-binding, 5e-21
1opk_A 495 P150, C-ABL, proto-oncogene tyrosine-protein kinas 5e-21
4ezg_A197 Putative uncharacterized protein; internalin-A, le 6e-21
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-17
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-09
2owb_A 335 Serine/threonine-protein kinase PLK1; catalytic do 1e-20
1k9a_A450 Carboxyl-terminal SRC kinase; COOH-terminal SRC ki 1e-20
3t9t_A 267 Tyrosine-protein kinase ITK/TSK; kinase domain, al 1e-20
3brb_A 313 Proto-oncogene tyrosine-protein kinase MER; ATP-bi 2e-20
1byg_A278 CSK, protein (C-terminal SRC kinase); protein kina 2e-20
2clq_A 295 Mitogen-activated protein kinase kinase kinase 5; 2e-20
2rku_A 294 Serine/threonine-protein kinase PLK1; structure of 2e-20
2x7f_A 326 TRAF2 and NCK-interacting protein kinase; serine/t 3e-20
3f66_A 298 Hepatocyte growth factor receptor; C-Met, protein 3e-20
3lzb_A 327 Epidermal growth factor receptor; epidermal growth 3e-20
3sxs_A 268 Cytoplasmic tyrosine-protein kinase BMX; transfera 3e-20
3fxz_A 297 Serine/threonine-protein kinase PAK 1; transferase 4e-20
4e5w_A 302 Tyrosine-protein kinase JAK1; kinase domain, trans 4e-20
3qup_A 323 Tyrosine-protein kinase receptor TYRO3; protein ki 4e-20
4fvq_A 289 Tyrosine-protein kinase JAK2; janus protein kinase 5e-20
3v5q_A 297 NT-3 growth factor receptor; kinase domain, kinase 5e-20
3gen_A 283 Tyrosine-protein kinase BTK; bruton'S tyrosine kin 5e-20
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 6e-20
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-19
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-18
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 4e-17
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 5e-17
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-15
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-13
1p4o_A 322 Insulin-like growth factor I receptor protein; IGF 7e-20
1zy4_A 303 Serine/threonine-protein kinase GCN2; translation 8e-20
2w1i_A 326 JAK2; chromosomal rearrangement, nucleotide-bindin 8e-20
2c30_A 321 Serine/threonine-protein kinase PAK 6; CRIB domain 9e-20
3com_A 314 Serine/threonine-protein kinase 4; MST1, STE20-lik 1e-19
3ugc_A 295 Tyrosine-protein kinase JAK2; small molecule inhib 1e-19
3kul_A 325 Ephrin type-A receptor 8; ATP-binding, kinase, nuc 2e-19
1qcf_A 454 Haematopoetic cell kinase (HCK); tyrosine kinase-i 2e-19
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-19
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 6e-19
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-18
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-18
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-18
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-12
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-10
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-08
1qpc_A 279 LCK kinase; alpha beta fold, transferase; HET: PTR 3e-19
1fmk_A 452 C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros 3e-19
4aoj_A 329 High affinity nerve growth factor receptor; transf 3e-19
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-19
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-17
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-15
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-15
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-15
1o6v_A466 Internalin A; bacterial infection, extracellular r 7e-11
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-08
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-05
3pls_A 298 Macrophage-stimulating protein receptor; protein k 3e-19
3poz_A 327 Epidermal growth factor receptor; kinase domain, a 4e-19
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-19
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-17
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 8e-13
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 8e-06
3lxp_A 318 Non-receptor tyrosine-protein kinase TYK2; JAK3, i 5e-19
3c1x_A 373 Hepatocyte growth factor receptor; receptor tyrosi 5e-19
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 5e-19
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-17
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 9e-17
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 5e-16
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-11
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-06
1u59_A 287 Tyrosine-protein kinase ZAP-70; transferase; HET: 5e-19
2j7t_A 302 Serine/threonine-protein kinase 10; transferase, A 6e-19
3kex_A 325 Receptor tyrosine-protein kinase ERBB-3; kinase do 6e-19
3a7i_A 303 MST3 kinase, serine/threonine kinase 24 (STE20 hom 6e-19
3zzw_A289 Tyrosine-protein kinase transmembrane receptor RO; 7e-19
1fvr_A 327 Tyrosine-protein kinase TIE-2; tyrosine kinase, tr 8e-19
3gni_B 389 Strad alpha; kinase fold, pseudokinase, alpha heli 8e-19
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 9e-19
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-14
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 3e-14
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 4e-14
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-18
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-18
4fmz_A347 Internalin; leucine rich repeat, structural genomi 8e-18
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-17
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-16
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-12
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-05
4g31_A 299 Eukaryotic translation initiation factor 2-alpha; 1e-18
2ozo_A 613 Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t 1e-18
3q60_A 371 ROP5B; pseudokinase, transferase; HET: ATP; 1.72A 2e-18
2yfx_A 327 Tyrosine-protein kinase receptor; nucleotide-bindi 2e-18
2vwi_A 303 Serine/threonine-protein kinase OSR1; STE kinase, 2e-18
2h8h_A 535 Proto-oncogene tyrosine-protein kinase SRC; SRC ki 2e-18
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-18
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-16
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-15
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 9e-15
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-13
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-13
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 8e-06
1u5q_A 348 Serine/threonine protein kinase TAO2; transferase; 3e-18
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-18
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 9e-18
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-17
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 9e-17
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 5e-16
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-15
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-12
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-11
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-08
3cc6_A 281 Protein tyrosine kinase 2 beta; focal adhesion kin 4e-18
3lxl_A 327 Tyrosine-protein kinase JAK3; TYK2, inflammation, 5e-18
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 6e-18
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-14
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 3e-14
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 4e-14
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-13
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 3e-06
1mp8_A 281 Focal adhesion kinase 1; tyrosine protein kinase, 6e-18
1u46_A 291 ACK-1, activated CDC42 kinase 1; tyrosine kinase, 6e-18
3l9p_A 367 Anaplastic lymphoma kinase; kinase domain, ATP-bin 7e-18
2qol_A 373 Ephrin receptor; receptor tyrosine kinase, juxtame 8e-18
1mqb_A 333 Ephrin type-A receptor 2; tyrosine protein kinase, 8e-18
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 8e-18
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-16
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-15
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 6e-15
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-14
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-13
1t46_A 313 HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcom 8e-18
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 8e-18
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-15
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-14
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 5e-12
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 8e-18
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 5e-16
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 2e-15
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 2e-14
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 4e-13
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 5e-13
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 2e-08
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 8e-06
4euu_A 319 Serine/threonine-protein kinase TBK1; ATP binding, 1e-17
2pvf_A 334 Fibroblast growth factor receptor 2; kinase domain 1e-17
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-17
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-16
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-15
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 8e-15
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-14
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 9e-13
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 6e-12
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 7e-11
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-09
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-09
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-07
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 7e-05
3e7e_A 365 HBUB1, BUB1A, mitotic checkpoint serine/threonine- 2e-17
3ll6_A 337 Cyclin G-associated kinase; transferase, protein k 2e-17
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-17
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-15
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-14
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 4e-14
2ivs_A 314 Proto-oncogene tyrosine-protein kinase receptor RE 2e-17
1luf_A 343 Muscle-specific tyrosine kinase receptor MUSK; pho 2e-17
2xir_A 316 Vascular endothelial growth factor receptor 2; ang 3e-17
2i1m_A 333 Macrophage colony-stimulating factor 1 receptor; k 3e-17
2j0j_A 656 Focal adhesion kinase 1; cell migration, FERM, tra 5e-17
2psq_A 370 Fibroblast growth factor receptor 2; kinase domain 5e-17
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 6e-17
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 7e-17
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-15
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 8e-13
3tt0_A 382 Basic fibroblast growth factor receptor 1; kinase 7e-17
1rjb_A 344 FL cytokine receptor; kinase, structure, autoinhib 7e-17
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 9e-17
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-16
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-14
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 6e-14
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-09
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 9e-05
3rgf_A 405 Cyclin-dependent kinase 8; protein kinase complex, 1e-16
2yex_A 276 Serine/threonine-protein kinase CHK1; transferase, 2e-16
3qa8_A 676 MGC80376 protein; kinase ubiquitin-like domain, ph 2e-16
4eut_A 396 Serine/threonine-protein kinase TBK1; ATP binding, 2e-16
3mtl_A 324 Cell division protein kinase 16; pctaire1, indirub 3e-16
3tki_A 323 Serine/threonine-protein kinase CHK1; cell checkpo 6e-16
2wei_A287 Calmodulin-domain protein kinase 1, putative; nucl 6e-16
3fe3_A 328 MAP/microtubule affinity-regulating kinase 3; seri 6e-16
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 6e-16
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 8e-15
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-14
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-14
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-13
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-13
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-06
4agu_A 311 Cyclin-dependent kinase-like 1; transferase, phosp 6e-16
3lij_A 494 Calcium/calmodulin dependent protein kinase with A 7e-16
2x4f_A 373 Myosin light chain kinase family member 4; LUNG, b 8e-16
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-15
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-11
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-15
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-15
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 6e-12
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 5e-11
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 5e-10
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-08
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 4e-05
4aaa_A 331 Cyclin-dependent kinase-like 2; transferase, phosp 1e-15
3kk8_A 284 Calcium/calmodulin dependent protein kinase II; AT 1e-15
3p23_A 432 Serine/threonine-protein kinase/endoribonuclease; 1e-15
3is5_A285 Calcium-dependent protein kinase; CDPK, structural 1e-15
2a2a_A 321 Death-associated protein kinase 2; autoinhibition, 1e-15
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 1e-15
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 5e-14
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 2e-11
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 6e-11
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 2e-08
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-15
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 4e-14
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-13
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 4e-13
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-09
2yab_A 361 Death-associated protein kinase 2; apoptosis, tran 2e-15
4eqm_A 294 Protein kinase; transferase; HET: ANP; 3.00A {Stap 2e-15
2h6d_A 276 5'-AMP-activated protein kinase catalytic subunit 2e-15
2y7j_A 365 Phosphorylase B kinase gamma catalytic chain, test 2e-15
3bhy_A 283 Death-associated protein kinase 3; death associate 2e-15
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 3e-15
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 5e-15
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 9e-13
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-10
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 5e-09
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-15
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-11
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-11
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-09
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-08
3fme_A 290 Dual specificity mitogen-activated protein kinase; 3e-15
2bdw_A 362 Hypothetical protein K11E8.1D; kinase, calmodulin 3e-15
1ua2_A 346 CAK, cell division protein kinase 7; cell cycle, p 4e-15
3gbz_A 329 Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide- 4e-15
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 5e-15
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-13
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 4e-11
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 3e-10
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-06
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 5e-04
2wtk_C 305 Serine/threonine-protein kinase 11; transferase-me 5e-15
3aln_A 327 Dual specificity mitogen-activated protein kinase; 5e-15
2pzi_A 681 Probable serine/threonine-protein kinase PKNG; ATP 5e-15
1phk_A 298 Phosphorylase kinase; glycogen metabolism, transfe 6e-15
2eue_A 275 Carbon catabolite derepressing protein kinase; kin 6e-15
3byv_A 377 Rhoptry kinase; malaria, transferase, structural g 7e-15
3niz_A 311 Rhodanese family protein; structural genomics, str 7e-15
2h34_A 309 Serine/threonine-protein kinase PKNE; apoenzyme, t 7e-15
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 8e-15
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-12
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 5e-12
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-10
3nyv_A 484 Calmodulin-domain protein kinase 1; serine/threoni 9e-15
3mi9_A 351 Cell division protein kinase 9; P-TEFB, HIV-1, pro 9e-15
3lm5_A 327 Serine/threonine-protein kinase 17B; STK17B, serin 1e-14
2y0a_A 326 Death-associated protein kinase 1; transferase, ca 1e-14
3eqc_A 360 Dual specificity mitogen-activated protein kinase; 1e-14
2y94_A 476 5'-AMP-activated protein kinase catalytic subunit; 1e-14
1kob_A 387 Twitchin; kinase, intrasteric regulation; 2.30A {A 1e-14
3h4j_B 336 AMPK kdaid, SNF1-like protein kinase SSP2; ATP-bin 1e-14
1ob3_A 288 PFPK5, cell division control protein 2 homolog; tr 2e-14
3uto_A 573 Twitchin; kinase, muscle sarcomere, transferase; H 2e-14
3mwu_A 486 Calmodulin-domain protein kinase 1; serine/threoni 2e-14
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 3e-14
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 3e-13
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-11
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 3e-09
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 7e-07
2jam_A 304 Calcium/calmodulin-dependent protein kinase type 1 3e-14
3dls_A 335 PAS domain-containing serine/threonine-protein KI; 3e-14
3o0g_A 292 Cell division protein kinase 5; kinase activator c 3e-14
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 3e-14
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 5e-14
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-13
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-12
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 6e-11
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-08
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 3e-07
3an0_A 340 Dual specificity mitogen-activated protein kinase; 4e-14
1tki_A 321 Titin; serine kinase, muscle, autoinhibition; 2.00 4e-14
2r3i_A 299 Cell division protein kinase 2; serine/threonine-p 4e-14
2pmi_A 317 Negative RE, cyclin-dependent protein kinase PHO85 4e-14
3soa_A 444 Calcium/calmodulin-dependent protein kinase type a 5e-14
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 5e-14
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 5e-12
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-09
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 5e-14
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-13
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-11
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-10
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 8e-09
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 8e-05
3pvu_A 695 Beta-adrenergic receptor kinase 1; transferase, se 5e-14
3f3z_A 277 Calcium/calmodulin-dependent protein kinase with d 5e-14
2dyl_A 318 Dual specificity mitogen-activated protein kinase 6e-14
3c4z_A 543 Rhodopsin kinase; Ser/Thr kinase, RGS homology dom 7e-14
4e7w_A 394 Glycogen synthase kinase 3; GSK3, PTyr195, transfe 8e-14
2rio_A 434 Serine/threonine-protein kinase/endoribonuclease I 9e-14
3dzo_A 413 Rhoptry kinase domain; parasitic disease, transfer 1e-13
3c0i_A 351 Peripheral plasma membrane protein CASK; neurexin, 1e-13
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-13
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 3e-13
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 9e-10
2qr7_A 342 Ribosomal protein S6 kinase alpha-3; kinase domain 2e-13
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-13
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-12
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-10
3ork_A 311 Serine/threonine protein kinase; structural genomi 2e-13
3g33_A 308 Cell division protein kinase 4; Ser/Thr protein ki 3e-13
2acx_A 576 G protein-coupled receptor kinase 6; GRK, G transf 4e-13
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 4e-13
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 5e-11
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 5e-13
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 8e-11
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 6e-10
3i6u_A 419 CDS1, serine/threonine-protein kinase CHK2; Ser/Th 6e-13
3uc3_A 361 Serine/threonine-protein kinase SRK2I; SNRK2, ABA 8e-13
1uu3_A 310 HPDK1, 3-phosphoinositide dependent protein kinase 9e-13
3uqc_A286 Probable conserved transmembrane protein; structur 9e-13
1blx_A 326 Cyclin-dependent kinase 6; inhibitor protein, cycl 1e-12
3q5i_A 504 Protein kinase; CDPK, malaria, phosphotransferase, 1e-12
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-12
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-12
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 4e-12
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-11
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 6e-11
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 4e-10
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 7e-09
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-08
2ac3_A 316 MAP kinase-interacting serine/threonine kinase 2; 1e-12
1j1b_A 420 Glycogen synthase kinase-3 beta; complex, TAU, AMP 1e-12
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 1e-12
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-11
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-12
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 7e-12
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 4e-10
2ycf_A 322 Serine/threonine-protein kinase CHK2; transferase, 2e-12
3a99_A 320 Proto-oncogene serine/threonine-protein kinase PI; 2e-12
2zv2_A298 Calcium/calmodulin-dependent protein kinase kinas; 3e-12
3fhr_A 336 MAP kinase-activated protein kinase 3; kinase-inhi 1e-11
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 1e-11
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 4e-10
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 3e-05
3hko_A 345 Calcium/calmodulin-dependent protein kinase with d 2e-11
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-11
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 6e-11
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 3e-09
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-06
2iwi_A 312 Serine/threonine-protein kinase PIM-2; nucleotide- 4e-11
4fr4_A 384 YANK1, serine/threonine-protein kinase 32A; struct 5e-11
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 6e-11
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-10
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-10
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 5e-10
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-08
3kn6_A 325 Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1 6e-11
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 6e-11
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 5e-10
2w4o_A 349 Calcium/calmodulin-dependent protein kinase type I 7e-11
3m19_A251 Variable lymphocyte receptor A diversity region; a 7e-11
3m19_A251 Variable lymphocyte receptor A diversity region; a 4e-08
3e3p_A 360 Protein kinase, putative glycogen synthase kinase; 8e-11
4ejn_A 446 RAC-alpha serine/threonine-protein kinase; AKT1, a 9e-11
4dc2_A 396 Protein kinase C IOTA type; kinase, substrate, cel 1e-10
3a8x_A 345 Protein kinase C IOTA type; transferase; HET: TPO; 1e-10
1nxk_A 400 MAP kinase-activated protein kinase 2; MK2, phosph 2e-10
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-10
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 6e-10
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 3e-06
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 8e-04
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 3e-10
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 8e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-10
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-07
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-07
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 5e-10
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 8e-07
3vhe_A 359 Vascular endothelial growth factor receptor 2; kin 5e-10
3m2w_A 299 MAP kinase-activated protein kinase 2; small molec 9e-10
3v8s_A 410 RHO-associated protein kinase 1; dimerization, myo 1e-09
1o6l_A 337 RAC-beta serine/threonine protein kinase; protein 2e-09
3txo_A 353 PKC-L, NPKC-ETA, protein kinase C ETA type; phosph 2e-09
3eb0_A 383 Putative uncharacterized protein; kinase cryptospo 3e-09
1xjd_A 345 Protein kinase C, theta type; PKC-theta, ATP, AMP, 3e-09
3rp9_A 458 Mitogen-activated protein kinase; structural genom 3e-09
3pfq_A 674 PKC-B, PKC-beta, protein kinase C beta type; phosp 4e-09
2i0e_A 353 Protein kinase C-beta II; serine/threonine protein 5e-09
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 6e-09
1w8a_A192 SLIT protein; signaling protein, secreted protein, 6e-09
1w8a_A192 SLIT protein; signaling protein, secreted protein, 1e-05
1vzo_A 355 Ribosomal protein S6 kinase alpha 5; protein kinas 6e-09
1rdq_E 350 PKA C-alpha, CAMP-dependent protein kinase, alpha- 7e-09
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 9e-09
3a62_A 327 Ribosomal protein S6 kinase beta-1; kinase domain, 1e-08
2vuw_A 336 Serine/threonine-protein kinase haspin; cell cycle 1e-08
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 1e-08
2vd5_A 412 DMPK protein; serine/threonine-protein kinase, kin 1e-08
1fot_A 318 TPK1 delta, CAMP-dependent protein kinase type 1; 2e-08
2r5t_A 373 Serine/threonine-protein kinase SGK1; AGC protein 2e-08
4aw2_A 437 Serine/threonine-protein kinase MRCK alpha; transf 2e-08
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 2e-08
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 6e-08
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 7e-08
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 2e-06
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 3e-05
3pg1_A 362 Mitogen-activated protein kinase, putative (MAP K 3e-08
3n9x_A 432 Phosphotransferase; malaria kinase, structural gen 3e-08
3g51_A 325 Ribosomal protein S6 kinase alpha-3; N-terminal ki 4e-08
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 8e-08
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 3e-07
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 5e-05
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 9e-05
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 9e-05
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 3e-04
3e6j_A229 Variable lymphocyte receptor diversity region; var 2e-07
3e6j_A229 Variable lymphocyte receptor diversity region; var 7e-05
3uzp_A 296 CKI-delta, CKID, casein kinase I isoform delta; CK 2e-07
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-07
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 3e-07
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 3e-06
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 7e-06
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-05
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 5e-05
2xrw_A 371 Mitogen-activated protein kinase 8; transcription, 4e-07
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 7e-07
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 2e-06
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 7e-04
3nsz_A 330 CK II alpha, casein kinase II subunit alpha; inhib 7e-07
2fst_X 367 Mitogen-activated protein kinase 14; active mutant 1e-06
3ttj_A 464 Mitogen-activated protein kinase 10; JNK3, protein 1e-06
3coi_A 353 Mitogen-activated protein kinase 13; P38D, P38delt 2e-06
1cm8_A 367 Phosphorylated MAP kinase P38-gamma; phosphorylati 2e-06
1csn_A 298 Casein kinase-1; phosphotransferase; HET: ATP; 2.0 2e-06
3qyz_A 364 Mitogen-activated protein kinase 1; transferase, s 3e-06
3oz6_A 388 Mitogen-activated protein kinase 1, serine/threon 4e-06
2jii_A 352 Serine/threonine-protein kinase VRK3 molecule: VA 5e-06
3qd2_B 332 Eukaryotic translation initiation factor 2-alpha; 7e-06
3qd2_B 332 Eukaryotic translation initiation factor 2-alpha; 8e-06
2izr_A 330 Casein kinase I isoform gamma-3; serine/threonine- 7e-06
3op5_A 364 Serine/threonine-protein kinase VRK1; adenosine tr 8e-06
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 1e-05
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 2e-05
2b9h_A 353 MAP kinase FUS3, mitogen-activated protein kinase 1e-05
3sv0_A 483 Casein kinase I-like; typical kinase domain fold, 1e-05
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 2e-05
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 2e-05
2i6l_A 320 Mitogen-activated protein kinase 6; MAPK6, ERK3, e 3e-05
2v62_A 345 Serine/threonine-protein kinase VRK2; transferase, 6e-05
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 2e-04
1q8y_A 373 SR protein kinase; transferase; HET: ADP ADE; 2.05 4e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-04
>3uim_A Brassinosteroid insensitive 1-associated receptor; kinase, protein kinase, transferase; HET: SEP TPO ANP; 2.20A {Arabidopsis thaliana} PDB: 3tl8_A* Length = 326 Back     alignment and structure
 Score =  222 bits (568), Expect = 4e-68
 Identities = 69/184 (37%), Positives = 104/184 (56%), Gaps = 6/184 (3%)

Query: 397 ATSYTVASLQTATNSFSQEFLIGEGSLGRVYRAEFANGKIMAVKKIDNAALSLQ-EEDNF 455
              +++  LQ A+++FS + ++G G  G+VY+   A+G ++AVK++       Q  E  F
Sbjct: 17  LKRFSLRELQVASDNFSNKNILGRGGFGKVYKGRLADGTLVAVKRLKEE--RTQGGELQF 74

Query: 456 LEAVSNMSRLRHPNIVTLAGYCAEHGQRLLVYEYVGNGNLHDMLHFADDSSKNLTWNARV 515
              V  +S   H N++ L G+C    +RLLVY Y+ NG++   L    +S   L W  R 
Sbjct: 75  QTEVEMISMAVHRNLLRLRGFCMTPTERLLVYPYMANGSVASCLRERPESQPPLDWPKRQ 134

Query: 516 RVALGTARALEYLHEVCLPSVVHRNFKSANILLDDELNPHLSDCGLAALTPNTERQVIT- 574
           R+ALG+AR L YLH+ C P ++HR+ K+ANILLD+E    + D GLA L    +  V T 
Sbjct: 135 RIALGSARGLAYLHDHCDPKIIHRDVKAANILLDEEFEAVVGDFGLAKLMDYKDTHVTTA 194

Query: 575 --GT 576
             GT
Sbjct: 195 VRGT 198


>2qkw_B Protein kinase; three-helix bundle motif, AVRPTO-PTO duplex, layered beta- sheets, transferas; HET: SEP TPO; 3.20A {Solanum pimpinellifolium} PDB: 3hgk_A* Length = 321 Back     alignment and structure
>2nru_A Interleukin-1 receptor-associated kinase 4; inhibitor, IRAK, transferase; HET: TPO SEP T12; 2.00A {Homo sapiens} PDB: 2nry_A* 2oib_A* 2oic_A* 2oid_A* 2o8y_A* Length = 307 Back     alignment and structure
>3soc_A Activin receptor type-2A; structural genomics consortium, SGC, transferase, protein KI; HET: GVD; 1.95A {Homo sapiens} PDB: 3q4t_A* 2qlu_A* Length = 322 Back     alignment and structure
>3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* Length = 309 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3dtc_A Mitogen-activated protein kinase kinase kinase 9; mixed-lineage kinase, MLK family, MLK1 and MLK3 subtype selective inhibitors; HET: VIN; 2.60A {Homo sapiens} Length = 271 Back     alignment and structure
>3kmu_A ILK, integrin-linked kinase; cell adhesion, ANK repeat, ATP-binding, cell junction, cell membrane, integrin-binding protein, membrane, nucleotide- binding; 1.80A {Homo sapiens} PDB: 3kmw_A* 3rep_A* Length = 271 Back     alignment and structure
>3g2f_A Bone morphogenetic protein receptor type-2; kinase, structural genomics, structural genomics consortium, ATP-binding, disease mutation; HET: ADP; 2.35A {Homo sapiens} Length = 336 Back     alignment and structure
>2eva_A TAK1 kinase - TAB1 chimera fusion protein; transferase/transferase activator complex; HET: ADN; 2.00A {Homo sapiens} Length = 307 Back     alignment and structure
>4f0f_A Serine/threonine-protein kinase ROCO4; LRRK2, ATP-binding, nucleotide serine/threonine-protein kinase, transferase, signaling Pro; HET: ACP; 1.80A {Dictyostelium discoideum} PDB: 4f0g_A 4f1t_A* 4f1m_A* 4f1o_A* Length = 287 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>3s95_A LIMK-1, LIM domain kinase 1; structural genomics, structural genomics consortium, SGC, PR kinase, transferase-antibiotic complex; HET: STU GOL; 1.65A {Homo sapiens} Length = 310 Back     alignment and structure
>3q4u_A Activin receptor type-1; structural genomics consortium, SGC, protein kinase, transfe; HET: LDN FLC; 1.82A {Homo sapiens} PDB: 3mtf_A* 3oom_A* 4dym_A* 3h9r_A* 3my0_A* Length = 301 Back     alignment and structure
>3og7_A AKAP9-BRAF fusion protein; proto-oncogene, V600E, kinase, transferase; HET: 032; 2.45A {Homo sapiens} PDB: 3c4c_A* 3c4d_A* 3idp_A* 3ii5_A* 3d4q_A* 3ppj_A* 3ppk_A* 3prf_A* 3pri_A* 3psb_A* 3psd_A* 3q4c_A* 3skc_A* 3tv4_A* 3tv6_A* 2fb8_A* 4dbn_A* 1uwj_A* 1uwh_A* 3q96_A* Length = 289 Back     alignment and structure
>3mdy_A Bone morphogenetic protein receptor type-1B; complex (isomerase-protein kinase), receptor serine/threonin structural genomics consortium, SGC; HET: LDN; 2.05A {Homo sapiens} Length = 337 Back     alignment and structure
>1b6c_B TGF-B superfamily receptor type I; complex (isomerase/protein kinase), receptor serine/threonine kinase; 2.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1ias_A 2x7o_A* 3faa_A* 3kcf_A* Length = 342 Back     alignment and structure
>2y4i_B KSR2, HKSR2, kinase suppressor of RAS 2; transferase, KSR1; HET: ATP; 3.46A {Homo sapiens} Length = 319 Back     alignment and structure
>1t4h_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase; 1.80A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 3fpq_A Length = 290 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fdn_A Serine/threonine-protein kinase 6; aurora kinase inhibitors, virtual screening, X-RAY CO- crystal analysis, structure-based drug design (SBDD); HET: MMH; 1.90A {Homo sapiens} PDB: 3k5u_A* 3m11_A* 2c6e_A* 1muo_A* 2bmc_A* 2j4z_A* 1ol6_A* 3up2_A* 3unz_A* 3uo5_A* 3uo6_A* 3uod_A* 3uoh_A* 3uoj_A* 3uok_A* 3uo4_A* 3uol_A* 3up7_A* 3lau_A* 2wtv_A* ... Length = 279 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>2vgo_A Serine/threonine-protein kinase 12-A; nucleotide-binding, serine/threonine-protein kinase, ATP-binding, transferase, coiled coil, cell division, kinase; HET: TPO AD5; 1.7A {Xenopus laevis} PDB: 2bfx_A* 2vgp_A* 3ztx_A* 2vrx_A* 2bfy_A* 4af3_A* 3dj6_A* 3d15_A* 3d2i_A* 3d2k_A* 3d14_A* 3dj5_A* 3dj7_A* 3daj_A* 1ol5_A* 1ol7_A* 2x6d_A* 2x6e_A* 2xng_A* 2dwb_A* ... Length = 284 Back     alignment and structure
>2w5a_A Serine/threonine-protein kinase NEK2; Ser/Thr protein kinase, nucleus, meiosis, mitosis, cytoplasm, metal-binding, phosphoprotein; HET: ADP; 1.55A {Homo sapiens} PDB: 2wqo_A* 2xk3_A* 2xk4_A* 2xk6_A* 2xk7_A* 2xk8_A* 2xkc_A* 2xkd_A* 2xke_A* 2xkf_A* 2xnm_A* 2xnn_A* 2xno_A* 2xnp_A* 4afe_A* 2jav_A* 2w5b_A* 2w5h_A 4a4x_A* Length = 279 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* Length = 377 Back     alignment and structure
>1x8b_A WEE1HU, WEE1-like protein kinase; cell cycle, transferase; HET: 824; 1.81A {Homo sapiens} PDB: 3bi6_A* 3biz_A* 3cqe_A* 3cr0_A* 2in6_A* 2io6_A* 2z2w_A* Length = 289 Back     alignment and structure
>4g3f_A NF-kappa-beta-inducing kinase; non-RD kinase, protein serine/threonine kinase, S based drug design, MAP3K14, transferase; HET: 0WB; 1.64A {Mus musculus} PDB: 4g3g_A* 4g3c_A 4dn5_A* Length = 336 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>2buj_A Serine/threonine-protein kinase 16; transferase, ATP-binding, lipoprotein, myristate, PA phosphorylation; HET: STU; 2.6A {Homo sapiens} Length = 317 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>3cek_A Dual specificity protein kinase TTK; HMPS1, PYT, ESK, phosphotyros picked threonine kinase, SGC, structural genomics consortiu binding; HET: 7PE; 2.30A {Homo sapiens} PDB: 3gfw_A* 3h9f_A* 2x9e_A* 3hmp_A* 3hmn_A* 3hmo_A* Length = 313 Back     alignment and structure
>4apc_A Serine/threonine-protein kinase NEK1; transferase; 2.10A {Homo sapiens} Length = 350 Back     alignment and structure
>3p1a_A MYT1 kinase, membrane-associated tyrosine- and threonine-speci inhibitory kinase; structural genomics, structural genomics consortium, SGC; 1.70A {Homo sapiens} Length = 311 Back     alignment and structure
>3dbq_A Dual specificity protein kinase TTK; MPS1 structure, kinase activation, phosphorylation, ATP- binding, nucleotide-binding, phosphoprotein; 2.70A {Homo sapiens} Length = 343 Back     alignment and structure
>2a19_B Interferon-induced, double-stranded RNA-activated kinase; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Homo sapiens} PDB: 2a1a_B* Length = 284 Back     alignment and structure
>3kfa_A Tyrosine-protein kinase ABL1; CML, drug resistance, inhibitor, ATP-binding, nucleotide-binding, oncogene, TRAN; HET: B91; 1.22A {Mus musculus} PDB: 2qoh_A* 3kf4_A* 3k5v_A* 1fpu_A* 1m52_A* 1iep_A* 2hzn_A* 1opj_A* 3ms9_A* 3mss_A* 3ik3_A* 2z60_A* 2e2b_A* 3pyy_A* 3oxz_A* 2g1t_A* 3ue4_A* 3oy3_A* 2hiw_A* 2v7a_A* ... Length = 288 Back     alignment and structure
>3cok_A Serine/threonine-protein kinase PLK4; POLO-like kinase 4, SAK, STK18, PSI, structural genomics, protein structure initiative; HET: ANP; 2.25A {Homo sapiens} Length = 278 Back     alignment and structure
>1xbb_A Tyrosine-protein kinase SYK; gleevec, STI-571, imatinib, spleen typrosine kinase, active conformation, structural genomics, structural genomix; HET: STI; 1.57A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xba_A* 1xbc_A* 3fqe_A* 3fqh_A* 3fqs_A* 3emg_A* 3srv_A* 4dfl_A* 4dfn_A* 3vf8_A* 3vf9_A* Length = 291 Back     alignment and structure
>2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A* Length = 390 Back     alignment and structure
>2pml_X PFPK7, Ser/Thr protein kinase; phosphorylati transferase, transferase; HET: ANP; 2.60A {Plasmodium falciparum} PDB: 2pmn_X* 2pmo_X* Length = 348 Back     alignment and structure
>2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A* Length = 310 Back     alignment and structure
>1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Length = 495 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>2owb_A Serine/threonine-protein kinase PLK1; catalytic domain, POLO-like kinase1, transfera; HET: 626; 2.10A {Homo sapiens} PDB: 2ou7_A* 3fc2_A* 3thb_A* Length = 335 Back     alignment and structure
>1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Length = 450 Back     alignment and structure
>3t9t_A Tyrosine-protein kinase ITK/TSK; kinase domain, alpha/beta, ATP binding, phosphorylation, intracellular, transferase-transferase inhibitor complex; HET: IAQ; 1.65A {Homo sapiens} PDB: 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 1sm2_A* 1snu_A* 1snx_A 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Length = 267 Back     alignment and structure
>3brb_A Proto-oncogene tyrosine-protein kinase MER; ATP-binding, disease mutation, glycoprotein, nucleot binding, phosphorylation, receptor; HET: ADP; 1.90A {Homo sapiens} PDB: 3bpr_A* 2p0c_A* Length = 313 Back     alignment and structure
>1byg_A CSK, protein (C-terminal SRC kinase); protein kinase, phosphorylation, staurosporine, transferase; HET: STU; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 3d7u_A 3d7t_A* Length = 278 Back     alignment and structure
>2clq_A Mitogen-activated protein kinase kinase kinase 5; transferase, metal-binding, apoptosis; HET: STU; 2.3A {Homo sapiens} Length = 295 Back     alignment and structure
>2rku_A Serine/threonine-protein kinase PLK1; structure of PLK1, selectivity residues, POLO-like K structure based drug design, ATP-binding; HET: R78 TLA SRT TAR; 1.95A {Homo sapiens} PDB: 2v5q_A 2yac_A* 4a4l_A* 4a4o_A* 3kb7_A* 3d5w_A* 3d5u_A* 3d5v_A 3db8_A* 3dbc_A* 3dbd_A* 3d5x_A* 3db6_A* 3dbe_A* 3dbf_A* Length = 294 Back     alignment and structure
>2x7f_A TRAF2 and NCK-interacting protein kinase; serine/threonine-protein kinase, phosphoprotein; HET: 824; 2.80A {Homo sapiens} Length = 326 Back     alignment and structure
>3f66_A Hepatocyte growth factor receptor; C-Met, protein kinase, quinoxaline, alternative splicing, ATP-binding, chromosomal rearrangement; HET: IHX; 1.40A {Homo sapiens} PDB: 3i5n_A* 3u6h_A* 3u6i_A* 3ccn_A* 2rfn_A* 2rfs_A* 3cd8_A* 3efj_A* 3efk_A* 3lq8_A* 3zxz_A* 2wkm_A* 2wgj_A* 3zze_A* 3q6w_A* 3r7o_A* 3q6u_A* 3cth_A* 3ce3_A* 3ctj_A* ... Length = 298 Back     alignment and structure
>3lzb_A Epidermal growth factor receptor; epidermal growth factor kinase domain, multitargeted small M kinase inhibitor; HET: ITI; 2.70A {Homo sapiens} Length = 327 Back     alignment and structure
>3sxs_A Cytoplasmic tyrosine-protein kinase BMX; transferase-transferase inhibitor complex; HET: PP2; 1.89A {Homo sapiens} PDB: 3sxr_A* Length = 268 Back     alignment and structure
>3fxz_A Serine/threonine-protein kinase PAK 1; transferase, ATP-binding, phosphorylation, allosteric enzyme, alternative splicing, apoptosis, cell junction; HET: TPO FLL; 1.64A {Homo sapiens} PDB: 3fy0_A* 4daw_A* 3q52_A* 3q53_A* 1yhw_A 1f3m_C 1yhv_A 2hy8_1* 3q4z_A* Length = 297 Back     alignment and structure
>4e5w_A Tyrosine-protein kinase JAK1; kinase domain, transferase-transferase inhibit complex; HET: PTR 0NT; 1.86A {Homo sapiens} PDB: 4e4l_A* 4e4n_A* 3eyg_A* 3eyh_A* Length = 302 Back     alignment and structure
>3qup_A Tyrosine-protein kinase receptor TYRO3; protein kinase inhibitor, receptor tyrosine kinase, spirocyc kinase domain, phosphotransfer, GAS6 ligand; HET: LUN; 1.90A {Mus musculus} Length = 323 Back     alignment and structure
>4fvq_A Tyrosine-protein kinase JAK2; janus protein kinase, pseudokinase, ATP binding, phosphoryla transferase; HET: ATP; 1.75A {Homo sapiens} PDB: 4fvp_A* 4fvr_A* Length = 289 Back     alignment and structure
>3v5q_A NT-3 growth factor receptor; kinase domain, kinase, phosphorylation, transferase-transfer inhibitor complex; HET: 0F4; 2.20A {Homo sapiens} Length = 297 Back     alignment and structure
>3gen_A Tyrosine-protein kinase BTK; bruton'S tyrosine kinase, 4-amino-5-(4-phenoxyphenyl)-5H- pyrrolo[3, 2-D]pyrimidin-7-YL-cyclopentane, TEC-family; HET: B43; 1.60A {Homo sapiens} PDB: 3k54_A* 3pj2_A* 3piy_A* 3piz_A* 3pj1_A* 3pix_A* 3pj3_A* 3p08_A 3ocs_A* 3oct_A* 1k2p_A Length = 283 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>1p4o_A Insulin-like growth factor I receptor protein; IGF-1R, kinase domain, hormone-growth factor complex; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 1m7n_A 3lvp_A* 3lw0_A* 1jqh_A* 2zm3_A* 3f5p_A* 3i81_A* 2oj9_A* 3nw5_A* 3nw6_A* 3nw7_A* 3o23_A* 3qqu_A* 3d94_A* 1k3a_A* 2z8c_A* 1ir3_A* 1gag_A* 1irk_A 3bu3_A* ... Length = 322 Back     alignment and structure
>1zy4_A Serine/threonine-protein kinase GCN2; translation regulator, signal transduction, acid starvation, starvation stress response; 1.95A {Saccharomyces cerevisiae} PDB: 1zy5_A* 1zyd_A* 1zyc_A* 1zxe_A Length = 303 Back     alignment and structure
>2w1i_A JAK2; chromosomal rearrangement, nucleotide-binding, tyrosine-protein kinase, proto-oncogene, phosphoprotein, disease mutation, SH2 domain; HET: PTR L0I; 2.60A {Homo sapiens} Length = 326 Back     alignment and structure
>2c30_A Serine/threonine-protein kinase PAK 6; CRIB domain, ATP-binding, transferase, nucleotide-binding; HET: SEP; 1.6A {Homo sapiens} PDB: 2f57_A* 2j0i_A* 2cdz_A* 2q0n_A* 2x4z_A* 2bva_A* Length = 321 Back     alignment and structure
>3com_A Serine/threonine-protein kinase 4; MST1, STE20-like kinase, PSI, structural genomics, protein structure initiative; HET: TPO; 2.20A {Homo sapiens} Length = 314 Back     alignment and structure
>3ugc_A Tyrosine-protein kinase JAK2; small molecule inhibitor, ATP binding, transferase-transfera inhibitor complex; HET: 046; 1.34A {} PDB: 3krr_A* 3lpb_A* 4aqc_A* 3q32_A* 3rvg_A* 3tjc_A* 3tjd_A* 2b7a_A* 3fup_A* 3e64_A* 3e62_A* 3e63_A* 2xa4_A* 3iok_A* 3io7_A* 3kck_A* 3jy9_A* Length = 295 Back     alignment and structure
>3kul_A Ephrin type-A receptor 8; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase; HET: PTR; 2.15A {Homo sapiens} Length = 325 Back     alignment and structure
>1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Length = 454 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>1qpc_A LCK kinase; alpha beta fold, transferase; HET: PTR ANP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1qpe_A* 1qpj_A* 2pl0_A* 3kxz_A* 3ac1_A* 2zm4_A* 2zyb_A* 2zm1_A* 3ac2_A* 3ac3_A* 3ac4_A* 3ac5_A* 3ac8_A* 3acj_A* 3ack_A* 3ad4_A* 3ad5_A* 3ad6_A* 3kmm_A* 1qpd_A* ... Length = 279 Back     alignment and structure
>1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Length = 452 Back     alignment and structure
>4aoj_A High affinity nerve growth factor receptor; transferase, inhibitor; HET: V4Z; 2.75A {Homo sapiens} Length = 329 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>3pls_A Macrophage-stimulating protein receptor; protein kinase, CIS autophosphorylation conformation, recept tyrosine kinase, AMP-PNP, unphosphorylated; HET: ANP; 2.24A {Homo sapiens} Length = 298 Back     alignment and structure
>3poz_A Epidermal growth factor receptor; kinase domain, anti-oncogene, ATP-binding, cell cycle, disea mutation, glycoprotein, membrane, nucleotide-binding; HET: 03P; 1.50A {Homo sapiens} PDB: 2itx_A* 2ity_A* 2j5f_A* 2j6m_A* 2itw_A* 1m14_A 1m17_A* 3vjo_A* 2gs6_A* 2gs2_A* 2rf9_A 1xkk_A* 2eb2_A 3gop_A 2eb3_A* 2itn_A* 2ito_A* 2itp_A* 2itq_A* 2jiu_A* ... Length = 327 Back     alignment and structure
>3lxp_A Non-receptor tyrosine-protein kinase TYK2; JAK3, inflammation, cancer, PAN inhibitor, ATP-binding nucleotide-binding, phosphoprotein, SH2 domain; HET: PTR IZA; 1.65A {Homo sapiens} PDB: 3lxn_A* 3nz0_A* 3nyx_A* Length = 318 Back     alignment and structure
>3c1x_A Hepatocyte growth factor receptor; receptor tyrosine kinase, signal transduction, GRB2, SHC, ATP-binding, glycoprotein, membrane; HET: CKK; 2.17A {Homo sapiens} SCOP: d.144.1.7 Length = 373 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>1u59_A Tyrosine-protein kinase ZAP-70; transferase; HET: STU; 2.30A {Homo sapiens} SCOP: d.144.1.7 Length = 287 Back     alignment and structure
>2j7t_A Serine/threonine-protein kinase 10; transferase, ATP-binding, cell cycle progression, phosphorylation, disease mutation, nucleotide- binding; HET: 274; 2.0A {Homo sapiens} PDB: 4aot_A* 3zz2_A* 2j51_A* 2jfl_A* 2jfm_A* 2uv2_A* Length = 302 Back     alignment and structure
>3kex_A Receptor tyrosine-protein kinase ERBB-3; kinase domain, inactive kinase, HER3, ATP-binding, cell membrane, membrane, nucleotide-binding; HET: ANP; 2.80A {Homo sapiens} PDB: 3lmg_A* Length = 325 Back     alignment and structure
>3a7i_A MST3 kinase, serine/threonine kinase 24 (STE20 homolog, yeast); two-LOBE protein kinase fold, ATP-binding, nucleotid binding, transferase; HET: TPO ADE; 1.45A {Homo sapiens} PDB: 3a7g_A* 3a7h_A* 3a7f_A* 3a7j_A* 3ckw_A 3ckx_A* 3ggf_A* 2xik_A* Length = 303 Back     alignment and structure
>3zzw_A Tyrosine-protein kinase transmembrane receptor RO; transferase, neurotrophic tyrosine kinase, receptor-related NTRKR2; 2.90A {Homo sapiens} Length = 289 Back     alignment and structure
>1fvr_A Tyrosine-protein kinase TIE-2; tyrosine kinase, transferase; 2.20A {Homo sapiens} SCOP: d.144.1.7 PDB: 2oo8_X* 2osc_A* 2p4i_A* 3l8p_A* 2wqb_A* Length = 327 Back     alignment and structure
>3gni_B Strad alpha; kinase fold, pseudokinase, alpha helical repeat protein, ADA protein, ATP-binding, cell cycle, kinase, nucleotide-bindin nucleus; HET: ATP CIT; 2.35A {Homo sapiens} PDB: 2wtk_B* Length = 389 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4g31_A Eukaryotic translation initiation factor 2-alpha; deletion mutant, catalytic domain, synthetic inhibitor, TRAN transferase inhibitor complex; HET: 0WH; 2.28A {Homo sapiens} PDB: 4g34_A* Length = 299 Back     alignment and structure
>2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} Length = 613 Back     alignment and structure
>3q60_A ROP5B; pseudokinase, transferase; HET: ATP; 1.72A {Toxoplasma gondii} PDB: 3q5z_A* Length = 371 Back     alignment and structure
>2yfx_A Tyrosine-protein kinase receptor; nucleotide-binding, transferase; HET: VGH; 1.70A {Homo sapiens} PDB: 2xp2_A* 3aox_A* 2yhv_A 3lcs_A* 3lct_A* 4dce_A* 2xba_A* 2xb7_A* Length = 327 Back     alignment and structure
>2vwi_A Serine/threonine-protein kinase OSR1; STE kinase, hypertension, transferase; HET: ANP; 2.15A {Homo sapiens} PDB: 3dak_A* Length = 303 Back     alignment and structure
>2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Length = 535 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>1u5q_A Serine/threonine protein kinase TAO2; transferase; HET: SEP; 2.10A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 1u5r_A* 2gcd_A* Length = 348 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3cc6_A Protein tyrosine kinase 2 beta; focal adhesion kinase, structural genomics, structural genom consortium, SGC, ATP-binding, membrane; 1.60A {Homo sapiens} PDB: 3fzs_A* 3et7_A 3fzo_A* 3fzr_A* 3fzp_A* 3fzt_A* 3h3c_A* Length = 281 Back     alignment and structure
>3lxl_A Tyrosine-protein kinase JAK3; TYK2, inflammation, cancer, PAN inhibitor, ATP-binding mutation, membrane, nucleotide-binding, phosphoprot SCID; HET: IZA; 1.74A {Homo sapiens} PDB: 3lxk_A* 3pjc_A* 1yvj_A* Length = 327 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>1mp8_A Focal adhesion kinase 1; tyrosine protein kinase, transferase; HET: ADP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 2ijm_A* 2etm_A* 3pxk_A* 2jkq_A* 2j0m_B* 2jkm_A* 2j0l_A* 3bz3_A* 2jko_A* 2jkk_A* Length = 281 Back     alignment and structure
>1u46_A ACK-1, activated CDC42 kinase 1; tyrosine kinase, transferase; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 1u4d_A* 1u54_A* 3eqr_A* 3eqp_B* Length = 291 Back     alignment and structure
>3l9p_A Anaplastic lymphoma kinase; kinase domain, ATP-binding, glycoprotein, membrane, nucleotide-binding, phosphoprotein, proto-oncogene; 1.80A {Homo sapiens} Length = 367 Back     alignment and structure
>2qol_A Ephrin receptor; receptor tyrosine kinase, juxtamembrane segment, structural genomics, mutant, structural genomics consortium, SGC, ATP- binding; 1.07A {Homo sapiens} PDB: 2qok_A 2qoi_A 2qoo_A 2qof_A 2qod_A 2qo9_A* 2gsf_A 2qo7_A* 2qo2_A* 2qoq_A* 2qon_A* 3fxx_A* 3fy2_A 2qoc_A* 2qob_A* 3dzq_A* 2r2p_A 2hel_A 2rei_A 3dko_A* ... Length = 373 Back     alignment and structure
>1mqb_A Ephrin type-A receptor 2; tyrosine protein kinase, transferase; HET: ANP; 2.30A {Homo sapiens} SCOP: d.144.1.7 Length = 333 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>1t46_A HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcoma viral oncogene homolog; kinase, structure, inhibitor, STI-571, gleevec, transferase activator; HET: STI; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1pkg_A* 1t45_A 3g0e_A* 3g0f_A* Length = 313 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>4euu_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: SEP BX7; 1.80A {Homo sapiens} Length = 319 Back     alignment and structure
>2pvf_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; HET: PTR ACP; 1.80A {Homo sapiens} PDB: 3cly_A* 2pzr_A* 2pzp_A* 2pvy_A* 2pz5_A* 2q0b_A* 2pwl_A* 2py3_A* 3ri1_A* 1gjo_A 1oec_A* 3b2t_A* 3gql_A* 3gqi_A* 1fgk_A 1fgi_A* 1agw_A 2fgi_A* 3js2_A* 3ky2_A ... Length = 334 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>3e7e_A HBUB1, BUB1A, mitotic checkpoint serine/threonine-protein kinas; spindle assembly checkpoint, mitosis, kinase, activation, KE CDC20, ATP-binding; HET: ATP; 2.31A {Homo sapiens} Length = 365 Back     alignment and structure
>3ll6_A Cyclin G-associated kinase; transferase, protein kinase, serine/threonine kinase, cyclin clathrine, membrane trafficking, structural genomics; 2.10A {Homo sapiens} Length = 337 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>2ivs_A Proto-oncogene tyrosine-protein kinase receptor RET; nucleotide-binding, hirschsprung disease, phosphorylation, disease mutation; HET: ACK; 2.00A {Homo sapiens} PDB: 2ivt_A* 2ivu_A* 2x2k_A* 2x2l_A* 2x2m_A* 2ivv_A* Length = 314 Back     alignment and structure
>1luf_A Muscle-specific tyrosine kinase receptor MUSK; phosphorylation, signal transduction, MASS spectrometry, transferase; 2.05A {Rattus norvegicus} SCOP: d.144.1.7 Length = 343 Back     alignment and structure
>2xir_A Vascular endothelial growth factor receptor 2; angiogenesis, nucleotide-binding, inhibitor, phosphorylation receptor, transferase, transmembrane; HET: 00J; 1.50A {Homo sapiens} PDB: 1vr2_A* 1ywn_A* 3vnt_A* 3c7q_A* 2oh4_A* 3u6j_A* 3efl_A* 2p2i_A* 3cjf_A* 3cjg_A* 3ewh_A* 2qu5_A* 2qu6_A* 2rl5_A* 3b8q_A* 3b8r_A* 2p2h_A* 3cp9_A* 3cpb_A* 3cpc_A* ... Length = 316 Back     alignment and structure
>2i1m_A Macrophage colony-stimulating factor 1 receptor; kinase domain, kinase inhibitor complex, transferase; HET: 5CN; 1.80A {Homo sapiens} PDB: 3bea_A* 3lcd_A* 2i0y_A* 2i0v_A* 3dpk_A* 3krj_A* 3krl_A* 2ogv_A 3lco_A* Length = 333 Back     alignment and structure
>2j0j_A Focal adhesion kinase 1; cell migration, FERM, transferase, integrin signaling; HET: 4ST; 2.80A {Gallus gallus} PDB: 2j0k_A* Length = 656 Back     alignment and structure
>2psq_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xr0_A Length = 370 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>3tt0_A Basic fibroblast growth factor receptor 1; kinase domain, transferase, transferase-transferase inhibito; HET: 07J; 2.80A {Homo sapiens} Length = 382 Back     alignment and structure
>1rjb_A FL cytokine receptor; kinase, structure, autoinhibition, juxtamembrane domain, transferase; 2.10A {Homo sapiens} SCOP: d.144.1.7 Length = 344 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>3rgf_A Cyclin-dependent kinase 8; protein kinase complex, transferase,transcription; HET: BAX; 2.20A {Homo sapiens} Length = 405 Back     alignment and structure
>2yex_A Serine/threonine-protein kinase CHK1; transferase, cell cycle; HET: YEX; 1.30A {Homo sapiens} PDB: 2x8e_A* 2ydk_A* 2ydj_A* 2yer_A* 2ydi_A* 1nvq_A* 1nvr_A* 1nvs_A* 2wmq_A* 2wmr_A* 2wms_A* 2wmt_A* 2wmu_A* 2wmv_A* 2wmw_A* 2wmx_A* 2x8d_A* 2x8i_A* 2xey_A* 2xez_A* ... Length = 276 Back     alignment and structure
>3qa8_A MGC80376 protein; kinase ubiquitin-like domain, phosphorylation, kinase domain ubiquitin-like domain, kinase, substrate binding; 3.60A {Xenopus laevis} PDB: 3qad_A* 3rzf_A* Length = 676 Back     alignment and structure
>4eut_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: BX7; 2.60A {Homo sapiens} Length = 396 Back     alignment and structure
>3mtl_A Cell division protein kinase 16; pctaire1, indirubin, structural genomics, structural consortium, SGC, transferase; HET: FEF; 2.40A {Homo sapiens} Length = 324 Back     alignment and structure
>3tki_A Serine/threonine-protein kinase CHK1; cell checkpoint, transferase-transferase inhib complex; HET: S25; 1.60A {Homo sapiens} PDB: 2qhm_A* 2r0u_A* 3tkh_A* 2qhn_A* 2hy0_A* 2hog_A* 2hxq_A* 2hxl_A* 3f9n_A* Length = 323 Back     alignment and structure
>2wei_A Calmodulin-domain protein kinase 1, putative; nucleotide-binding, serine/threonine-protein kinase, CGD3_920, transferase; HET: VGG; 1.65A {Cryptosporidium parvum iowa II} PDB: 3dfa_A 3ma6_A* Length = 287 Back     alignment and structure
>3fe3_A MAP/microtubule affinity-regulating kinase 3; serine/threonine protein kinase, MARK;PAR-1, UBA domai TAK1;P78;MARK3, ATP-binding; 1.90A {Homo sapiens} PDB: 2qnj_A 1y8g_A* 1zmw_A 1zmu_A 1zmv_A 2wzj_A 2r0i_A 2hak_A 3iec_A Length = 328 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>4agu_A Cyclin-dependent kinase-like 1; transferase, phospho-mimetic; HET: D15; 2.40A {Homo sapiens} Length = 311 Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Length = 494 Back     alignment and structure
>2x4f_A Myosin light chain kinase family member 4; LUNG, breast cancer, transferase, serine/threonine-protein kinase, nucleotide-binding; HET: 16X 1PE; 2.67A {Homo sapiens} Length = 373 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>4aaa_A Cyclin-dependent kinase-like 2; transferase, phospho-mimetic; HET: DKI; 1.53A {Homo sapiens} Length = 331 Back     alignment and structure
>3kk8_A Calcium/calmodulin dependent protein kinase II; ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; HET: TPO; 1.72A {Caenorhabditis elegans} PDB: 3kk9_A* 3kl8_A 2vn9_A* 3bhh_A* Length = 284 Back     alignment and structure
>3p23_A Serine/threonine-protein kinase/endoribonuclease; kinase domain, kinase and RNAse function, ATP binding ssRNA dephosphorylated, hydrolase; HET: ADP; 2.70A {Homo sapiens} Length = 432 Back     alignment and structure
>3is5_A Calcium-dependent protein kinase; CDPK, structural genomics, parasitology, structural genomics consortium, SGC, ATP-binding, nucleotide-binding; HET: ANP; 2.55A {Toxoplasma gondii} Length = 285 Back     alignment and structure
>2a2a_A Death-associated protein kinase 2; autoinhibition, transferase; 1.47A {Homo sapiens} PDB: 2cke_A* 1wmk_A 1z9x_A 2a27_A 2x0g_A 2xuu_A* 2w4k_A* 2xzs_A Length = 321 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2yab_A Death-associated protein kinase 2; apoptosis, transferase; HET: AMP; 1.90A {Mus musculus} PDB: 2yaa_A* 2ya9_A* Length = 361 Back     alignment and structure
>4eqm_A Protein kinase; transferase; HET: ANP; 3.00A {Staphylococcus aureus subsp} Length = 294 Back     alignment and structure
>2h6d_A 5'-AMP-activated protein kinase catalytic subunit alpha-2; ATP-binding, cholesterol biosynthesis, fatty acid biosynthesis;kinase, lipid synthesis; 1.85A {Homo sapiens} PDB: 3aqv_A* 2yza_A* Length = 276 Back     alignment and structure
>2y7j_A Phosphorylase B kinase gamma catalytic chain, testis/liver isoform; transferase; HET: B49; 2.50A {Homo sapiens} PDB: 1h0t_A 1lp1_B 1q2n_A 2spz_A 3mzw_B* 1ss1_A 2jwd_A 1bdc_A 1bdd_A 1fc2_C* 2b87_A 2b88_A 1h0t_B 1lp1_A 2b87_B 2b89_A 3s1k_A Length = 365 Back     alignment and structure
>3bhy_A Death-associated protein kinase 3; death associated kinase, DAPK3, ZIP kinase, ZIPK, DAP kinase like kinase, DLK, structural genomics consortium; HET: 7CP; 1.24A {Homo sapiens} PDB: 3bqr_A* 2j90_A* 1yrp_A* 2yak_A* 2y4p_A* 3f5u_A* 1jks_A 1jkk_A* 1ig1_A* 1jkl_A 1jkt_A 3eh9_A* 3eha_A* 3f5g_A* 1p4f_A* 1wvw_A 1wvx_A* 1wvy_A* 2w4j_A* 3dgk_A ... Length = 283 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3fme_A Dual specificity mitogen-activated protein kinase; active mutant, structural genomics consortium, SCG, binding, nucleotide-binding, phosphoprotein; HET: STU; 2.26A {Homo sapiens} PDB: 3enm_A Length = 290 Back     alignment and structure
>2bdw_A Hypothetical protein K11E8.1D; kinase, calmodulin activated, transferase; 1.80A {Caenorhabditis elegans} PDB: 2wel_A* 2v7o_A* 2vz6_A* 1cdm_B 1cm1_B 1cm4_B Length = 362 Back     alignment and structure
>1ua2_A CAK, cell division protein kinase 7; cell cycle, phosphorylation, protein-protein interaction, PR kinase, cell cycle, transferase; HET: TPO ATP; 3.02A {Homo sapiens} SCOP: d.144.1.7 Length = 346 Back     alignment and structure
>3gbz_A Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; 1.85A {Giardia lamblia} PDB: 3gc0_A* Length = 329 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>2wtk_C Serine/threonine-protein kinase 11; transferase-metal-binding protein complex, transferase metal protein complex, nucleus; HET: ANP; 2.65A {Homo sapiens} Length = 305 Back     alignment and structure
>3aln_A Dual specificity mitogen-activated protein kinase; protein AMP-PNP complex, transferase; HET: ANP; 2.30A {Homo sapiens} PDB: 3alo_A* Length = 327 Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Length = 681 Back     alignment and structure
>1phk_A Phosphorylase kinase; glycogen metabolism, transferase, serine/threonine-protein, ATP-binding, calmodulin-binding; HET: ATP; 2.20A {Oryctolagus cuniculus} SCOP: d.144.1.7 PDB: 1ql6_A* 2phk_A* Length = 298 Back     alignment and structure
>3byv_A Rhoptry kinase; malaria, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} PDB: 2w1z_A Length = 377 Back     alignment and structure
>3niz_A Rhodanese family protein; structural genomics, structural genomics consortium, SGC, phosphotransferase, cyclin dependent kinase; HET: ADP; 2.40A {Cryptosporidium parvum} PDB: 2qkr_A* Length = 311 Back     alignment and structure
>2h34_A Serine/threonine-protein kinase PKNE; apoenzyme, transferase; 2.80A {Mycobacterium tuberculosis} Length = 309 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Length = 484 Back     alignment and structure
>3mi9_A Cell division protein kinase 9; P-TEFB, HIV-1, protein binding; HET: TPO; 2.10A {Homo sapiens} PDB: 3mia_A* 3blh_A* 3blq_A* 3blr_A* 3lq5_A* 3my1_A* 3tn8_A* 3tnh_A* 3tni_A* Length = 351 Back     alignment and structure
>3lm5_A Serine/threonine-protein kinase 17B; STK17B, serine/threonine kinase 17B, DRAK2, DAP kinase relat apoptosis-inducing protein kinase 2; HET: QUE; 2.29A {Homo sapiens} PDB: 3lm0_A* Length = 327 Back     alignment and structure
>2y0a_A Death-associated protein kinase 1; transferase, calmodulin, esprit; HET: MES; 2.60A {Homo sapiens} Length = 326 Back     alignment and structure
>3eqc_A Dual specificity mitogen-activated protein kinase; MEK1 kinase, ATP-binding, disease mutation, nucleoti binding, phosphoprotein; HET: 3BM AGS; 1.80A {Homo sapiens} PDB: 3eqd_A* 3eqf_A* 3eqg_A* 3eqh_A* 3eqi_A* 2y4i_C* 3eqb_A* 2p55_A* 1s9j_A* 3dy7_A* 3e8n_A* 3dv3_A* 3mbl_A* 3pp1_A* 3orn_A* 3os3_A* 3sls_A* 1s9i_A* Length = 360 Back     alignment and structure
>2y94_A 5'-AMP-activated protein kinase catalytic subunit; transferase, nucleotide-binding, staurosporine-binding, serine/threonine-protein kinase; HET: TPO STU AMP; 3.24A {Rattus norvegicus} Length = 476 Back     alignment and structure
>1kob_A Twitchin; kinase, intrasteric regulation; 2.30A {Aplysia californica} SCOP: d.144.1.7 Length = 387 Back     alignment and structure
>3h4j_B AMPK kdaid, SNF1-like protein kinase SSP2; ATP-binding, nucleotide-binding, phosphoprotei serine/threonine-protein kinase, transferase; 2.80A {Schizosaccharomyces pombe} Length = 336 Back     alignment and structure
>1ob3_A PFPK5, cell division control protein 2 homolog; transferase, serine/threonine-protein kinase, ATP-binding, phosphorylation, CDK; 1.9A {Plasmodium falciparum} SCOP: d.144.1.7 PDB: 1v0p_A* 1v0o_A* 1v0b_A Length = 288 Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Length = 573 Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Length = 486 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>2jam_A Calcium/calmodulin-dependent protein kinase type 1G; transferase, kinase, membrane, ATP-binding, prenylation, serine/threonine-protein kinase, alternative splicing; HET: J60; 1.7A {Homo sapiens} PDB: 2jc6_A* 1a06_A Length = 304 Back     alignment and structure
>3dls_A PAS domain-containing serine/threonine-protein KI; PAS kinase, PASK, protein kinase, drug discovery, ATP-bindin kinase, nucleotide-binding; HET: ADP; 2.30A {Homo sapiens} Length = 335 Back     alignment and structure
>3o0g_A Cell division protein kinase 5; kinase activator complex, kinase inhibitor complex, transferase-transferase activator complex; HET: 3O0; 1.95A {Homo sapiens} PDB: 1unh_A* 1ung_A* 1unl_A* 1h4l_A Length = 292 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>1tki_A Titin; serine kinase, muscle, autoinhibition; 2.00A {Homo sapiens} SCOP: d.144.1.7 Length = 321 Back     alignment and structure
>2r3i_A Cell division protein kinase 2; serine/threonine-protein kinase, cell cycle, inhibition, cyclin-dependent kinase, cancer, ATP-binding; HET: SCF; 1.28A {Homo sapiens} PDB: 2r3j_A* 2r3k_A* 2r3l_A* 2r3m_A* 2r3n_A* 2r3o_A* 2r3p_A* 2r3q_A* 1jvp_P* 1buh_A 1ckp_A* 1di8_A* 1dm2_A* 1f5q_A 1fin_A* 1fq1_B* 1fvt_A* 1fvv_A* 1g5s_A* 1gih_A* ... Length = 299 Back     alignment and structure
>2pmi_A Negative RE, cyclin-dependent protein kinase PHO85; cyclin-dependent kinase, signaling protein,transfera cycle complex; HET: MES AGS; 2.90A {Saccharomyces cerevisiae} PDB: 2pk9_A* Length = 317 Back     alignment and structure
>3soa_A Calcium/calmodulin-dependent protein kinase type alpha with A beta 7 linker; phosphorylation, cytosolic, transferase-transferase inhibitor complex; HET: DB8; 3.55A {Homo sapiens} Length = 444 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>3pvu_A Beta-adrenergic receptor kinase 1; transferase, serine/threonine-protein kinase, ATP-binding, I membrane; HET: QRW; 2.48A {Bos taurus} PDB: 3psc_A* 3pvw_A* 1omw_A 1ym7_A 2bcj_A* 3cik_A 3krw_A* 3krx_A* 1bak_A Length = 695 Back     alignment and structure
>3f3z_A Calcium/calmodulin-dependent protein kinase with domain and 4 calmodulin like EF...; calcium dependent protein kinase; HET: SEP DRK; 1.84A {Cryptosporidium parvum iowa II} PDB: 2qg5_A* Length = 277 Back     alignment and structure
>2dyl_A Dual specificity mitogen-activated protein kinase kinase 7; MKK7, activated mutant, ATP-binding, structural genomics, NPPSFA; 2.45A {Homo sapiens} Length = 318 Back     alignment and structure
>3c4z_A Rhodopsin kinase; Ser/Thr kinase, RGS homology domain, G protein coupled recep kinase, GRK, GRK1, P-loop, autophosphoryl ADP, ATP-binding; HET: ADP; 1.84A {Bos taurus} PDB: 3c4x_A* 3c4y_A 3c4w_A* 3c50_A* 3c51_A* 3qc9_A* 2i94_B Length = 543 Back     alignment and structure
>4e7w_A Glycogen synthase kinase 3; GSK3, PTyr195, transferase; HET: PTR; 3.30A {Ustilago maydis} Length = 394 Back     alignment and structure
>2rio_A Serine/threonine-protein kinase/endoribonuclease IRE1; protein-nucleotide complex, ATP-binding, endoplasmic reticulum, glycoprotein; HET: ADP; 2.40A {Saccharomyces cerevisiae} PDB: 3lj0_A* 3lj1_A* 3lj2_A* 3fbv_A* 3sdm_A* 3sdj_A* Length = 434 Back     alignment and structure
>3dzo_A Rhoptry kinase domain; parasitic disease, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Length = 413 Back     alignment and structure
>3c0i_A Peripheral plasma membrane protein CASK; neurexin, Ca2+/calmodulin dependent protein kinase, Mg synaptic plasticity, pseudokinase, maguk; HET: 3AM; 1.85A {Homo sapiens} PDB: 3c0h_A* 3c0g_A* 3mfr_A* 3mfs_A* 3mft_A 3mfu_A* 3tac_A Length = 351 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>2qr7_A Ribosomal protein S6 kinase alpha-3; kinase domain, RSK2, autoinhibitory, ATP-binding, nucleotide phosphorylation, serine/threonine-protein kinase; 2.00A {Mus musculus} PDB: 2qr8_A 4d9t_A* 4d9u_A* 3rny_A 2wnt_A Length = 342 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>3ork_A Serine/threonine protein kinase; structural genomics, TB structural genomics consortium, TBSG domain, signal transduction; HET: AGS; 1.60A {Mycobacterium tuberculosis} PDB: 3ori_A* 3orl_A* 3oro_A* 3orp_A* 3ort_A* 3f61_A* 1mru_A* 3f69_A* 3orm_A* 1o6y_A* 2fum_A* Length = 311 Back     alignment and structure
>3g33_A Cell division protein kinase 4; Ser/Thr protein kinase, cell cycle, phosphorylation, ATP-BIN cell division, disease mutation, kinase; 3.00A {Homo sapiens} Length = 308 Back     alignment and structure
>2acx_A G protein-coupled receptor kinase 6; GRK, G transferase; HET: ANP; 2.60A {Homo sapiens} PDB: 3nyn_A* 3nyo_A* Length = 576 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A Length = 419 Back     alignment and structure
>3uc3_A Serine/threonine-protein kinase SRK2I; SNRK2, ABA signaling, transferase; 1.90A {Arabidopsis thaliana} PDB: 3zut_A 3zuu_A 3uc4_A 3ujg_A 3udb_A Length = 361 Back     alignment and structure
>1uu3_A HPDK1, 3-phosphoinositide dependent protein kinase-1; PKB, inhibitor, LY333531, diabetes, cancer, transferase, serine/threonine-protein kinase; HET: SEP LY4; 1.7A {Homo sapiens} SCOP: d.144.1.7 PDB: 1okz_A* 1oky_A* 1uu7_A* 1uu8_A* 2biy_A* 3rwp_A* 2xch_A* 3rwq_A* 3sc1_A* 3qd0_A* 2r7b_A* 3ion_A* 3qcq_A* 3qcs_A* 3qcx_A* 3qcy_A* 3iop_A* 3qd3_A* 3qd4_A* 3h9o_A* ... Length = 310 Back     alignment and structure
>3uqc_A Probable conserved transmembrane protein; structural genomics, TB structural genomics consortium, TBSG fold, FHAA, transferase; 2.26A {Mycobacterium tuberculosis} PDB: 3oun_B* 3otv_A 3ouk_A Length = 286 Back     alignment and structure
>1blx_A Cyclin-dependent kinase 6; inhibitor protein, cyclin-dependent kinase, cell cycle control, alpha/beta, complex (inhibitor protein/kinase); 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 1bi7_A 1bi8_A 1g3n_A 2f2c_B* 1jow_B* 2euf_B* 1xo2_B* 3nup_A* 3nux_A* 2w9z_B 2w99_B 2w96_B 2w9f_B Length = 326 Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Length = 504 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>2ac3_A MAP kinase-interacting serine/threonine kinase 2; DFD motif, transferase; 2.10A {Homo sapiens} PDB: 2hw7_A* 2ac5_A* 2hw6_A Length = 316 Back     alignment and structure
>1j1b_A Glycogen synthase kinase-3 beta; complex, TAU, AMPPNP, transferase; HET: ANP; 1.80A {Homo sapiens} SCOP: d.144.1.7 PDB: 1i09_A* 1j1c_A* 2jld_A* 3m1s_A* 3pup_A* 3du8_A* 1pyx_A* 1q41_A* 1q3w_A* 1q3d_A* 1q4l_A* 3q3b_A* 1q5k_A* 3i4b_A* 3l1s_A* 1r0e_A* 3zrk_A* 3zrl_A* 3zrm_A* 4dit_A* ... Length = 420 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>2ycf_A Serine/threonine-protein kinase CHK2; transferase, anticancer, anticancer drug design; HET: YCF; 1.77A {Homo sapiens} PDB: 2yiq_A* 2w7x_A* 2ycq_A* 2ycs_A* 2w0j_A* 2yir_A* 2yit_A* 2wtj_A* 2cn8_A* 2wtc_A* 2wtd_A* 2wti_A* 2cn5_A* 2xbj_A* 2xm8_A* 2xm9_A* 2xk9_A* 2ycr_A* Length = 322 Back     alignment and structure
>3a99_A Proto-oncogene serine/threonine-protein kinase PI; PIM-1, P27KIP1, peptide drug, prostate cancer, transferase; HET: ANP; 1.60A {Homo sapiens} PDB: 3bgq_A* 3bgp_A* 2obj_A* 3bgz_A* 3t9i_A* 3dcv_A* 1xws_A* 2xj1_A* 2xix_A* 2xiz_A* 2xj0_A* 2xiy_A* 2xj2_A* 3f2a_A* 1xr1_A* 1xqz_A* 3cy2_A* 3cxw_A* 3cy3_A* 2bik_B* ... Length = 320 Back     alignment and structure
>2zv2_A Calcium/calmodulin-dependent protein kinase kinas; beta, camkk2, E.C.2.7.11.17, phosphorylation, AMPKK, metabolism, binding, calmodulin-binding; HET: 609; 2.40A {Homo sapiens} Length = 298 Back     alignment and structure
>3fhr_A MAP kinase-activated protein kinase 3; kinase-inhibitor complex, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; HET: P4O; 1.90A {Homo sapiens} PDB: 3fxw_A* 3r1n_A* 3she_A* 2oza_A 3fyk_X* 3fyj_X* 2p3g_X* 3ka0_A* 3fpm_A* 2pzy_A* 3a2c_A* 3kc3_A* 3gok_A* 2jbo_A* 2jbp_A* 3r2y_A* 3r30_A* 3r2b_A* Length = 336 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3hko_A Calcium/calmodulin-dependent protein kinase with domain and 2 calmodulin-like EF...; structural genomics, protist parasite; HET: ANP; 1.80A {Cryptosporidium parvum iowa II} Length = 345 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2iwi_A Serine/threonine-protein kinase PIM-2; nucleotide-binding, cancer, leukemia, transferase, ATP-binding, proto- oncogene, phosphorylation; HET: HB1; 2.80A {Homo sapiens} Length = 312 Back     alignment and structure
>4fr4_A YANK1, serine/threonine-protein kinase 32A; structural genomics, structural genomics consortium, SGC, TR; HET: STU; 2.29A {Homo sapiens} Length = 384 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3kn6_A Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1, MSK, ATP-binding, metal-binding, NUCL binding, serine/threonine-protein kinase, transferase; 2.00A {Homo sapiens} PDB: 3kn5_A Length = 325 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>2w4o_A Calcium/calmodulin-dependent protein kinase type IV; calmodulin-binding, nucleotide-binding, serine/threonine-protein kinase, ATP-binding; HET: DKI; 2.17A {Homo sapiens} Length = 349 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3e3p_A Protein kinase, putative glycogen synthase kinase; leishmaniasis, transferase; 2.00A {Leishmania major} Length = 360 Back     alignment and structure
>4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* Length = 446 Back     alignment and structure
>4dc2_A Protein kinase C IOTA type; kinase, substrate, cell polarity, atypical PKC, trans transferase substrate complex; HET: TPO ADE; 2.40A {Mus musculus} Length = 396 Back     alignment and structure
>3a8x_A Protein kinase C IOTA type; transferase; HET: TPO; 2.00A {Homo sapiens} PDB: 3a8w_A* 1zrz_A* Length = 345 Back     alignment and structure
>1nxk_A MAP kinase-activated protein kinase 2; MK2, phosphorylation, staurosporine, transfe; HET: STU; 2.70A {Homo sapiens} SCOP: d.144.1.7 PDB: 1kwp_A* 1ny3_A* 2onl_C Length = 400 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>3vhe_A Vascular endothelial growth factor receptor 2; kinase domain, kinase, transferase-transferase inhibitor COM; HET: 42Q; 1.55A {Homo sapiens} PDB: 1y6a_A* 1y6b_A* 3vid_A* 3hng_A* Length = 359 Back     alignment and structure
>3m2w_A MAP kinase-activated protein kinase 2; small molecule inhibitor, spiroazetidine-tetracycle, ATP-SIT inhibitor, novartis compound NVP-BXS169; HET: L8I; 2.41A {Homo sapiens} PDB: 3kga_A* 3m42_A* Length = 299 Back     alignment and structure
>3v8s_A RHO-associated protein kinase 1; dimerization, myosin, transferase, inhibitor, transf transferase inhibitor complex; HET: 0HD; 2.29A {Homo sapiens} PDB: 3tv7_A* 2etr_A* 2esm_A* 2eto_A* 2etk_A* 3d9v_A* 3ncz_A* 3ndm_A* 2v55_A* 2f2u_A* 2h9v_A* Length = 410 Back     alignment and structure
>1o6l_A RAC-beta serine/threonine protein kinase; protein kinase, transferase, serine/threonine-protein kinase; HET: TPO ANP; 1.6A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jdo_A* 2jdr_A* 2uw9_A* 2x37_A* 2x39_A* 2xh5_A* 3d0e_A* 3e87_A* 3e88_A* 3e8d_A* 1o6k_A* 1mrv_A 1mry_A 1gzn_A 1gzk_A 1gzo_A 3qkl_A* 3ocb_A* 3ow4_A* 3qkk_A* ... Length = 337 Back     alignment and structure
>3txo_A PKC-L, NPKC-ETA, protein kinase C ETA type; phosphotransferase, transferase-transferase inhibito; HET: TPO 07U; 2.05A {Homo sapiens} Length = 353 Back     alignment and structure
>3eb0_A Putative uncharacterized protein; kinase cryptosporidium parvum, ATP-binding, kinase, nucleoti binding; HET: PTR DRK; 2.65A {Cryptosporidium parvum iowa II} Length = 383 Back     alignment and structure
>1xjd_A Protein kinase C, theta type; PKC-theta, ATP, AMP,, transferase; HET: TPO SEP STU; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jed_A* Length = 345 Back     alignment and structure
>3rp9_A Mitogen-activated protein kinase; structural genomics, structural genomics consortium, SGC, TR; 2.40A {Toxoplasma gondii} Length = 458 Back     alignment and structure
>3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Length = 674 Back     alignment and structure
>2i0e_A Protein kinase C-beta II; serine/threonine protein kinase, transferase; HET: TPO SEP PDS; 2.60A {Homo sapiens} PDB: 3iw4_A* Length = 353 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1vzo_A Ribosomal protein S6 kinase alpha 5; protein kinase, transferase, phosphorylation, serine/threonine protein kinase; 1.8A {Homo sapiens} SCOP: d.144.1.7 Length = 355 Back     alignment and structure
>1rdq_E PKA C-alpha, CAMP-dependent protein kinase, alpha-catalytic SU; CAMP-dependent protein kinase,catalytic mechanism, ATP hydro two nucleotide states; HET: TPO SEP ADP ATP; 1.26A {Mus musculus} SCOP: d.144.1.7 PDB: 2erz_E* 3fjq_E* 1bkx_A* 1atp_E* 1fmo_E* 1j3h_A* 1jlu_E* 1bx6_A* 1re8_A* 1rej_A* 1rek_A* 2cpk_E* 2qcs_A* 2qvs_E* 1l3r_E* 3idb_A* 3idc_A* 3o7l_D* 3ow3_A* 3tnp_C* ... Length = 350 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>3a62_A Ribosomal protein S6 kinase beta-1; kinase domain, inactive, active, ribosomal S6 kinase, activation, alternative initiation, ATP-binding; HET: TPO STU; 2.35A {Homo sapiens} PDB: 3a61_A* 3a60_A* Length = 327 Back     alignment and structure
>2vuw_A Serine/threonine-protein kinase haspin; cell cycle, transferase, CAsp8, nucleotide binding; HET: MSE 5ID MPD; 1.80A {Homo sapiens} PDB: 3f2n_A* 3e7v_A* 3dlz_A* 3fmd_A* 3iq7_A* 2wb8_A Length = 336 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2vd5_A DMPK protein; serine/threonine-protein kinase, kinase, transferase, ATP-BI nucleotide-binding, cardiac contractility, muscle different; HET: BI8; 2.80A {Homo sapiens} Length = 412 Back     alignment and structure
>1fot_A TPK1 delta, CAMP-dependent protein kinase type 1; open conformation, transferase; HET: TPO; 2.80A {Saccharomyces cerevisiae} SCOP: d.144.1.7 Length = 318 Back     alignment and structure
>2r5t_A Serine/threonine-protein kinase SGK1; AGC protein kinase, apoptosis, ATP-binding, cytoplasm, endoplasmic reticulum, nucleotide-binding, nucleus; HET: ANP; 1.90A {Homo sapiens} PDB: 3hdm_A* 3hdn_A* Length = 373 Back     alignment and structure
>4aw2_A Serine/threonine-protein kinase MRCK alpha; transferase, CDC42BPA; HET: 22E; 1.70A {Rattus norvegicus} PDB: 3tku_A* 3qfv_A* Length = 437 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3pg1_A Mitogen-activated protein kinase, putative (MAP K protein); EPK Ser/Thr protein kinase fold, Ser/Thr protein kinase, TRA; 1.95A {Leishmania major} Length = 362 Back     alignment and structure
>3n9x_A Phosphotransferase; malaria kinase, structural genomics, structural genomics CON SGC; 2.05A {Plasmodium berghei} PDB: 3nie_A* Length = 432 Back     alignment and structure
>3g51_A Ribosomal protein S6 kinase alpha-3; N-terminal kinase domain of P90 ribosomal S6 kinase 2, ATP- binding, nucleotide-binding, phosphoprotein; HET: ANP; 1.80A {Mus musculus} PDB: 2z7q_A* 2z7r_A* 2z7s_A* Length = 325 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3uzp_A CKI-delta, CKID, casein kinase I isoform delta; CK1D, inhibitor, PF670462, transferase-transferase I complex; HET: 0CK; 1.94A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 1cki_A 1ckj_A Length = 296 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>2xrw_A Mitogen-activated protein kinase 8; transcription, MAPK signaling pathways, linear binding motif; HET: ANP; 1.33A {Homo sapiens} PDB: 1ukh_A 1uki_A* 2xs0_A* 3elj_A* 2h96_A* 2gmx_A* 2g01_A* 2no3_A* 3o2m_A* 3o17_A* 3pze_A* 3g9l_X* 2p33_A* 3cgf_A* 3cgo_A* 3g90_X* 2ok1_A* 3g9n_A* 1pmn_A* 1pmq_A* ... Length = 371 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3nsz_A CK II alpha, casein kinase II subunit alpha; inhibitor, transferase-transferase inhibitor CO; HET: ANP; 1.30A {Homo sapiens} PDB: 2r7i_A 3pe1_A* 1jwh_A* 3pe2_A* 3r0t_A* 3h30_A* 3q9w_A* 3q9x_A* 3q9y_A* 3q9z_A* 3qa0_A 3bqc_A* 2rkp_A* 3c13_A* 3fwq_A 3rps_A* 3mb7_A* 3mb6_A* 3owj_A* 3owk_A* ... Length = 330 Back     alignment and structure
>2fst_X Mitogen-activated protein kinase 14; active mutants, lipids, MAP kinase insertion, autophosphorylation, transferase; HET: BOG; 1.45A {Homo sapiens} PDB: 2fso_X* 2fsl_X* 2fsm_X* 2npq_A* 2bal_A* 2baj_A* 2bak_A* 2baq_A* 2qd9_A* 1ian_A* 2rg5_A* 2rg6_A* 3bv2_A* 3bv3_A* 3bx5_A* 3c5u_A* 3cg2_A* 3l8x_A* 3mvl_A* 3mvm_A* ... Length = 367 Back     alignment and structure
>3ttj_A Mitogen-activated protein kinase 10; JNK3, protein kinase in transferase-transferase inhibitor complex; HET: JBI; 2.10A {Homo sapiens} PDB: 3tti_A* 1jnk_A* Length = 464 Back     alignment and structure
>3coi_A Mitogen-activated protein kinase 13; P38D, P38delta, ERK, MAP kinase, PMK, STK26, stress-activated protein kinase, structural genomics, PSI; 2.09A {Homo sapiens} Length = 353 Back     alignment and structure
>1cm8_A Phosphorylated MAP kinase P38-gamma; phosphorylation, transferase; HET: TPO PTR ANP; 2.40A {Homo sapiens} SCOP: d.144.1.7 Length = 367 Back     alignment and structure
>1csn_A Casein kinase-1; phosphotransferase; HET: ATP; 2.00A {Schizosaccharomyces pombe} SCOP: d.144.1.7 PDB: 1eh4_A* 2csn_A* Length = 298 Back     alignment and structure
>3qyz_A Mitogen-activated protein kinase 1; transferase, serine/threonine-protein kinase, ATP-binding CE phosphorylation; HET: CME Z8B SO4; 1.46A {Rattus norvegicus} PDB: 2fys_B 1erk_A* 3qyi_A* 3erk_A* 3qyw_A* 4erk_A* 2z7l_A* 2erk_A* 1gol_A* 2gph_A 3o71_A 3r63_A 3c9w_A* 2y9q_A* 3sa0_A* 1wzy_A* 2e14_A* 1tvo_A* 2ojg_A* 2oji_A* ... Length = 364 Back     alignment and structure
>3oz6_A Mitogen-activated protein kinase 1, serine/threon protein kinase; structural genomics consortium, SGC, transferase; 2.37A {Cryptosporidium parvum iowa II} Length = 388 Back     alignment and structure
>2jii_A Serine/threonine-protein kinase VRK3 molecule: VA related kinase 3; transferase, pseudo kinase domain, vaccinia related kinase, ATP-binding; 2.00A {Homo sapiens} Length = 352 Back     alignment and structure
>3qd2_B Eukaryotic translation initiation factor 2-alpha; EIF2A kinase, phosphoryalation, gene regulation; HET: TPO; 2.81A {Mus musculus} Length = 332 Back     alignment and structure
>3qd2_B Eukaryotic translation initiation factor 2-alpha; EIF2A kinase, phosphoryalation, gene regulation; HET: TPO; 2.81A {Mus musculus} Length = 332 Back     alignment and structure
>2izr_A Casein kinase I isoform gamma-3; serine/threonine-protein kinase, transferase, ATP- binding, phosphorylation, nucleotide-binding; HET: BRK; 1.3A {Homo sapiens} PDB: 2izs_A* 2izt_A* 2izu_A* 2chl_A* 2c47_A* 2cmw_A* Length = 330 Back     alignment and structure
>3op5_A Serine/threonine-protein kinase VRK1; adenosine triphosphate, amino acid sequence, binding sites, domain, models, molecular; HET: REB; 2.40A {Homo sapiens} PDB: 2lav_A 2kty_A 2kul_A Length = 364 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2b9h_A MAP kinase FUS3, mitogen-activated protein kinase FUS3; transferase; HET: ADP; 1.55A {Saccharomyces cerevisiae} PDB: 2b9i_A* 2b9j_A* 2f49_A 2fa2_A 2b9f_A* 2f9g_A* Length = 353 Back     alignment and structure
>3sv0_A Casein kinase I-like; typical kinase domain fold, cytosol, transferase; 2.00A {Oryza sativa japonica group} Length = 483 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Length = 267 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>2i6l_A Mitogen-activated protein kinase 6; MAPK6, ERK3, extracellular signal regulated kinase 3, serine phosphorylation, threonine phosphorylation; 2.25A {Homo sapiens} Length = 320 Back     alignment and structure
>2v62_A Serine/threonine-protein kinase VRK2; transferase, ATP-binding, membrane, nucleotide-binding, TRAN; 1.7A {Homo sapiens} Length = 345 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>1q8y_A SR protein kinase; transferase; HET: ADP ADE; 2.05A {Saccharomyces cerevisiae} SCOP: d.144.1.7 PDB: 1q8z_A 1q97_A* 1q99_A* 1how_A 2jd5_A Length = 373 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query577
4b9d_A 350 Serine/threonine-protein kinase NEK1; transferase, 100.0
3omv_A 307 RAF proto-oncogene serine/threonine-protein kinas; 100.0
3fpq_A290 Serine/threonine-protein kinase WNK1; protein seri 100.0
4asz_A 299 BDNF/NT-3 growth factors receptor; transferase, TR 100.0
4aoj_A 329 High affinity nerve growth factor receptor; transf 100.0
4aw0_A 311 HPDK1, 3-phosphoinositide-dependent protein kinase 100.0
4gt4_A 308 Tyrosine-protein kinase transmembrane receptor RO; 100.0
4fih_A 346 Serine/threonine-protein kinase PAK 4; kinase doma 100.0
3ubd_A 304 Ribosomal protein S6 kinase alpha-3; kinase-inhibi 100.0
3hyh_A275 Carbon catabolite-derepressing protein kinase; kin 100.0
4fie_A 423 Serine/threonine-protein kinase PAK 4; kinase doma 100.0
3hmm_A 303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 100.0
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 100.0
4g3f_A 336 NF-kappa-beta-inducing kinase; non-RD kinase, prot 100.0
4g31_A 299 Eukaryotic translation initiation factor 2-alpha; 100.0
4ase_A 353 Vascular endothelial growth factor receptor 2; tra 100.0
4b99_A 398 Mitogen-activated protein kinase 7; transferase, i 99.97
3v5w_A 689 G-protein coupled receptor kinase 2; inhibitor com 99.97
4f9c_A 361 Cell division cycle 7-related protein kinase; Ser/ 99.97
3uto_A 573 Twitchin; kinase, muscle sarcomere, transferase; H 99.96
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.96
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 99.96
3fe3_A 328 MAP/microtubule affinity-regulating kinase 3; seri 99.96
3uim_A 326 Brassinosteroid insensitive 1-associated receptor; 99.96
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.95
4aw2_A 437 Serine/threonine-protein kinase MRCK alpha; transf 99.95
3s95_A 310 LIMK-1, LIM domain kinase 1; structural genomics, 99.95
2qkw_B 321 Protein kinase; three-helix bundle motif, AVRPTO-P 99.95
3v8s_A 410 RHO-associated protein kinase 1; dimerization, myo 99.95
1o6l_A 337 RAC-beta serine/threonine protein kinase; protein 99.95
3p86_A 309 Serine/threonine-protein kinase CTR1; ETR1, ERS1, 99.95
2vd5_A 412 DMPK protein; serine/threonine-protein kinase, kin 99.95
3zgw_A 347 Maternal embryonic leucine zipper kinase; transfer 99.95
1fot_A 318 TPK1 delta, CAMP-dependent protein kinase type 1; 99.95
3txo_A 353 PKC-L, NPKC-ETA, protein kinase C ETA type; phosph 99.95
4fr4_A 384 YANK1, serine/threonine-protein kinase 32A; struct 99.95
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.95
2c30_A 321 Serine/threonine-protein kinase PAK 6; CRIB domain 99.95
3niz_A 311 Rhodanese family protein; structural genomics, str 99.95
3fxz_A 297 Serine/threonine-protein kinase PAK 1; transferase 99.95
4dc2_A 396 Protein kinase C IOTA type; kinase, substrate, cel 99.95
2psq_A 370 Fibroblast growth factor receptor 2; kinase domain 99.95
3qd2_B 332 Eukaryotic translation initiation factor 2-alpha; 99.95
3kul_A 325 Ephrin type-A receptor 8; ATP-binding, kinase, nuc 99.95
3a8x_A 345 Protein kinase C IOTA type; transferase; HET: TPO; 99.95
2bdw_A 362 Hypothetical protein K11E8.1D; kinase, calmodulin 99.95
2yab_A 361 Death-associated protein kinase 2; apoptosis, tran 99.94
1xjd_A 345 Protein kinase C, theta type; PKC-theta, ATP, AMP, 99.94
4hcu_A 269 Tyrosine-protein kinase ITK/TSK; transferase-trans 99.94
3c0i_A 351 Peripheral plasma membrane protein CASK; neurexin, 99.94
1tki_A 321 Titin; serine kinase, muscle, autoinhibition; 2.00 99.94
2qol_A 373 Ephrin receptor; receptor tyrosine kinase, juxtame 99.94
4eqm_A 294 Protein kinase; transferase; HET: ANP; 3.00A {Stap 99.94
1rdq_E 350 PKA C-alpha, CAMP-dependent protein kinase, alpha- 99.94
3tki_A 323 Serine/threonine-protein kinase CHK1; cell checkpo 99.94
3e7e_A 365 HBUB1, BUB1A, mitotic checkpoint serine/threonine- 99.94
3soa_A 444 Calcium/calmodulin-dependent protein kinase type a 99.94
3o0g_A 292 Cell division protein kinase 5; kinase activator c 99.94
3sxs_A 268 Cytoplasmic tyrosine-protein kinase BMX; transfera 99.94
3a62_A 327 Ribosomal protein S6 kinase beta-1; kinase domain, 99.94
2i0e_A 353 Protein kinase C-beta II; serine/threonine protein 99.94
3cbl_A 377 C-FES, proto-oncogene tyrosine-protein kinase FES/ 99.94
3h4j_B 336 AMPK kdaid, SNF1-like protein kinase SSP2; ATP-bin 99.94
1ob3_A 288 PFPK5, cell division control protein 2 homolog; tr 99.94
2y94_A 476 5'-AMP-activated protein kinase catalytic subunit; 99.94
2y0a_A 326 Death-associated protein kinase 1; transferase, ca 99.94
2zv2_A298 Calcium/calmodulin-dependent protein kinase kinas; 99.94
2r5t_A 373 Serine/threonine-protein kinase SGK1; AGC protein 99.94
3c4z_A 543 Rhodopsin kinase; Ser/Thr kinase, RGS homology dom 99.94
3gen_A 283 Tyrosine-protein kinase BTK; bruton'S tyrosine kin 99.94
1x8b_A289 WEE1HU, WEE1-like protein kinase; cell cycle, tran 99.94
2nru_A 307 Interleukin-1 receptor-associated kinase 4; inhibi 99.94
2acx_A 576 G protein-coupled receptor kinase 6; GRK, G transf 99.94
3soc_A 322 Activin receptor type-2A; structural genomics cons 99.94
1opk_A 495 P150, C-ABL, proto-oncogene tyrosine-protein kinas 99.94
3p1a_A311 MYT1 kinase, membrane-associated tyrosine- and thr 99.94
1luf_A 343 Muscle-specific tyrosine kinase receptor MUSK; pho 99.94
3rp9_A 458 Mitogen-activated protein kinase; structural genom 99.94
3gni_B 389 Strad alpha; kinase fold, pseudokinase, alpha heli 99.94
1qcf_A 454 Haematopoetic cell kinase (HCK); tyrosine kinase-i 99.94
4agu_A 311 Cyclin-dependent kinase-like 1; transferase, phosp 99.94
4euu_A 319 Serine/threonine-protein kinase TBK1; ATP binding, 99.94
3tt0_A 382 Basic fibroblast growth factor receptor 1; kinase 99.94
3vhe_A 359 Vascular endothelial growth factor receptor 2; kin 99.94
1t4h_A290 Serine/threonine-protein kinase WNK1; protein seri 99.94
2vuw_A336 Serine/threonine-protein kinase haspin; cell cycle 99.94
3q4u_A 301 Activin receptor type-1; structural genomics conso 99.94
4ejn_A 446 RAC-alpha serine/threonine-protein kinase; AKT1, a 99.94
3uc3_A 361 Serine/threonine-protein kinase SRK2I; SNRK2, ABA 99.94
1kob_A 387 Twitchin; kinase, intrasteric regulation; 2.30A {A 99.94
2ivs_A 314 Proto-oncogene tyrosine-protein kinase receptor RE 99.94
3ugc_A 295 Tyrosine-protein kinase JAK2; small molecule inhib 99.94
3fdn_A 279 Serine/threonine-protein kinase 6; aurora kinase i 99.94
3n9x_A 432 Phosphotransferase; malaria kinase, structural gen 99.94
3lb7_A 307 RAF proto-oncogene serine/threonine-protein kinas; 99.94
3ork_A 311 Serine/threonine protein kinase; structural genomi 99.94
3is5_A285 Calcium-dependent protein kinase; CDPK, structural 99.93
3l9p_A 367 Anaplastic lymphoma kinase; kinase domain, ATP-bin 99.93
2pmi_A 317 Negative RE, cyclin-dependent protein kinase PHO85 99.93
3qup_A 323 Tyrosine-protein kinase receptor TYRO3; protein ki 99.93
3kk8_A 284 Calcium/calmodulin dependent protein kinase II; AT 99.93
2x4f_A 373 Myosin light chain kinase family member 4; LUNG, b 99.93
3dls_A 335 PAS domain-containing serine/threonine-protein KI; 99.93
3dbq_A 343 Dual specificity protein kinase TTK; MPS1 structur 99.93
1k9a_A450 Carboxyl-terminal SRC kinase; COOH-terminal SRC ki 99.93
3kmu_A271 ILK, integrin-linked kinase; cell adhesion, ANK re 99.93
2w4o_A 349 Calcium/calmodulin-dependent protein kinase type I 99.93
1fmk_A 452 C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros 99.93
3dtc_A271 Mitogen-activated protein kinase kinase kinase 9; 99.93
1t46_A 313 HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcom 99.93
2eue_A 275 Carbon catabolite derepressing protein kinase; kin 99.93
3f3z_A 277 Calcium/calmodulin-dependent protein kinase with d 99.93
1u5q_A 348 Serine/threonine protein kinase TAO2; transferase; 99.93
2vgo_A 284 Serine/threonine-protein kinase 12-A; nucleotide-b 99.93
2w5a_A 279 Serine/threonine-protein kinase NEK2; Ser/Thr prot 99.93
2izr_A 330 Casein kinase I isoform gamma-3; serine/threonine- 99.93
3lij_A 494 Calcium/calmodulin dependent protein kinase with A 99.93
4aaa_A 331 Cyclin-dependent kinase-like 2; transferase, phosp 99.93
2rku_A 294 Serine/threonine-protein kinase PLK1; structure of 99.93
3t9t_A 267 Tyrosine-protein kinase ITK/TSK; kinase domain, al 99.93
2zmd_A 390 Dual specificity protein kinase TTK; MPS1, T686A, 99.93
3eqc_A 360 Dual specificity mitogen-activated protein kinase; 99.93
2owb_A 335 Serine/threonine-protein kinase PLK1; catalytic do 99.93
4eut_A 396 Serine/threonine-protein kinase TBK1; ATP binding, 99.93
3cok_A 278 Serine/threonine-protein kinase PLK4; POLO-like ki 99.93
1rjb_A 344 FL cytokine receptor; kinase, structure, autoinhib 99.93
1vzo_A 355 Ribosomal protein S6 kinase alpha 5; protein kinas 99.93
3kfa_A 288 Tyrosine-protein kinase ABL1; CML, drug resistance 99.93
3pfq_A 674 PKC-B, PKC-beta, protein kinase C beta type; phosp 99.93
2pvf_A 334 Fibroblast growth factor receptor 2; kinase domain 99.93
3mwu_A 486 Calmodulin-domain protein kinase 1; serine/threoni 99.93
3oz6_A 388 Mitogen-activated protein kinase 1, serine/threon 99.93
2h8h_A 535 Proto-oncogene tyrosine-protein kinase SRC; SRC ki 99.93
3fme_A 290 Dual specificity mitogen-activated protein kinase; 99.93
3i6u_A 419 CDS1, serine/threonine-protein kinase CHK2; Ser/Th 99.93
3kn6_A 325 Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1 99.93
2wqm_A 310 Serine/threonine-protein kinase NEK7; ATP-binding, 99.93
3hko_A 345 Calcium/calmodulin-dependent protein kinase with d 99.93
2a2a_A 321 Death-associated protein kinase 2; autoinhibition, 99.93
2pml_X 348 PFPK7, Ser/Thr protein kinase; phosphorylati trans 99.93
2yex_A 276 Serine/threonine-protein kinase CHK1; transferase, 99.93
4f0f_A287 Serine/threonine-protein kinase ROCO4; LRRK2, ATP- 99.93
1qpc_A 279 LCK kinase; alpha beta fold, transferase; HET: PTR 99.93
3ttj_A 464 Mitogen-activated protein kinase 10; JNK3, protein 99.93
3brb_A 313 Proto-oncogene tyrosine-protein kinase MER; ATP-bi 99.93
1p4o_A 322 Insulin-like growth factor I receptor protein; IGF 99.93
4e5w_A 302 Tyrosine-protein kinase JAK1; kinase domain, trans 99.93
3q5i_A 504 Protein kinase; CDPK, malaria, phosphotransferase, 99.93
1mp8_A 281 Focal adhesion kinase 1; tyrosine protein kinase, 99.93
3llt_A 360 Serine/threonine kinase-1, pflammer; lammer kinase 99.93
3g33_A 308 Cell division protein kinase 4; Ser/Thr protein ki 99.93
1cm8_A 367 Phosphorylated MAP kinase P38-gamma; phosphorylati 99.93
3og7_A 289 AKAP9-BRAF fusion protein; proto-oncogene, V600E, 99.93
3gbz_A 329 Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide- 99.93
2buj_A 317 Serine/threonine-protein kinase 16; transferase, A 99.93
3mi9_A 351 Cell division protein kinase 9; P-TEFB, HIV-1, pro 99.93
3lxl_A 327 Tyrosine-protein kinase JAK3; TYK2, inflammation, 99.93
3lxp_A 318 Non-receptor tyrosine-protein kinase TYK2; JAK3, i 99.93
4fvq_A 289 Tyrosine-protein kinase JAK2; janus protein kinase 99.93
3gxj_A 303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 99.93
2jam_A 304 Calcium/calmodulin-dependent protein kinase type 1 99.93
3nyv_A 484 Calmodulin-domain protein kinase 1; serine/threoni 99.93
4fl3_A 635 Tyrosine-protein kinase SYK; transferase; HET: ANP 99.93
3poz_A 327 Epidermal growth factor receptor; kinase domain, a 99.93
3mdy_A 337 Bone morphogenetic protein receptor type-1B; compl 99.93
3c1x_A 373 Hepatocyte growth factor receptor; receptor tyrosi 99.93
1xbb_A 291 Tyrosine-protein kinase SYK; gleevec, STI-571, ima 99.93
2y7j_A 365 Phosphorylase B kinase gamma catalytic chain, test 99.92
3bhy_A 283 Death-associated protein kinase 3; death associate 99.92
2h6d_A 276 5'-AMP-activated protein kinase catalytic subunit 99.92
1mqb_A 333 Ephrin type-A receptor 2; tyrosine protein kinase, 99.92
1zy4_A 303 Serine/threonine-protein kinase GCN2; translation 99.92
3an0_A 340 Dual specificity mitogen-activated protein kinase; 99.92
3f66_A 298 Hepatocyte growth factor receptor; C-Met, protein 99.92
3kex_A 325 Receptor tyrosine-protein kinase ERBB-3; kinase do 99.92
3pg1_A 362 Mitogen-activated protein kinase, putative (MAP K 99.92
2r3i_A 299 Cell division protein kinase 2; serine/threonine-p 99.92
3pls_A 298 Macrophage-stimulating protein receptor; protein k 99.92
2qr7_A 342 Ribosomal protein S6 kinase alpha-3; kinase domain 99.92
3a7i_A 303 MST3 kinase, serine/threonine kinase 24 (STE20 hom 99.92
3lm5_A 327 Serine/threonine-protein kinase 17B; STK17B, serin 99.92
2a19_B284 Interferon-induced, double-stranded RNA-activated 99.92
1u59_A 287 Tyrosine-protein kinase ZAP-70; transferase; HET: 99.92
2xir_A 316 Vascular endothelial growth factor receptor 2; ang 99.92
3eb0_A 383 Putative uncharacterized protein; kinase cryptospo 99.92
2h34_A 309 Serine/threonine-protein kinase PKNE; apoenzyme, t 99.92
1nxk_A 400 MAP kinase-activated protein kinase 2; MK2, phosph 99.92
3uqc_A286 Probable conserved transmembrane protein; structur 99.92
2ac3_A 316 MAP kinase-interacting serine/threonine kinase 2; 99.92
1ua2_A 346 CAK, cell division protein kinase 7; cell cycle, p 99.92
2ozo_A 613 Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t 99.92
3op5_A 364 Serine/threonine-protein kinase VRK1; adenosine tr 99.92
3byv_A 377 Rhoptry kinase; malaria, transferase, structural g 99.92
1fvr_A 327 Tyrosine-protein kinase TIE-2; tyrosine kinase, tr 99.92
2i1m_A 333 Macrophage colony-stimulating factor 1 receptor; k 99.92
1b6c_B 342 TGF-B superfamily receptor type I; complex (isomer 99.92
1phk_A 298 Phosphorylase kinase; glycogen metabolism, transfe 99.92
2ycf_A 322 Serine/threonine-protein kinase CHK2; transferase, 99.92
2w1i_A 326 JAK2; chromosomal rearrangement, nucleotide-bindin 99.92
3mtl_A 324 Cell division protein kinase 16; pctaire1, indirub 99.92
2xrw_A 371 Mitogen-activated protein kinase 8; transcription, 99.92
2fst_X 367 Mitogen-activated protein kinase 14; active mutant 99.92
1csn_A 298 Casein kinase-1; phosphotransferase; HET: ATP; 2.0 99.92
2eva_A 307 TAK1 kinase - TAB1 chimera fusion protein; transfe 99.92
2x7f_A 326 TRAF2 and NCK-interacting protein kinase; serine/t 99.92
2vwi_A 303 Serine/threonine-protein kinase OSR1; STE kinase, 99.92
2clq_A 295 Mitogen-activated protein kinase kinase kinase 5; 99.92
4azs_A 569 Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15 99.92
2yfx_A 327 Tyrosine-protein kinase receptor; nucleotide-bindi 99.92
3cc6_A 281 Protein tyrosine kinase 2 beta; focal adhesion kin 99.92
3g2f_A 336 Bone morphogenetic protein receptor type-2; kinase 99.92
2wtk_C 305 Serine/threonine-protein kinase 11; transferase-me 99.92
3nsz_A 330 CK II alpha, casein kinase II subunit alpha; inhib 99.92
2pzi_A 681 Probable serine/threonine-protein kinase PKNG; ATP 99.91
3com_A 314 Serine/threonine-protein kinase 4; MST1, STE20-lik 99.91
3qyz_A 364 Mitogen-activated protein kinase 1; transferase, s 99.91
1blx_A 326 Cyclin-dependent kinase 6; inhibitor protein, cycl 99.91
4exu_A 371 Mitogen-activated protein kinase 13; P38 kinase, t 99.91
2wei_A 287 Calmodulin-domain protein kinase 1, putative; nucl 99.91
2j7t_A 302 Serine/threonine-protein kinase 10; transferase, A 99.91
3lzb_A 327 Epidermal growth factor receptor; epidermal growth 99.91
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.91
2v62_A 345 Serine/threonine-protein kinase VRK2; transferase, 99.91
1j1b_A 420 Glycogen synthase kinase-3 beta; complex, TAU, AMP 99.91
1byg_A278 CSK, protein (C-terminal SRC kinase); protein kina 99.91
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.91
2i6l_A 320 Mitogen-activated protein kinase 6; MAPK6, ERK3, e 99.91
2b9h_A 353 MAP kinase FUS3, mitogen-activated protein kinase 99.91
3ll6_A 337 Cyclin G-associated kinase; transferase, protein k 99.91
2iwi_A 312 Serine/threonine-protein kinase PIM-2; nucleotide- 99.91
3coi_A 353 Mitogen-activated protein kinase 13; P38D, P38delt 99.91
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.91
3cek_A 313 Dual specificity protein kinase TTK; HMPS1, PYT, E 99.91
3kvw_A 429 DYRK2, dual specificity tyrosine-phosphorylation-r 99.91
4e7w_A 394 Glycogen synthase kinase 3; GSK3, PTyr195, transfe 99.91
3q60_A 371 ROP5B; pseudokinase, transferase; HET: ATP; 1.72A 99.91
2jii_A 352 Serine/threonine-protein kinase VRK3 molecule: VA 99.91
3a99_A 320 Proto-oncogene serine/threonine-protein kinase PI; 99.91
3m2w_A 299 MAP kinase-activated protein kinase 2; small molec 99.91
3e3p_A 360 Protein kinase, putative glycogen synthase kinase; 99.91
2y4i_B 319 KSR2, HKSR2, kinase suppressor of RAS 2; transfera 99.91
3rgf_A 405 Cyclin-dependent kinase 8; protein kinase complex, 99.91
3fhr_A 336 MAP kinase-activated protein kinase 3; kinase-inhi 99.91
1u46_A 291 ACK-1, activated CDC42 kinase 1; tyrosine kinase, 99.91
2j0j_A 656 Focal adhesion kinase 1; cell migration, FERM, tra 99.91
1z57_A 339 Dual specificity protein kinase CLK1; protein tyro 99.91
4hgt_A 296 Casein kinase I isoform delta; CK1D, inhibitor, tr 99.9
3aln_A 327 Dual specificity mitogen-activated protein kinase; 99.9
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.9
3sv0_A 483 Casein kinase I-like; typical kinase domain fold, 99.9
3uzp_A 296 CKI-delta, CKID, casein kinase I isoform delta; CK 99.9
1wak_A 397 Serine/threonine-protein kinase SPRK1; SRPK, trans 99.9
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.9
2dyl_A 318 Dual specificity mitogen-activated protein kinase 99.9
2rio_A 434 Serine/threonine-protein kinase/endoribonuclease I 99.9
3p23_A 432 Serine/threonine-protein kinase/endoribonuclease; 99.89
2eu9_A 355 Dual specificity protein kinase CLK3; kinase domai 99.89
2vx3_A 382 Dual specificity tyrosine-phosphorylation- regula 99.89
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.89
3qa8_A 676 MGC80376 protein; kinase ubiquitin-like domain, ph 99.89
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.89
3en9_A540 Glycoprotease, O-sialoglycoprotein endopeptidase/p 99.89
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.89
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.89
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.89
1q8y_A 373 SR protein kinase; transferase; HET: ADP ADE; 2.05 99.88
1zar_A282 RIO2 kinase; serine kinase, winged-helix, RIO doma 99.88
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.87
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.87
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.86
3dzo_A 413 Rhoptry kinase domain; parasitic disease, transfer 99.86
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.85
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.85
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.85
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 99.85
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.85
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.85
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.85
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.85
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.84
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.84
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.84
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.84
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.84
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.84
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.84
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.83
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 99.83
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.83
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.83
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.83
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.83
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.83
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.83
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.83
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.83
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 99.83
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.82
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.82
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.82
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.82
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.82
1zth_A258 RIO1 serine protein kinase; ribosome biogenesis, r 99.82
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.81
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.81
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.81
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.81
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.81
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.81
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.81
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.81
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.8
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.8
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.8
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.8
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.8
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 99.8
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.8
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.79
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.79
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 99.79
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 99.79
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.79
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.79
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.79
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.79
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.78
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.78
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.78
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.78
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.78
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.77
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.77
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.77
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.77
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.77
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 99.76
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.76
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.76
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.76
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.75
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.74
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.74
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.74
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.73
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.73
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.73
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.73
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.73
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.73
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.73
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.72
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 99.72
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.72
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.71
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.71
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.7
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.7
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 99.7
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.7
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.7
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.69
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.69
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.69
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.69
4gyi_A 397 RIO2 kinase; protein kinase, ADP complex, phosphoa 99.68
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.68
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.68
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.67
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.67
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.67
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.65
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.65
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 99.64
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.64
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.63
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.62
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.61
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.61
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.6
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.59
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.59
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.59
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.56
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.53
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.53
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.53
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.49
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.48
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 99.46
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 99.43
3tm0_A263 Aminoglycoside 3'-phosphotransferase; protein kina 99.32
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.31
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.22
1nd4_A264 Aminoglycoside 3'-phosphotransferase; protein kina 99.22
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.13
3dxp_A359 Putative acyl-COA dehydrogenase; protein kinase-li 99.12
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.1
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.05
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 98.95
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.88
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 98.84
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 98.75
3r70_A320 Aminoglycoside phosphotransferase; structural geno 98.71
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.65
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.65
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.63
3sg8_A304 APH(2'')-ID; antibiotic resistance enzyme, transfe 98.61
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.6
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.55
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.53
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.51
3tdw_A306 Gentamicin resistance protein; kinase, phosphoryl 98.48
3d1u_A288 Putative fructosamine-3-kinase; YP_290396.1, struc 98.45
4gkh_A272 Aminoglycoside 3'-phosphotransferase APHA1-IAB; py 98.44
3ovc_A 362 Hygromycin-B 4-O-kinase; aminoglycoside phosphotra 98.33
3ats_A 357 Putative uncharacterized protein; hypothetical pro 98.17
2q83_A346 YTAA protein; 2635576, structural genomics, joint 98.08
3jr1_A312 Putative fructosamine-3-kinase; YP_719053.1, struc 97.87
2olc_A 397 MTR kinase, methylthioribose kinase; kinase ADP-2H 97.84
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 97.77
2pyw_A 420 Uncharacterized protein; 5-methylthioribose kinase 97.6
3f7w_A 288 Putative fructosamine-3-kinase; YP_290396.1, struc 97.57
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.55
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.48
4gt6_A394 Cell surface protein; leucine rich repeats, putati 97.42
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.3
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 97.27
3dxq_A301 Choline/ethanolamine kinase family protein; NP_106 97.26
2ppq_A322 HSK, HK, homoserine kinase; structural genomics, M 97.25
3csv_A 333 Aminoglycoside phosphotransferase; YP_614837.1, ph 97.21
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.15
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 97.12
4gt6_A394 Cell surface protein; leucine rich repeats, putati 97.11
1zyl_A328 Hypothetical protein YIHE; putative protein kinase 97.05
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 97.01
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 96.97
1nw1_A 429 Choline kinase (49.2 KD); phospholipid synthesis, 96.92
3feg_A 379 Choline/ethanolamine kinase; non-protein kinase, c 96.76
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 96.53
2qg7_A 458 Ethanolamine kinase PV091845; malaria, SGC, struct 96.42
3c5i_A 369 Choline kinase; choline, kinase, malaria, transfer 96.27
3i1a_A339 Spectinomycin phosphotransferase; protein kinase, 96.27
3f2s_A 401 CK, chetk-alpha, choline kinase alpha; non-protein 95.44
2k1k_A38 Ephrin type-A receptor 1; EPHA1, receptor tyrosine 94.56
3mes_A 424 Choline kinase; malaria, structural genomics, stru 94.43
2ks1_B44 Epidermal growth factor receptor; ERBB1, ERBB2, tr 93.04
2l2t_A44 Receptor tyrosine-protein kinase ERBB-4; transmemb 92.91
3g15_A 401 CK, chetk-alpha, choline kinase alpha; non-protein 90.96
3cxl_A 463 N-chimerin; SH2, RHO-GAP, structural genomics cons 90.33
2jwa_A44 Receptor tyrosine-protein kinase ERBB-2; transmemb 89.38
4ano_A219 ESSB; membrane protein, membrane secretion, ESS ty 88.23
4ann_A215 ESSB; membrane protein, membrane secretion, ESS ty 86.64
>4b9d_A Serine/threonine-protein kinase NEK1; transferase, inhibitor; HET: CK7; 1.90A {Homo sapiens} PDB: 4apc_A* Back     alignment and structure
Probab=100.00  E-value=4.5e-36  Score=305.26  Aligned_cols=163  Identities=25%  Similarity=0.408  Sum_probs=139.7

Q ss_pred             cCCCccceeccCccceEEEEEE-cCCcEEEEEEccccccchHHHHHHHHHHHHhhcCCCCceeeEeeEEEeCCeEEEEEE
Q 008107          410 NSFSQEFLIGEGSLGRVYRAEF-ANGKIMAVKKIDNAALSLQEEDNFLEAVSNMSRLRHPNIVTLAGYCAEHGQRLLVYE  488 (577)
Q Consensus       410 ~~~~~~~~lg~G~fg~Vy~~~~-~~~~~vavK~~~~~~~~~~~~~~~~~e~~~l~~l~H~niv~l~~~~~~~~~~~lv~e  488 (577)
                      ++|...+.||+|+||+||+|+. .+|+.||||+++.........+.|.+|+++|++++|||||++++++.+++..|+|||
T Consensus        24 e~Y~~~~~lG~G~fg~V~~a~~~~~~~~vAiK~i~~~~~~~~~~~~~~~E~~il~~l~HpnIV~~~~~~~~~~~~yiVmE  103 (350)
T 4b9d_A           24 EKYVRLQKIGEGSFGKAILVKSTEDGRQYVIKEINISRMSSKEREESRREVAVLANMKHPNIVQYRESFEENGSLYIVMD  103 (350)
T ss_dssp             CCEEEEEEC------CEEEEEETTTCCEEEEEEEECTTSCHHHHHHHHHHHHHHHHCCCTTBCCEEEEEEETTEEEEEEE
T ss_pred             cceEEeEEEecCCCeEEEEEEECCCCCEEEEEEEehHHCCHHHHHHHHHHHHHHHHCCCCCCCcEEEEEEECCEEEEEEe
Confidence            5788999999999999999977 468999999997665556667889999999999999999999999999999999999


Q ss_pred             ecCCCCHHHhhhhccCCCCCCCHHHHHHHHHHHHHHHHHHhcCCCCCeeecCCCCCCeeeCCCCCeEEeccccCcccCCC
Q 008107          489 YVGNGNLHDMLHFADDSSKNLTWNARVRVALGTARALEYLHEVCLPSVVHRNFKSANILLDDELNPHLSDCGLAALTPNT  568 (577)
Q Consensus       489 ~~~~g~L~~~l~~~~~~~~~l~~~~~~~i~~~i~~~L~yLH~~~~~~ivHrDlk~~NILl~~~~~~kl~DFGla~~~~~~  568 (577)
                      ||++|+|.++|+.  .....+++.++..|+.||+.||+|||++   +||||||||+||||++++.+||+|||+|+.+...
T Consensus       104 y~~gg~L~~~i~~--~~~~~~~e~~~~~~~~qi~~aL~ylH~~---~IiHRDlKp~NILl~~~g~vKl~DFGla~~~~~~  178 (350)
T 4b9d_A          104 YCEGGDLFKRINA--QKGVLFQEDQILDWFVQICLALKHVHDR---KILHRDIKSQNIFLTKDGTVQLGDFGIARVLNST  178 (350)
T ss_dssp             CCTTCBHHHHHHH--TTTCCCCHHHHHHHHHHHHHHHHHHHHT---TCEETTCCGGGEEECTTCCEEECSTTEESCCCHH
T ss_pred             CCCCCcHHHHHHH--cCCCCCCHHHHHHHHHHHHHHHHHHHHC---CeeeccCCHHHEEECCCCCEEEcccccceeecCC
Confidence            9999999999963  2345678999999999999999999999   9999999999999999999999999999987654


Q ss_pred             cc--ccccCCC
Q 008107          569 ER--QVITGTS  577 (577)
Q Consensus       569 ~~--~~~~Gt~  577 (577)
                      ..  ...+|||
T Consensus       179 ~~~~~~~~GT~  189 (350)
T 4b9d_A          179 VELARACIGTP  189 (350)
T ss_dssp             HHHHHHHHSCC
T ss_pred             cccccccCCCc
Confidence            32  4567886



>3omv_A RAF proto-oncogene serine/threonine-protein kinas; serine/threonine-protein kinase, transferase; HET: SM5; 4.00A {Homo sapiens} Back     alignment and structure
>3fpq_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase, ATP-BIND kinase, nucleotide-binding, phosphoprotein; 1.80A {Rattus norvegicus} Back     alignment and structure
>4asz_A BDNF/NT-3 growth factors receptor; transferase, TRKA, TRKB; 1.70A {Homo sapiens} PDB: 4at3_A* 4at4_A* 4at5_A* 3v5q_A* Back     alignment and structure
>4aoj_A High affinity nerve growth factor receptor; transferase, inhibitor; HET: V4Z; 2.75A {Homo sapiens} Back     alignment and structure
>4aw0_A HPDK1, 3-phosphoinositide-dependent protein kinase 1; transferase, allosteric regulation, allosteric site, phosphorylation, AGC protein kinase; HET: SEP ATP MJF; 1.43A {Homo sapiens} PDB: 3hrc_A* 3hrf_A* 4a06_A* 4a07_A* 3rcj_A* 4aw1_A* 3rwq_A* 3sc1_A* 3qd0_A* 2r7b_A* 3ion_A* 3qcq_A* 3qcs_A* 3qcx_A* 3qcy_A* 3iop_A* 3qd3_A* 3qd4_A* 3h9o_A* 1uu3_A* ... Back     alignment and structure
>4gt4_A Tyrosine-protein kinase transmembrane receptor RO; ATP binding, phosphorylation, transferase; 2.41A {Homo sapiens} PDB: 3zzw_A Back     alignment and structure
>4fih_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP; 1.97A {Homo sapiens} PDB: 4fig_A* 4fif_A* 4fii_A* 4fij_A* Back     alignment and structure
>3ubd_A Ribosomal protein S6 kinase alpha-3; kinase-inhibitor complex, induced FIT, transferase-transfera inhibitor complex; HET: SL0; 1.53A {Mus musculus} PDB: 4el9_A* 3g51_A* 2z7q_A* 2z7r_A* 2z7s_A* Back     alignment and structure
>3hyh_A Carbon catabolite-derepressing protein kinase; kinase domain, transferase, ATP-binding, carbohydrate metabo kinase, membrane; 2.20A {Saccharomyces cerevisiae} PDB: 3dae_A 2fh9_A 3mn3_A Back     alignment and structure
>4fie_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP ANP; 3.11A {Homo sapiens} Back     alignment and structure
>3hmm_A TGF-beta receptor type-1; ALK5, kinase, inhibitor, quinazoline, aortic aneurysm, ATP-binding, craniosynostosis, disease mutation, disulfide bond; HET: 855; 1.70A {Homo sapiens} PDB: 1vjy_A* 3gxl_A* 3tzm_A* 2wot_A* 2wou_A* 1py5_A* 1rw8_A* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>4g3f_A NF-kappa-beta-inducing kinase; non-RD kinase, protein serine/threonine kinase, S based drug design, MAP3K14, transferase; HET: 0WB; 1.64A {Mus musculus} PDB: 4g3g_A* 4g3c_A 4dn5_A* Back     alignment and structure
>4g31_A Eukaryotic translation initiation factor 2-alpha; deletion mutant, catalytic domain, synthetic inhibitor, TRAN transferase inhibitor complex; HET: 0WH; 2.28A {Homo sapiens} PDB: 4g34_A* Back     alignment and structure
>4ase_A Vascular endothelial growth factor receptor 2; transferase, angiogenesis, signaling protein, phosphorylatio receptor, inhibitor; HET: AV9; 1.83A {Homo sapiens} PDB: 4agd_A* 4asd_A* 4agc_A* Back     alignment and structure
>4b99_A Mitogen-activated protein kinase 7; transferase, inhibitor; HET: R4L; 2.80A {Homo sapiens} Back     alignment and structure
>3v5w_A G-protein coupled receptor kinase 2; inhibitor complex, protein kinase, beta propeller, RGS homol domain; HET: 8PR; 2.07A {Homo sapiens} PDB: 3cik_A* 3krw_A* 3krx_A* 1omw_A 1ym7_A 2bcj_A* 3uzs_A 3uzt_A 3pvu_A* 3psc_A* 3pvw_A* 1bak_A Back     alignment and structure
>4f9c_A Cell division cycle 7-related protein kinase; Ser/Thr protein kinase, transferase, phosphorylation, cell C cell division, mitosis, S phase; HET: 0SX; 2.08A {Homo sapiens} PDB: 4f99_A* 4f9b_A* 4f9a_A* Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3fe3_A MAP/microtubule affinity-regulating kinase 3; serine/threonine protein kinase, MARK;PAR-1, UBA domai TAK1;P78;MARK3, ATP-binding; 1.90A {Homo sapiens} PDB: 2qnj_A 1y8g_A* 1zmw_A 1zmu_A 1zmv_A 2wzj_A 2r0i_A 2hak_A 3iec_A Back     alignment and structure
>3uim_A Brassinosteroid insensitive 1-associated receptor; kinase, protein kinase, transferase; HET: SEP TPO ANP; 2.20A {Arabidopsis thaliana} PDB: 3ulz_A* 3tl8_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4aw2_A Serine/threonine-protein kinase MRCK alpha; transferase, CDC42BPA; HET: 22E; 1.70A {Rattus norvegicus} PDB: 3tku_A* 3qfv_A* Back     alignment and structure
>3s95_A LIMK-1, LIM domain kinase 1; structural genomics, structural genomics consortium, SGC, PR kinase, transferase-antibiotic complex; HET: STU GOL; 1.65A {Homo sapiens} Back     alignment and structure
>2qkw_B Protein kinase; three-helix bundle motif, AVRPTO-PTO duplex, layered beta- sheets, transferas; HET: SEP TPO; 3.20A {Solanum pimpinellifolium} PDB: 3hgk_A* Back     alignment and structure
>3v8s_A RHO-associated protein kinase 1; dimerization, myosin, transferase, inhibitor, transf transferase inhibitor complex; HET: 0HD; 2.29A {Homo sapiens} PDB: 3twj_A* 3tv7_A* 2etr_A* 2esm_A* 2eto_A* 2etk_A* 3d9v_A* 3ncz_A* 3ndm_A* 2v55_A* 2f2u_A* 2h9v_A* Back     alignment and structure
>1o6l_A RAC-beta serine/threonine protein kinase; protein kinase, transferase, serine/threonine-protein kinase; HET: TPO ANP; 1.6A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jdo_A* 2jdr_A* 2uw9_A* 2x37_A* 2x39_A* 2xh5_A* 3d0e_A* 3e87_A* 3e88_A* 3e8d_A* 1o6k_A* 1mrv_A 1mry_A 1gzn_A 1gzk_A 1gzo_A 3qkl_A* 3ocb_A* 3ow4_A* 3qkk_A* ... Back     alignment and structure
>3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* Back     alignment and structure
>2vd5_A DMPK protein; serine/threonine-protein kinase, kinase, transferase, ATP-BI nucleotide-binding, cardiac contractility, muscle different; HET: BI8; 2.80A {Homo sapiens} Back     alignment and structure
>1fot_A TPK1 delta, CAMP-dependent protein kinase type 1; open conformation, transferase; HET: TPO; 2.80A {Saccharomyces cerevisiae} SCOP: d.144.1.7 Back     alignment and structure
>3txo_A PKC-L, NPKC-ETA, protein kinase C ETA type; phosphotransferase, transferase-transferase inhibito; HET: TPO 07U; 2.05A {Homo sapiens} Back     alignment and structure
>4fr4_A YANK1, serine/threonine-protein kinase 32A; structural genomics, structural genomics consortium, SGC, TR; HET: STU; 2.29A {Homo sapiens} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>2c30_A Serine/threonine-protein kinase PAK 6; CRIB domain, ATP-binding, transferase, nucleotide-binding; HET: SEP; 1.6A {Homo sapiens} PDB: 2f57_A* 2j0i_A* 2cdz_A* 2q0n_A* 2x4z_A* 2bva_A* Back     alignment and structure
>3niz_A Rhodanese family protein; structural genomics, structural genomics consortium, SGC, phosphotransferase, cyclin dependent kinase; HET: ADP; 2.40A {Cryptosporidium parvum} SCOP: d.144.1.7 PDB: 2qkr_A* Back     alignment and structure
>3fxz_A Serine/threonine-protein kinase PAK 1; transferase, ATP-binding, phosphorylation, allosteric enzyme, alternative splicing, apoptosis, cell junction; HET: TPO FLL; 1.64A {Homo sapiens} SCOP: d.144.1.7 PDB: 3fy0_A* 4daw_A* 3q52_A* 3q53_A* 1yhw_A 1f3m_C 1yhv_A 2hy8_1* 3q4z_A* Back     alignment and structure
>4dc2_A Protein kinase C IOTA type; kinase, substrate, cell polarity, atypical PKC, trans transferase substrate complex; HET: TPO ADE; 2.40A {Mus musculus} Back     alignment and structure
>2psq_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xr0_A Back     alignment and structure
>3qd2_B Eukaryotic translation initiation factor 2-alpha; EIF2A kinase, phosphoryalation, gene regulation; HET: TPO; 2.81A {Mus musculus} Back     alignment and structure
>3kul_A Ephrin type-A receptor 8; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase; HET: PTR; 2.15A {Homo sapiens} Back     alignment and structure
>3a8x_A Protein kinase C IOTA type; transferase; HET: TPO; 2.00A {Homo sapiens} PDB: 3a8w_A* 1zrz_A* Back     alignment and structure
>2bdw_A Hypothetical protein K11E8.1D; kinase, calmodulin activated, transferase; 1.80A {Caenorhabditis elegans} PDB: 2wel_A* 2v7o_A* 2vz6_A* 1cdm_B 1cm1_B 1cm4_B Back     alignment and structure
>2yab_A Death-associated protein kinase 2; apoptosis, transferase; HET: AMP; 1.90A {Mus musculus} PDB: 2yaa_A* 2ya9_A* Back     alignment and structure
>1xjd_A Protein kinase C, theta type; PKC-theta, ATP, AMP,, transferase; HET: TPO SEP STU; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jed_A* Back     alignment and structure
>4hcu_A Tyrosine-protein kinase ITK/TSK; transferase-transferase inhibitor complex; HET: 13L; 1.43A {Homo sapiens} PDB: 4hct_A* 4hcv_A* 3t9t_A* 1sm2_A* 1snu_A* 1snx_A 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Back     alignment and structure
>3c0i_A Peripheral plasma membrane protein CASK; neurexin, Ca2+/calmodulin dependent protein kinase, Mg synaptic plasticity, pseudokinase, maguk; HET: 3AM; 1.85A {Homo sapiens} PDB: 3c0h_A* 3c0g_A* 3mfr_A* 3mfs_A* 3mft_A 3mfu_A* 3tac_A Back     alignment and structure
>1tki_A Titin; serine kinase, muscle, autoinhibition; 2.00A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2qol_A Ephrin receptor; receptor tyrosine kinase, juxtamembrane segment, structural genomics, mutant, structural genomics consortium, SGC, ATP- binding; 1.07A {Homo sapiens} PDB: 2qok_A 2qoi_A 2qoo_A 2qof_A 2qod_A 2qo9_A* 2gsf_A 2qo7_A* 2qo2_A* 2qoq_A* 2qon_A* 3fxx_A* 3fy2_A 2qoc_A* 2qob_A* 3dzq_A* 2r2p_A 2hel_A 2rei_A 3dko_A* ... Back     alignment and structure
>4eqm_A Protein kinase; transferase; HET: ANP; 3.00A {Staphylococcus aureus subsp} Back     alignment and structure
>1rdq_E PKA C-alpha, CAMP-dependent protein kinase, alpha-catalytic SU; CAMP-dependent protein kinase,catalytic mechanism, ATP hydro two nucleotide states; HET: TPO SEP ADP ATP; 1.26A {Mus musculus} SCOP: d.144.1.7 PDB: 2erz_E* 3fjq_E* 1bkx_A* 1atp_E* 1fmo_E* 1j3h_A* 1jlu_E* 1bx6_A* 1re8_A* 1rej_A* 1rek_A* 2cpk_E* 2qcs_A* 2qvs_E* 1l3r_E* 3idb_A* 3idc_A* 3o7l_D* 3ow3_A* 3tnp_C* ... Back     alignment and structure
>3tki_A Serine/threonine-protein kinase CHK1; cell checkpoint, transferase-transferase inhib complex; HET: S25; 1.60A {Homo sapiens} PDB: 2qhm_A* 2r0u_A* 3tkh_A* 2qhn_A* 2hy0_A* 2hog_A* 2hxq_A* 2hxl_A* 3f9n_A* Back     alignment and structure
>3e7e_A HBUB1, BUB1A, mitotic checkpoint serine/threonine-protein kinas; spindle assembly checkpoint, mitosis, kinase, activation, KE CDC20, ATP-binding; HET: ATP; 2.31A {Homo sapiens} Back     alignment and structure
>3soa_A Calcium/calmodulin-dependent protein kinase type alpha with A beta 7 linker; phosphorylation, cytosolic, transferase-transferase inhibitor complex; HET: DB8; 3.55A {Homo sapiens} Back     alignment and structure
>3o0g_A Cell division protein kinase 5; kinase activator complex, kinase inhibitor complex, transferase-transferase activator complex; HET: 3O0; 1.95A {Homo sapiens} SCOP: d.144.1.7 PDB: 1unh_A* 1ung_A* 1unl_A* 1h4l_A Back     alignment and structure
>3sxs_A Cytoplasmic tyrosine-protein kinase BMX; transferase-transferase inhibitor complex; HET: PP2; 1.89A {Homo sapiens} SCOP: d.144.1.7 PDB: 3sxr_A* Back     alignment and structure
>3a62_A Ribosomal protein S6 kinase beta-1; kinase domain, inactive, active, ribosomal S6 kinase, activation, alternative initiation, ATP-binding; HET: TPO STU; 2.35A {Homo sapiens} PDB: 3a61_A* 3a60_A* Back     alignment and structure
>2i0e_A Protein kinase C-beta II; serine/threonine protein kinase, transferase; HET: TPO SEP PDS; 2.60A {Homo sapiens} PDB: 3iw4_A* Back     alignment and structure
>3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* Back     alignment and structure
>3h4j_B AMPK kdaid, SNF1-like protein kinase SSP2; ATP-binding, nucleotide-binding, phosphoprotei serine/threonine-protein kinase, transferase; 2.80A {Schizosaccharomyces pombe} Back     alignment and structure
>1ob3_A PFPK5, cell division control protein 2 homolog; transferase, serine/threonine-protein kinase, ATP-binding, phosphorylation, CDK; 1.9A {Plasmodium falciparum} SCOP: d.144.1.7 PDB: 1v0p_A* 1v0o_A* 1v0b_A Back     alignment and structure
>2y94_A 5'-AMP-activated protein kinase catalytic subunit; transferase, nucleotide-binding, staurosporine-binding, serine/threonine-protein kinase; HET: TPO STU AMP; 3.24A {Rattus norvegicus} Back     alignment and structure
>2y0a_A Death-associated protein kinase 1; transferase, calmodulin, esprit; HET: MES; 2.60A {Homo sapiens} Back     alignment and structure
>2zv2_A Calcium/calmodulin-dependent protein kinase kinas; beta, camkk2, E.C.2.7.11.17, phosphorylation, AMPKK, metabolism, binding, calmodulin-binding; HET: 609; 2.40A {Homo sapiens} Back     alignment and structure
>2r5t_A Serine/threonine-protein kinase SGK1; AGC protein kinase, apoptosis, ATP-binding, cytoplasm, endoplasmic reticulum, nucleotide-binding, nucleus; HET: ANP; 1.90A {Homo sapiens} PDB: 3hdm_A* 3hdn_A* Back     alignment and structure
>3c4z_A Rhodopsin kinase; Ser/Thr kinase, RGS homology domain, G protein coupled recep kinase, GRK, GRK1, P-loop, autophosphoryl ADP, ATP-binding; HET: ADP; 1.84A {Bos taurus} PDB: 3c4x_A* 3c4y_A 3c4w_A* 3c50_A* 3c51_A* 3qc9_A* 2i94_B Back     alignment and structure
>3gen_A Tyrosine-protein kinase BTK; bruton'S tyrosine kinase, 4-amino-5-(4-phenoxyphenyl)-5H- pyrrolo[3, 2-D]pyrimidin-7-YL-cyclopentane, TEC-family; HET: B43; 1.60A {Homo sapiens} PDB: 3k54_A* 3pj2_A* 3piy_A* 3piz_A* 3pj1_A* 3pix_A* 3pj3_A* 3p08_A 3ocs_A* 3oct_A* 1k2p_A Back     alignment and structure
>1x8b_A WEE1HU, WEE1-like protein kinase; cell cycle, transferase; HET: 824; 1.81A {Homo sapiens} PDB: 3bi6_A* 3biz_A* 3cqe_A* 3cr0_A* 2in6_A* 2io6_A* 2z2w_A* Back     alignment and structure
>2nru_A Interleukin-1 receptor-associated kinase 4; inhibitor, IRAK, transferase; HET: TPO SEP T12; 2.00A {Homo sapiens} PDB: 2nry_A* 2oib_A* 2oic_A* 2oid_A* 2o8y_A* Back     alignment and structure
>2acx_A G protein-coupled receptor kinase 6; GRK, G transferase; HET: ANP; 2.60A {Homo sapiens} PDB: 3nyn_A* 3nyo_A* Back     alignment and structure
>3soc_A Activin receptor type-2A; structural genomics consortium, SGC, transferase, protein KI; HET: GVD; 1.95A {Homo sapiens} PDB: 3q4t_A* 4asx_A* 2qlu_A* Back     alignment and structure
>1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Back     alignment and structure
>3p1a_A MYT1 kinase, membrane-associated tyrosine- and threonine-speci inhibitory kinase; structural genomics, structural genomics consortium, SGC; 1.70A {Homo sapiens} Back     alignment and structure
>1luf_A Muscle-specific tyrosine kinase receptor MUSK; phosphorylation, signal transduction, MASS spectrometry, transferase; 2.05A {Rattus norvegicus} SCOP: d.144.1.7 Back     alignment and structure
>3rp9_A Mitogen-activated protein kinase; structural genomics, structural genomics consortium, SGC, TR; 2.40A {Toxoplasma gondii} Back     alignment and structure
>3gni_B Strad alpha; kinase fold, pseudokinase, alpha helical repeat protein, ADA protein, ATP-binding, cell cycle, kinase, nucleotide-bindin nucleus; HET: ATP CIT; 2.35A {Homo sapiens} PDB: 2wtk_B* Back     alignment and structure
>1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Back     alignment and structure
>4agu_A Cyclin-dependent kinase-like 1; transferase, phospho-mimetic; HET: D15; 2.40A {Homo sapiens} Back     alignment and structure
>4euu_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: SEP BX7; 1.80A {Homo sapiens} Back     alignment and structure
>3tt0_A Basic fibroblast growth factor receptor 1; kinase domain, transferase, transferase-transferase inhibito; HET: 07J; 2.80A {Homo sapiens} Back     alignment and structure
>3vhe_A Vascular endothelial growth factor receptor 2; kinase domain, kinase, transferase-transferase inhibitor COM; HET: 42Q; 1.55A {Homo sapiens} PDB: 1y6a_A* 1y6b_A* 3vhk_A* 3vid_A* 3hng_A* Back     alignment and structure
>1t4h_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase; 1.80A {Rattus norvegicus} PDB: 3fpq_A Back     alignment and structure
>2vuw_A Serine/threonine-protein kinase haspin; cell cycle, transferase, CAsp8, nucleotide binding; HET: MSE 5ID MPD; 1.80A {Homo sapiens} PDB: 3f2n_A* 3e7v_A* 3dlz_A* 3fmd_A* 3iq7_A* 2wb8_A Back     alignment and structure
>3q4u_A Activin receptor type-1; structural genomics consortium, SGC, protein kinase, transfe; HET: LDN FLC; 1.82A {Homo sapiens} PDB: 3mtf_A* 3oom_A* 4dym_A* 3h9r_A* 3my0_A* Back     alignment and structure
>4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* Back     alignment and structure
>3uc3_A Serine/threonine-protein kinase SRK2I; SNRK2, ABA signaling, transferase; 1.90A {Arabidopsis thaliana} PDB: 3zut_A 3zuu_A 3uc4_A 3ujg_A 3udb_A Back     alignment and structure
>1kob_A Twitchin; kinase, intrasteric regulation; 2.30A {Aplysia californica} SCOP: d.144.1.7 Back     alignment and structure
>2ivs_A Proto-oncogene tyrosine-protein kinase receptor RET; nucleotide-binding, hirschsprung disease, phosphorylation, disease mutation; HET: ACK; 2.00A {Homo sapiens} PDB: 2ivt_A* 2ivu_A* 2x2k_A* 2x2l_A* 2x2m_A* 2ivv_A* Back     alignment and structure
>3ugc_A Tyrosine-protein kinase JAK2; small molecule inhibitor, ATP binding, transferase-transfera inhibitor complex; HET: 046; 1.34A {} PDB: 3krr_A* 3lpb_A* 4aqc_A* 4e4m_A* 4f08_A* 4f09_A* 3q32_A* 3rvg_A* 4hge_A* 3tjc_A* 3tjd_A* 4bbe_A* 4bbf_A* 2b7a_A* 3fup_A* 3e64_A* 3e62_A* 3e63_A* 2xa4_A* 3iok_A* ... Back     alignment and structure
>3fdn_A Serine/threonine-protein kinase 6; aurora kinase inhibitors, virtual screening, X-RAY CO- crystal analysis, structure-based drug design (SBDD); HET: MMH; 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 3k5u_A* 3m11_A* 2c6e_A* 1muo_A* 2bmc_A* 2j4z_A* 1ol6_A* 3up2_A* 3unz_A* 3uo5_A* 3uo6_A* 3uod_A* 3uoh_A* 3uoj_A* 3uok_A* 3uo4_A* 3uol_A* 3up7_A* 4dea_A* 4deb_A* ... Back     alignment and structure
>3n9x_A Phosphotransferase; malaria kinase, structural genomics, structural genomics CON SGC; 2.05A {Plasmodium berghei} PDB: 3nie_A* Back     alignment and structure
>3ork_A Serine/threonine protein kinase; structural genomics, TB structural genomics consortium, TBSG domain, signal transduction; HET: AGS; 1.60A {Mycobacterium tuberculosis} PDB: 3ori_A* 3orl_A* 3oro_A* 3orp_A* 3ort_A* 3f61_A* 1mru_A* 3f69_A* 3orm_A* 1o6y_A* 2fum_A* Back     alignment and structure
>3is5_A Calcium-dependent protein kinase; CDPK, structural genomics, parasitology, structural genomics consortium, SGC, ATP-binding, nucleotide-binding; HET: ANP; 2.55A {Toxoplasma gondii} Back     alignment and structure
>3l9p_A Anaplastic lymphoma kinase; kinase domain, ATP-binding, glycoprotein, membrane, nucleotide-binding, phosphoprotein, proto-oncogene; 1.80A {Homo sapiens} Back     alignment and structure
>2pmi_A Negative RE, cyclin-dependent protein kinase PHO85; cyclin-dependent kinase, signaling protein,transfera cycle complex; HET: MES AGS; 2.90A {Saccharomyces cerevisiae} PDB: 2pk9_A* Back     alignment and structure
>3qup_A Tyrosine-protein kinase receptor TYRO3; protein kinase inhibitor, receptor tyrosine kinase, spirocyc kinase domain, phosphotransfer, GAS6 ligand; HET: LUN; 1.90A {Mus musculus} Back     alignment and structure
>3kk8_A Calcium/calmodulin dependent protein kinase II; ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; HET: TPO; 1.72A {Caenorhabditis elegans} PDB: 3kk9_A* 3kl8_A 2vn9_A* 3bhh_A* Back     alignment and structure
>2x4f_A Myosin light chain kinase family member 4; LUNG, breast cancer, transferase, serine/threonine-protein kinase, nucleotide-binding; HET: 16X 1PE; 2.67A {Homo sapiens} Back     alignment and structure
>3dls_A PAS domain-containing serine/threonine-protein KI; PAS kinase, PASK, protein kinase, drug discovery, ATP-bindin kinase, nucleotide-binding; HET: ADP; 2.30A {Homo sapiens} Back     alignment and structure
>3dbq_A Dual specificity protein kinase TTK; MPS1 structure, kinase activation, phosphorylation, ATP- binding, nucleotide-binding, phosphoprotein; 2.70A {Homo sapiens} Back     alignment and structure
>1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Back     alignment and structure
>3kmu_A ILK, integrin-linked kinase; cell adhesion, ANK repeat, ATP-binding, cell junction, cell membrane, integrin-binding protein, membrane, nucleotide- binding; 1.80A {Homo sapiens} SCOP: d.144.1.0 PDB: 3kmw_A* 3rep_A* Back     alignment and structure
>2w4o_A Calcium/calmodulin-dependent protein kinase type IV; calmodulin-binding, nucleotide-binding, serine/threonine-protein kinase, ATP-binding; HET: DKI; 2.17A {Homo sapiens} Back     alignment and structure
>1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Back     alignment and structure
>3dtc_A Mitogen-activated protein kinase kinase kinase 9; mixed-lineage kinase, MLK family, MLK1 and MLK3 subtype selective inhibitors; HET: VIN; 2.60A {Homo sapiens} SCOP: d.144.1.0 Back     alignment and structure
>1t46_A HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcoma viral oncogene homolog; kinase, structure, inhibitor, STI-571, gleevec, transferase activator; HET: STI; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1pkg_A* 1t45_A 3g0e_A* 3g0f_A* Back     alignment and structure
>3f3z_A Calcium/calmodulin-dependent protein kinase with domain and 4 calmodulin like EF...; calcium dependent protein kinase; HET: SEP DRK; 1.84A {Cryptosporidium parvum iowa II} PDB: 2qg5_A* Back     alignment and structure
>1u5q_A Serine/threonine protein kinase TAO2; transferase; HET: SEP; 2.10A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 1u5r_A* 2gcd_A* Back     alignment and structure
>2vgo_A Serine/threonine-protein kinase 12-A; nucleotide-binding, serine/threonine-protein kinase, ATP-binding, transferase, coiled coil, cell division, kinase; HET: TPO AD5; 1.7A {Xenopus laevis} PDB: 2bfx_A* 2vgp_A* 3ztx_A* 2vrx_A* 2bfy_A* 4af3_A* 3dj6_A* 3d15_A* 3d2i_A* 3d2k_A* 3d14_A* 3dj5_A* 3dj7_A* 3daj_A* 1ol5_A* 1ol7_A* 2x6d_A* 2x6e_A* 2xng_A* 2dwb_A* ... Back     alignment and structure
>2w5a_A Serine/threonine-protein kinase NEK2; Ser/Thr protein kinase, nucleus, meiosis, mitosis, cytoplasm, metal-binding, phosphoprotein; HET: ADP; 1.55A {Homo sapiens} PDB: 2wqo_A* 2xk3_A* 2xk4_A* 2xk6_A* 2xk7_A* 2xk8_A* 2xkc_A* 2xkd_A* 2xke_A* 2xkf_A* 2xnm_A* 2xnn_A* 2xno_A* 2xnp_A* 4afe_A* 2jav_A* 2w5b_A* 2w5h_A 4a4x_A* Back     alignment and structure
>2izr_A Casein kinase I isoform gamma-3; serine/threonine-protein kinase, transferase, ATP- binding, phosphorylation, nucleotide-binding; HET: BRK; 1.3A {Homo sapiens} PDB: 2izs_A* 2izt_A* 2izu_A* 2chl_A* 2c47_A* 2cmw_A* Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Back     alignment and structure
>4aaa_A Cyclin-dependent kinase-like 2; transferase, phospho-mimetic; HET: DKI; 1.53A {Homo sapiens} PDB: 4bbm_A* Back     alignment and structure
>2rku_A Serine/threonine-protein kinase PLK1; structure of PLK1, selectivity residues, POLO-like K structure based drug design, ATP-binding; HET: R78 TLA SRT TAR; 1.95A {Homo sapiens} PDB: 2v5q_A 2yac_A* 4a4l_A* 4a4o_A* 3kb7_A* 3d5w_A* 3d5u_A* 3d5v_A 3db8_A* 3dbc_A* 3dbd_A* 3d5x_A* 3db6_A* 3dbe_A* 3dbf_A* Back     alignment and structure
>3t9t_A Tyrosine-protein kinase ITK/TSK; kinase domain, alpha/beta, ATP binding, phosphorylation, intracellular, transferase-transferase inhibitor complex; HET: IAQ; 1.65A {Homo sapiens} PDB: 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 1sm2_A* 1snu_A* 1snx_A 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Back     alignment and structure
>2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A* Back     alignment and structure
>3eqc_A Dual specificity mitogen-activated protein kinase; MEK1 kinase, ATP-binding, disease mutation, nucleoti binding, phosphoprotein; HET: 3BM AGS; 1.80A {Homo sapiens} PDB: 3eqd_A* 3eqf_A* 3eqg_A* 3eqh_A* 3eqi_A* 2y4i_C* 3eqb_A* 2p55_A* 1s9j_A* 3dy7_A* 3e8n_A* 3v01_A* 3v04_A* 3dv3_A* 3mbl_A* 3pp1_A* 3orn_A* 3os3_A* 3sls_A* 1s9i_A* ... Back     alignment and structure
>2owb_A Serine/threonine-protein kinase PLK1; catalytic domain, POLO-like kinase1, transfera; HET: 626; 2.10A {Homo sapiens} PDB: 2ou7_A* 3fc2_A* 3thb_A* Back     alignment and structure
>4eut_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: BX7; 2.60A {Homo sapiens} Back     alignment and structure
>3cok_A Serine/threonine-protein kinase PLK4; POLO-like kinase 4, SAK, STK18, PSI, structural genomics, protein structure initiative; HET: ANP; 2.25A {Homo sapiens} Back     alignment and structure
>1rjb_A FL cytokine receptor; kinase, structure, autoinhibition, juxtamembrane domain, transferase; 2.10A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>1vzo_A Ribosomal protein S6 kinase alpha 5; protein kinase, transferase, phosphorylation, serine/threonine protein kinase; 1.8A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3kfa_A Tyrosine-protein kinase ABL1; CML, drug resistance, inhibitor, ATP-binding, nucleotide-binding, oncogene, TRAN; HET: B91; 1.22A {Mus musculus} SCOP: d.144.1.7 PDB: 2qoh_A* 3kf4_A* 3k5v_A* 1fpu_A* 1m52_A* 1iep_A* 2hzn_A* 1opj_A* 3ms9_A* 3mss_A* 3ik3_A* 2z60_A* 2e2b_A* 3pyy_A* 3oxz_A* 2g1t_A* 3ue4_A* 3oy3_A* 2hiw_A* 2v7a_A* ... Back     alignment and structure
>3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Back     alignment and structure
>2pvf_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; HET: PTR ACP; 1.80A {Homo sapiens} PDB: 3cly_A* 2pzr_A* 2pzp_A* 2pvy_A* 2pz5_A* 2q0b_A* 2pwl_A* 2py3_A* 3ri1_A* 1gjo_A 1oec_A* 3b2t_A* 3gql_A* 3gqi_A* 1fgk_A 1fgi_A* 1agw_A 2fgi_A* 3js2_A* 3ky2_A ... Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Back     alignment and structure
>3oz6_A Mitogen-activated protein kinase 1, serine/threon protein kinase; structural genomics consortium, SGC, transferase; 2.37A {Cryptosporidium parvum iowa II} Back     alignment and structure
>2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Back     alignment and structure
>3fme_A Dual specificity mitogen-activated protein kinase; active mutant, structural genomics consortium, SCG, binding, nucleotide-binding, phosphoprotein; HET: STU; 2.26A {Homo sapiens} PDB: 3enm_A Back     alignment and structure
>3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A Back     alignment and structure
>3kn6_A Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1, MSK, ATP-binding, metal-binding, NUCL binding, serine/threonine-protein kinase, transferase; 2.00A {Homo sapiens} PDB: 3kn5_A Back     alignment and structure
>2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A* Back     alignment and structure
>3hko_A Calcium/calmodulin-dependent protein kinase with domain and 2 calmodulin-like EF...; structural genomics, protist parasite; HET: ANP; 1.80A {Cryptosporidium parvum iowa II} Back     alignment and structure
>2a2a_A Death-associated protein kinase 2; autoinhibition, transferase; 1.47A {Homo sapiens} PDB: 2cke_A* 1wmk_A 1z9x_A 2a27_A 2x0g_A 2xuu_A* 2w4k_A* 2xzs_A Back     alignment and structure
>2pml_X PFPK7, Ser/Thr protein kinase; phosphorylati transferase, transferase; HET: ANP; 2.60A {Plasmodium falciparum} PDB: 2pmn_X* 2pmo_X* Back     alignment and structure
>2yex_A Serine/threonine-protein kinase CHK1; transferase, cell cycle; HET: YEX; 1.30A {Homo sapiens} PDB: 2x8e_A* 2ydk_A* 2ydj_A* 2yer_A* 2ydi_A* 1nvq_A* 1nvr_A* 1nvs_A* 2wmq_A* 2wmr_A* 2wms_A* 2wmt_A* 2wmu_A* 2wmv_A* 2wmw_A* 2wmx_A* 2x8d_A* 2x8i_A* 2xey_A* 2xez_A* ... Back     alignment and structure
>4f0f_A Serine/threonine-protein kinase ROCO4; LRRK2, ATP-binding, nucleotide serine/threonine-protein kinase, transferase, signaling Pro; HET: ACP; 1.80A {Dictyostelium discoideum} PDB: 4f0g_A 4f1t_A* 4f1m_A* 4f1o_A* Back     alignment and structure
>1qpc_A LCK kinase; alpha beta fold, transferase; HET: PTR ANP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1qpe_A* 1qpj_A* 2pl0_A* 3kxz_A* 3ac1_A* 2zm4_A* 2zyb_A* 2zm1_A* 3ac2_A* 3ac3_A* 3ac4_A* 3ac5_A* 3ac8_A* 3acj_A* 3ack_A* 3ad4_A* 3ad5_A* 3ad6_A* 3kmm_A* 1qpd_A* ... Back     alignment and structure
>3ttj_A Mitogen-activated protein kinase 10; JNK3, protein kinase in transferase-transferase inhibitor complex; HET: JBI; 2.10A {Homo sapiens} PDB: 3tti_A* 1jnk_A* Back     alignment and structure
>3brb_A Proto-oncogene tyrosine-protein kinase MER; ATP-binding, disease mutation, glycoprotein, nucleot binding, phosphorylation, receptor; HET: ADP; 1.90A {Homo sapiens} PDB: 3bpr_A* 2p0c_A* Back     alignment and structure
>1p4o_A Insulin-like growth factor I receptor protein; IGF-1R, kinase domain, hormone-growth factor complex; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 1m7n_A 3lvp_A* 3lw0_A* 1jqh_A* 2zm3_A* 3f5p_A* 3i81_A* 2oj9_A* 3nw5_A* 3nw6_A* 3nw7_A* 3o23_A* 3qqu_A* 3d94_A* 1k3a_A* 2z8c_A* 1ir3_A* 1gag_A* 1irk_A 3bu3_A* ... Back     alignment and structure
>4e5w_A Tyrosine-protein kinase JAK1; kinase domain, transferase-transferase inhibit complex; HET: PTR 0NT; 1.86A {Homo sapiens} PDB: 4e4l_A* 4e4n_A* 4ehz_A* 4ei4_A* 4fk6_A* 3eyg_A* 3eyh_A* Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Back     alignment and structure
>1mp8_A Focal adhesion kinase 1; tyrosine protein kinase, transferase; HET: ADP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 2ijm_A* 2etm_A* 3pxk_A* 2jkq_A* 2j0m_B* 2jkm_A* 2j0l_A* 3bz3_A* 2jko_A* 2jkk_A* Back     alignment and structure
>3llt_A Serine/threonine kinase-1, pflammer; lammer kinase, malaria, structural GE structural genomics consortium, SGC, transferase; HET: ANP; 2.50A {Plasmodium falciparum 3D7} Back     alignment and structure
>3g33_A Cell division protein kinase 4; Ser/Thr protein kinase, cell cycle, phosphorylation, ATP-BIN cell division, disease mutation, kinase; 3.00A {Homo sapiens} Back     alignment and structure
>1cm8_A Phosphorylated MAP kinase P38-gamma; phosphorylation, transferase; HET: TPO PTR ANP; 2.40A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3og7_A AKAP9-BRAF fusion protein; proto-oncogene, V600E, kinase, transferase; HET: 032; 2.45A {Homo sapiens} SCOP: d.144.1.7 PDB: 4fk3_A* 3c4c_A* 3c4d_A* 3idp_A* 4g9r_A* 3ii5_A* 4e26_A* 3ppj_A* 3ppk_A* 3prf_A* 3pri_A* 3psb_A* 3psd_A* 3q4c_A* 3skc_A* 3tv4_A* 3tv6_A* 3d4q_A* 4e4x_A* 4g9c_A* ... Back     alignment and structure
>3gbz_A Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; 1.85A {Giardia lamblia} PDB: 3gc0_A* Back     alignment and structure
>2buj_A Serine/threonine-protein kinase 16; transferase, ATP-binding, lipoprotein, myristate, PA phosphorylation; HET: STU; 2.6A {Homo sapiens} Back     alignment and structure
>3mi9_A Cell division protein kinase 9; P-TEFB, HIV-1, protein binding; HET: TPO; 2.10A {Homo sapiens} PDB: 3mia_A* 4ec9_A* 4ec8_A* 3blh_A* 3blq_A* 3blr_A* 3lq5_A* 3my1_A* 3tn8_A* 3tnh_A* 3tni_A* 4bch_A* 4bci_A* 4bcj_A* 4bcf_A* Back     alignment and structure
>3lxl_A Tyrosine-protein kinase JAK3; TYK2, inflammation, cancer, PAN inhibitor, ATP-binding mutation, membrane, nucleotide-binding, phosphoprot SCID; HET: IZA; 1.74A {Homo sapiens} PDB: 3lxk_A* 4hvd_A* 4hvg_A* 4hvh_A* 4hvi_A* 3pjc_A* 1yvj_A* Back     alignment and structure
>3lxp_A Non-receptor tyrosine-protein kinase TYK2; JAK3, inflammation, cancer, PAN inhibitor, ATP-binding nucleotide-binding, phosphoprotein, SH2 domain; HET: PTR IZA; 1.65A {Homo sapiens} PDB: 3lxn_A* 3nz0_A* 3nyx_A* 4e20_A* 4e1z_A* Back     alignment and structure
>4fvq_A Tyrosine-protein kinase JAK2; janus protein kinase, pseudokinase, ATP binding, phosphoryla transferase; HET: ATP; 1.75A {Homo sapiens} PDB: 4fvp_A* 4fvr_A* Back     alignment and structure
>2jam_A Calcium/calmodulin-dependent protein kinase type 1G; transferase, kinase, membrane, ATP-binding, prenylation, serine/threonine-protein kinase, alternative splicing; HET: J60; 1.7A {Homo sapiens} PDB: 2jc6_A* 1a06_A Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Back     alignment and structure
>4fl3_A Tyrosine-protein kinase SYK; transferase; HET: ANP; 1.90A {Homo sapiens} PDB: 4fl2_A* 1a81_A* 1csy_A* 1csz_A* Back     alignment and structure
>3poz_A Epidermal growth factor receptor; kinase domain, anti-oncogene, ATP-binding, cell cycle, disea mutation, glycoprotein, membrane, nucleotide-binding; HET: 03P; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 2itx_A* 2ity_A* 2j5f_A* 2j6m_A* 2itw_A* 1m14_A 1m17_A* 3vjo_A* 2gs6_A* 2gs2_A* 2rf9_A 4g5j_A* 1xkk_A* 2eb2_A 3gop_A 2eb3_A* 2itn_A* 2ito_A* 2itp_A* 2itq_A* ... Back     alignment and structure
>3mdy_A Bone morphogenetic protein receptor type-1B; complex (isomerase-protein kinase), receptor serine/threonin structural genomics consortium, SGC; HET: LDN; 2.05A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3c1x_A Hepatocyte growth factor receptor; receptor tyrosine kinase, signal transduction, GRB2, SHC, ATP-binding, glycoprotein, membrane; HET: CKK; 2.17A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>1xbb_A Tyrosine-protein kinase SYK; gleevec, STI-571, imatinib, spleen typrosine kinase, active conformation, structural genomics, structural genomix; HET: STI; 1.57A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xba_A* 1xbc_A* 3fqe_A* 3fqh_A* 3fqs_A* 3emg_A* 3srv_A* 4dfl_A* 4dfn_A* 3vf8_A* 3vf9_A* Back     alignment and structure
>2y7j_A Phosphorylase B kinase gamma catalytic chain, testis/liver isoform; transferase; HET: B49; 2.50A {Homo sapiens} PDB: 1h0t_A 1lp1_B 1q2n_A 2spz_A 3mzw_B* 1ss1_A 2jwd_A 1bdc_A 1bdd_A 1fc2_C* 2b87_A 2b88_A 1h0t_B 1lp1_A 2b87_B 2b89_A 3s1k_A Back     alignment and structure
>3bhy_A Death-associated protein kinase 3; death associated kinase, DAPK3, ZIP kinase, ZIPK, DAP kinase like kinase, DLK, structural genomics consortium; HET: 7CP; 1.24A {Homo sapiens} PDB: 3bqr_A* 2j90_A* 1yrp_A* 2yak_A* 2y4p_A* 3f5u_A* 1jks_A 1jkk_A* 1ig1_A* 1jkl_A 1jkt_A 3eh9_A* 3eha_A* 3f5g_A* 1p4f_A* 1wvw_A 1wvx_A* 1wvy_A* 2w4j_A* 3dgk_A ... Back     alignment and structure
>2h6d_A 5'-AMP-activated protein kinase catalytic subunit alpha-2; ATP-binding, cholesterol biosynthesis, fatty acid biosynthesis;kinase, lipid synthesis; 1.85A {Homo sapiens} PDB: 3aqv_A* 2yza_A* Back     alignment and structure
>1mqb_A Ephrin type-A receptor 2; tyrosine protein kinase, transferase; HET: ANP; 2.30A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>1zy4_A Serine/threonine-protein kinase GCN2; translation regulator, signal transduction, acid starvation, starvation stress response; 1.95A {Saccharomyces cerevisiae} PDB: 1zy5_A* 1zyd_A* 1zyc_A* 1zxe_A Back     alignment and structure
>3f66_A Hepatocyte growth factor receptor; C-Met, protein kinase, quinoxaline, alternative splicing, ATP-binding, chromosomal rearrangement; HET: IHX; 1.40A {Homo sapiens} PDB: 3i5n_A* 3u6h_A* 3u6i_A* 4deg_A* 4deh_A* 4dei_A* 3ccn_A* 2rfn_A* 2rfs_A* 3cd8_A* 3efj_A* 3efk_A* 3lq8_A* 3zxz_A* 2wkm_A* 2wgj_A* 3zze_A* 4aoi_A* 4ap7_A* 3q6w_A* ... Back     alignment and structure
>3kex_A Receptor tyrosine-protein kinase ERBB-3; kinase domain, inactive kinase, HER3, ATP-binding, cell membrane, membrane, nucleotide-binding; HET: ANP; 2.80A {Homo sapiens} PDB: 3lmg_A* Back     alignment and structure
>3pg1_A Mitogen-activated protein kinase, putative (MAP K protein); EPK Ser/Thr protein kinase fold, Ser/Thr protein kinase, TRA; 1.95A {Leishmania major} PDB: 3uib_A* Back     alignment and structure
>2r3i_A Cell division protein kinase 2; serine/threonine-protein kinase, cell cycle, inhibition, cyclin-dependent kinase, cancer, ATP-binding; HET: SCF; 1.28A {Homo sapiens} PDB: 2r3j_A* 2r3k_A* 2r3l_A* 2r3m_A* 2r3n_A* 2r3o_A* 2r3p_A* 2r3q_A* 1jvp_P* 1buh_A 1ckp_A* 1di8_A* 1dm2_A* 1f5q_A 1fin_A* 1fq1_B* 1fvt_A* 1fvv_A* 1g5s_A* 1gih_A* ... Back     alignment and structure
>3pls_A Macrophage-stimulating protein receptor; protein kinase, CIS autophosphorylation conformation, recept tyrosine kinase, AMP-PNP, unphosphorylated; HET: ANP; 2.24A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2qr7_A Ribosomal protein S6 kinase alpha-3; kinase domain, RSK2, autoinhibitory, ATP-binding, nucleotide phosphorylation, serine/threonine-protein kinase; 2.00A {Mus musculus} PDB: 2qr8_A 4d9t_A* 4d9u_A* 3rny_A 2wnt_A Back     alignment and structure
>3a7i_A MST3 kinase, serine/threonine kinase 24 (STE20 homolog, yeast); two-LOBE protein kinase fold, ATP-binding, nucleotid binding, transferase; HET: TPO ADE; 1.45A {Homo sapiens} PDB: 3a7g_A* 3a7h_A* 3a7f_A* 3a7j_A* 3ckw_A 3ckx_A* 3ggf_A* 2xik_A* Back     alignment and structure
>3lm5_A Serine/threonine-protein kinase 17B; STK17B, serine/threonine kinase 17B, DRAK2, DAP kinase relat apoptosis-inducing protein kinase 2; HET: QUE; 2.29A {Homo sapiens} PDB: 3lm0_A* Back     alignment and structure
>2a19_B Interferon-induced, double-stranded RNA-activated kinase; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Homo sapiens} PDB: 2a1a_B* Back     alignment and structure
>1u59_A Tyrosine-protein kinase ZAP-70; transferase; HET: STU; 2.30A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2xir_A Vascular endothelial growth factor receptor 2; angiogenesis, nucleotide-binding, inhibitor, phosphorylation receptor, transferase, transmembrane; HET: 00J; 1.50A {Homo sapiens} PDB: 1vr2_A* 1ywn_A* 3vnt_A* 3c7q_A* 2oh4_A* 3u6j_A* 3efl_A* 2p2i_A* 3cjf_A* 3cjg_A* 3ewh_A* 2qu5_A* 2qu6_A* 2rl5_A* 3b8q_A* 3b8r_A* 2p2h_A* 3cp9_A* 3cpb_A* 3cpc_A* ... Back     alignment and structure
>3eb0_A Putative uncharacterized protein; kinase cryptosporidium parvum, ATP-binding, kinase, nucleoti binding; HET: PTR DRK; 2.65A {Cryptosporidium parvum iowa II} Back     alignment and structure
>2h34_A Serine/threonine-protein kinase PKNE; apoenzyme, transferase; 2.80A {Mycobacterium tuberculosis} Back     alignment and structure
>1nxk_A MAP kinase-activated protein kinase 2; MK2, phosphorylation, staurosporine, transfe; HET: STU; 2.70A {Homo sapiens} SCOP: d.144.1.7 PDB: 1kwp_A* 1ny3_A* 2onl_C Back     alignment and structure
>3uqc_A Probable conserved transmembrane protein; structural genomics, TB structural genomics consortium, TBSG fold, FHAA, transferase; 2.26A {Mycobacterium tuberculosis} PDB: 3oun_B* 3otv_A 3ouk_A Back     alignment and structure
>2ac3_A MAP kinase-interacting serine/threonine kinase 2; DFD motif, transferase; 2.10A {Homo sapiens} PDB: 2hw7_A* 2ac5_A* 2hw6_A Back     alignment and structure
>1ua2_A CAK, cell division protein kinase 7; cell cycle, phosphorylation, protein-protein interaction, PR kinase, cell cycle, transferase; HET: TPO ATP; 3.02A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} Back     alignment and structure
>3op5_A Serine/threonine-protein kinase VRK1; adenosine triphosphate, amino acid sequence, binding sites, domain, models, molecular; HET: REB; 2.40A {Homo sapiens} PDB: 2lav_A 2kty_A 2kul_A Back     alignment and structure
>3byv_A Rhoptry kinase; malaria, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} PDB: 2w1z_A Back     alignment and structure
>1fvr_A Tyrosine-protein kinase TIE-2; tyrosine kinase, transferase; 2.20A {Homo sapiens} SCOP: d.144.1.7 PDB: 2oo8_X* 2osc_A* 2p4i_A* 3l8p_A* 2wqb_A* Back     alignment and structure
>2i1m_A Macrophage colony-stimulating factor 1 receptor; kinase domain, kinase inhibitor complex, transferase; HET: 5CN; 1.80A {Homo sapiens} PDB: 3bea_A* 3lcd_A* 2i0y_A* 2i0v_A* 3dpk_A* 3krj_A* 3krl_A* 2ogv_A 3lco_A* Back     alignment and structure
>1b6c_B TGF-B superfamily receptor type I; complex (isomerase/protein kinase), receptor serine/threonine kinase; 2.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1ias_A 2x7o_A* 3faa_A* 3kcf_A* Back     alignment and structure
>1phk_A Phosphorylase kinase; glycogen metabolism, transferase, serine/threonine-protein, ATP-binding, calmodulin-binding; HET: ATP; 2.20A {Oryctolagus cuniculus} SCOP: d.144.1.7 PDB: 1ql6_A* 2phk_A* Back     alignment and structure
>2ycf_A Serine/threonine-protein kinase CHK2; transferase, anticancer, anticancer drug design; HET: YCF; 1.77A {Homo sapiens} PDB: 2yiq_A* 2w7x_A* 2ycq_A* 2ycs_A* 2w0j_A* 2yir_A* 2yit_A* 2wtj_A* 2cn8_A* 2wtc_A* 2wtd_A* 2wti_A* 2cn5_A* 2xbj_A* 2xm8_A* 2xm9_A* 2xk9_A* 2ycr_A* Back     alignment and structure
>2w1i_A JAK2; chromosomal rearrangement, nucleotide-binding, tyrosine-protein kinase, proto-oncogene, phosphoprotein, disease mutation, SH2 domain; HET: PTR L0I; 2.60A {Homo sapiens} Back     alignment and structure
>3mtl_A Cell division protein kinase 16; pctaire1, indirubin, structural genomics, structural consortium, SGC, transferase; HET: FEF; 2.40A {Homo sapiens} Back     alignment and structure
>2xrw_A Mitogen-activated protein kinase 8; transcription, MAPK signaling pathways, linear binding motif; HET: ANP; 1.33A {Homo sapiens} PDB: 1ukh_A 1uki_A* 2xs0_A* 3elj_A* 2h96_A* 2gmx_A* 2g01_A* 2no3_A* 3o2m_A* 3o17_A* 3pze_A* 3g9l_X* 2p33_A* 3cgf_A* 3cgo_A* 3g90_X* 2ok1_A* 3g9n_A* 1pmn_A* 1pmq_A* ... Back     alignment and structure
>2fst_X Mitogen-activated protein kinase 14; active mutants, lipids, MAP kinase insertion, autophosphorylation, transferase; HET: BOG; 1.45A {Homo sapiens} PDB: 2fso_X* 2fsl_X* 2fsm_X* 2npq_A* 2bal_A* 2baj_A* 2bak_A* 2baq_A* 2qd9_A* 1ian_A* 2rg5_A* 2rg6_A* 3bv2_A* 3bv3_A* 3bx5_A* 3c5u_A* 3cg2_A* 3l8x_A* 3mvl_A* 3mvm_A* ... Back     alignment and structure
>1csn_A Casein kinase-1; phosphotransferase; HET: ATP; 2.00A {Schizosaccharomyces pombe} SCOP: d.144.1.7 PDB: 1eh4_A* 2csn_A* Back     alignment and structure
>2eva_A TAK1 kinase - TAB1 chimera fusion protein; transferase/transferase activator complex; HET: ADN; 2.00A {Homo sapiens} Back     alignment and structure
>2x7f_A TRAF2 and NCK-interacting protein kinase; serine/threonine-protein kinase, phosphoprotein; HET: 824; 2.80A {Homo sapiens} Back     alignment and structure
>2vwi_A Serine/threonine-protein kinase OSR1; STE kinase, hypertension, transferase; HET: ANP; 2.15A {Homo sapiens} PDB: 3dak_A* Back     alignment and structure
>2clq_A Mitogen-activated protein kinase kinase kinase 5; transferase, metal-binding, apoptosis; HET: STU; 2.3A {Homo sapiens} Back     alignment and structure
>4azs_A Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15A {Escherichia coli} PDB: 4azt_A* 4azv_A* 4azw_A* Back     alignment and structure
>2yfx_A Tyrosine-protein kinase receptor; nucleotide-binding, transferase; HET: VGH; 1.70A {Homo sapiens} PDB: 2xp2_A* 3aox_A* 2yhv_A 3lcs_A* 3lct_A* 4dce_A* 2xba_A* 2xb7_A* Back     alignment and structure
>3cc6_A Protein tyrosine kinase 2 beta; focal adhesion kinase, structural genomics, structural genom consortium, SGC, ATP-binding, membrane; 1.60A {Homo sapiens} PDB: 3fzs_A* 3et7_A 3fzo_A* 3fzr_A* 3fzp_A* 3fzt_A* 3h3c_A* Back     alignment and structure
>3g2f_A Bone morphogenetic protein receptor type-2; kinase, structural genomics, structural genomics consortium, ATP-binding, disease mutation; HET: ADP; 2.35A {Homo sapiens} Back     alignment and structure
>2wtk_C Serine/threonine-protein kinase 11; transferase-metal-binding protein complex, transferase metal protein complex, nucleus; HET: ANP; 2.65A {Homo sapiens} Back     alignment and structure
>3nsz_A CK II alpha, casein kinase II subunit alpha; inhibitor, transferase-transferase inhibitor CO; HET: ANP; 1.30A {Homo sapiens} SCOP: d.144.1.7 PDB: 2r7i_A 3pe1_A* 1jwh_A* 3pe2_A* 3r0t_A* 3h30_A* 3q9w_A* 3q9x_A* 3q9y_A* 3q9z_A* 3qa0_A 3bqc_A* 2rkp_A* 3c13_A* 3fwq_A 3rps_A* 3u9c_A* 4fbx_A* 3mb7_A* 3mb6_A* ... Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>3com_A Serine/threonine-protein kinase 4; MST1, STE20-like kinase, PSI, structural genomics, protein structure initiative; HET: TPO; 2.20A {Homo sapiens} Back     alignment and structure
>3qyz_A Mitogen-activated protein kinase 1; transferase, serine/threonine-protein kinase, ATP-binding CE phosphorylation; HET: CME Z8B SO4; 1.46A {Rattus norvegicus} PDB: 2fys_B 1erk_A* 3qyi_A* 3erk_A* 3qyw_A* 4erk_A* 4gsb_A* 4gt3_A* 4gva_A* 2z7l_A* 2erk_A* 1gol_A* 2gph_A 3zu7_A 3zuv_A* 3o71_A 3r63_A 3c9w_A* 2y9q_A* 4fmq_A* ... Back     alignment and structure
>1blx_A Cyclin-dependent kinase 6; inhibitor protein, cyclin-dependent kinase, cell cycle control, alpha/beta, complex (inhibitor protein/kinase); 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 1bi7_A 1bi8_A 1g3n_A 2f2c_B* 1jow_B* 2euf_B* 1xo2_B* 3nup_A* 3nux_A* 2w9z_B 2w99_B 2w96_B 2w9f_B Back     alignment and structure
>4exu_A Mitogen-activated protein kinase 13; P38 kinase, transferase; 1.70A {Homo sapiens} PDB: 4eyj_A* 4eym_A* 3coi_A Back     alignment and structure
>2wei_A Calmodulin-domain protein kinase 1, putative; nucleotide-binding, serine/threonine-protein kinase, CGD3_920, transferase; HET: VGG; 1.65A {Cryptosporidium parvum iowa II} PDB: 3dfa_A 3ma6_A* Back     alignment and structure
>2j7t_A Serine/threonine-protein kinase 10; transferase, ATP-binding, cell cycle progression, phosphorylation, disease mutation, nucleotide- binding; HET: 274; 2.0A {Homo sapiens} PDB: 4aot_A* 3zz2_A* 2j51_A* 2jfl_A* 2jfm_A* 2uv2_A* Back     alignment and structure
>3lzb_A Epidermal growth factor receptor; epidermal growth factor kinase domain, multitargeted small M kinase inhibitor; HET: ITI; 2.70A {Homo sapiens} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2v62_A Serine/threonine-protein kinase VRK2; transferase, ATP-binding, membrane, nucleotide-binding, TRAN; 1.7A {Homo sapiens} Back     alignment and structure
>1j1b_A Glycogen synthase kinase-3 beta; complex, TAU, AMPPNP, transferase; HET: ANP; 1.80A {Homo sapiens} SCOP: d.144.1.7 PDB: 1i09_A* 1j1c_A* 2jld_A* 3m1s_A* 3pup_A* 3du8_A* 1pyx_A* 1q41_A* 1q3w_A* 1q3d_A* 1q4l_A* 3q3b_A* 1q5k_A* 3i4b_A* 3l1s_A* 1r0e_A* 3zrk_A* 3zrl_A* 3zrm_A* 4dit_A* ... Back     alignment and structure
>1byg_A CSK, protein (C-terminal SRC kinase); protein kinase, phosphorylation, staurosporine, transferase; HET: STU; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 3d7u_A 3d7t_A* Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>2i6l_A Mitogen-activated protein kinase 6; MAPK6, ERK3, extracellular signal regulated kinase 3, serine phosphorylation, threonine phosphorylation; 2.25A {Homo sapiens} Back     alignment and structure
>2b9h_A MAP kinase FUS3, mitogen-activated protein kinase FUS3; transferase; HET: ADP; 1.55A {Saccharomyces cerevisiae} PDB: 2b9i_A* 2b9j_A* 2f49_A 2fa2_A 2b9f_A* 2f9g_A* Back     alignment and structure
>3ll6_A Cyclin G-associated kinase; transferase, protein kinase, serine/threonine kinase, cyclin clathrine, membrane trafficking, structural genomics; 2.10A {Homo sapiens} Back     alignment and structure
>2iwi_A Serine/threonine-protein kinase PIM-2; nucleotide-binding, cancer, leukemia, transferase, ATP-binding, proto- oncogene, phosphorylation; HET: HB1; 2.80A {Homo sapiens} Back     alignment and structure
>3coi_A Mitogen-activated protein kinase 13; P38D, P38delta, ERK, MAP kinase, PMK, STK26, stress-activated protein kinase, structural genomics, PSI; 2.09A {Homo sapiens} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3cek_A Dual specificity protein kinase TTK; HMPS1, PYT, ESK, phosphotyros picked threonine kinase, SGC, structural genomics consortiu binding; HET: 7PE; 2.30A {Homo sapiens} PDB: 3gfw_A* 3h9f_A* 2x9e_A* 3hmp_A* 3hmn_A* 3hmo_A* Back     alignment and structure
>3kvw_A DYRK2, dual specificity tyrosine-phosphorylation-regulat 2; KI-(Y)-phosphorylation REG kinase 2, PSK-H2, kinase, structural genomics consortium; HET: SEP PTR IRB; 2.28A {Homo sapiens} PDB: 3k2l_A* 4azf_A* Back     alignment and structure
>4e7w_A Glycogen synthase kinase 3; GSK3, PTyr195, transferase; HET: PTR; 3.30A {Ustilago maydis} Back     alignment and structure
>3q60_A ROP5B; pseudokinase, transferase; HET: ATP; 1.72A {Toxoplasma gondii} PDB: 3q5z_A* Back     alignment and structure
>2jii_A Serine/threonine-protein kinase VRK3 molecule: VA related kinase 3; transferase, pseudo kinase domain, vaccinia related kinase, ATP-binding; 2.00A {Homo sapiens} Back     alignment and structure
>3a99_A Proto-oncogene serine/threonine-protein kinase PI; PIM-1, P27KIP1, peptide drug, prostate cancer, transferase; HET: ANP; 1.60A {Homo sapiens} PDB: 3bgq_A* 3bgp_A* 2obj_A* 3bgz_A* 3t9i_A* 3dcv_A* 1xws_A* 2xj1_A* 2xix_A* 2xiz_A* 2xj0_A* 2xiy_A* 2xj2_A* 3f2a_A* 1xr1_A* 1xqz_A* 3cy2_A* 3cxw_A* 3cy3_A* 2bik_B* ... Back     alignment and structure
>3m2w_A MAP kinase-activated protein kinase 2; small molecule inhibitor, spiroazetidine-tetracycle, ATP-SIT inhibitor, novartis compound NVP-BXS169; HET: L8I; 2.41A {Homo sapiens} PDB: 3kga_A* 3m42_A* Back     alignment and structure
>3e3p_A Protein kinase, putative glycogen synthase kinase; leishmaniasis, transferase; 2.00A {Leishmania major} Back     alignment and structure
>2y4i_B KSR2, HKSR2, kinase suppressor of RAS 2; transferase, KSR1; HET: ATP; 3.46A {Homo sapiens} Back     alignment and structure
>3rgf_A Cyclin-dependent kinase 8; protein kinase complex, transferase,transcription; HET: BAX; 2.20A {Homo sapiens} Back     alignment and structure
>3fhr_A MAP kinase-activated protein kinase 3; kinase-inhibitor complex, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; HET: P4O; 1.90A {Homo sapiens} PDB: 3fxw_A* 3r1n_A* 3she_A* 2oza_A 3fyk_X* 3fyj_X* 2p3g_X* 3ka0_A* 3fpm_A* 2pzy_A* 3a2c_A* 3kc3_A* 3gok_A* 2jbo_A* 2jbp_A* 3r2y_A* 3r30_A* 3r2b_A* Back     alignment and structure
>1u46_A ACK-1, activated CDC42 kinase 1; tyrosine kinase, transferase; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 1u4d_A* 1u54_A* 3eqr_A* 3eqp_B* Back     alignment and structure
>2j0j_A Focal adhesion kinase 1; cell migration, FERM, transferase, integrin signaling; HET: 4ST; 2.80A {Gallus gallus} PDB: 2j0k_A* Back     alignment and structure
>1z57_A Dual specificity protein kinase CLK1; protein tyrosine kinase, splicing, human, 10Z-hymendialdisine, structural genomics; HET: DBQ; 1.70A {Homo sapiens} PDB: 2vag_A* Back     alignment and structure
>4hgt_A Casein kinase I isoform delta; CK1D, inhibitor, transferase-transferase inhibitor C; HET: 15G; 1.80A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 3uzp_A* 4hnf_A* 1cki_A 1ckj_A 4hni_A* 4hok_A Back     alignment and structure
>3aln_A Dual specificity mitogen-activated protein kinase; protein AMP-PNP complex, transferase; HET: ANP; 2.30A {Homo sapiens} PDB: 3alo_A* Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3sv0_A Casein kinase I-like; typical kinase domain fold, cytosol, transferase; 2.00A {Oryza sativa japonica group} Back     alignment and structure
>3uzp_A CKI-delta, CKID, casein kinase I isoform delta; CK1D, inhibitor, PF670462, transferase-transferase I complex; HET: 0CK; 1.94A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 1cki_A 1ckj_A Back     alignment and structure
>1wak_A Serine/threonine-protein kinase SPRK1; SRPK, transferase, alternative splicing, ATP-binding, chromosome partition, differentiation, mRNA processing; 1.73A {Homo sapiens} PDB: 1wbp_A* 3beg_A* 2x7g_A* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2dyl_A Dual specificity mitogen-activated protein kinase kinase 7; MKK7, activated mutant, ATP-binding, structural genomics, NPPSFA; 2.45A {Homo sapiens} Back     alignment and structure
>2rio_A Serine/threonine-protein kinase/endoribonuclease IRE1; protein-nucleotide complex, ATP-binding, endoplasmic reticulum, glycoprotein; HET: ADP; 2.40A {Saccharomyces cerevisiae} PDB: 3lj0_A* 3lj1_A* 3lj2_A* 3fbv_A* 3sdm_A* 3sdj_A* Back     alignment and structure
>3p23_A Serine/threonine-protein kinase/endoribonuclease; kinase domain, kinase and RNAse function, ATP binding ssRNA dephosphorylated, hydrolase; HET: ADP; 2.70A {Homo sapiens} Back     alignment and structure
>2eu9_A Dual specificity protein kinase CLK3; kinase domain, transferase; 1.53A {Homo sapiens} PDB: 2wu6_A* 2wu7_A* 3raw_A* 2exe_A 3nr9_A* Back     alignment and structure
>2vx3_A Dual specificity tyrosine-phosphorylation- regula kinase 1A; serine/threonine-protein kinase, minibrain homolog, nucleotide-binding, transferase; HET: PTR D15 P6G; 2.40A {Homo sapiens} PDB: 2wo6_A* 3anq_A* 3anr_A* Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3qa8_A MGC80376 protein; kinase ubiquitin-like domain, phosphorylation, kinase domain ubiquitin-like domain, kinase, substrate binding; 3.60A {Xenopus laevis} PDB: 3qad_A* 3rzf_A* Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3en9_A Glycoprotease, O-sialoglycoprotein endopeptidase/protein kinase; endopeptidase activity, protein kinase activity; HET: TBR; 2.67A {Methanocaldococcus jannaschii} PDB: 3enh_A* 2vwb_A* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>1q8y_A SR protein kinase; transferase; HET: ADP ADE; 2.05A {Saccharomyces cerevisiae} SCOP: d.144.1.7 PDB: 1q8z_A 1q97_A* 1q99_A* 1how_A 2jd5_A Back     alignment and structure
>1zar_A RIO2 kinase; serine kinase, winged-helix, RIO domain, ADP-Mn complex, rRNA processing, transferase; HET: ADP; 1.75A {Archaeoglobus fulgidus} SCOP: a.4.5.56 d.144.1.9 PDB: 1tqi_A* 1tqp_A* 1tqm_A* 1zao_A* Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3dzo_A Rhoptry kinase domain; parasitic disease, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>1zth_A RIO1 serine protein kinase; ribosome biogenesis, rRNA, ADP, manganese, transferase; HET: ADP; 1.89A {Archaeoglobus fulgidus} PDB: 1zp9_A* 1ztf_A* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>4gyi_A RIO2 kinase; protein kinase, ADP complex, phosphoaspartate, acyl-phosphat ribosome biogenesis, Ser/Thr protein kinase; HET: PHD ADP; 2.20A {Chaetomium thermophilum} PDB: 4gyg_A Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3tm0_A Aminoglycoside 3'-phosphotransferase; protein kinase, phosphorylation, transferase-antibiotic COMP; HET: ANP B31; 2.10A {Enterococcus faecalis} SCOP: d.144.1.6 PDB: 2b0q_A* 1l8t_A* 3q2j_A* 1j7i_A* 1j7u_A* 3h8p_A* 1j7l_A* 2bkk_A* Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1nd4_A Aminoglycoside 3'-phosphotransferase; protein kinase, ATPase, kanamycin; HET: KAN; 2.10A {Klebsiella pneumoniae} SCOP: d.144.1.6 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3dxp_A Putative acyl-COA dehydrogenase; protein kinase-like fold, structural genomics, joint center structural genomics, JCSG; 2.32A {Ralstonia eutropha JMP134} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3sg8_A APH(2'')-ID; antibiotic resistance enzyme, transferase, aminoglycoside, phosphorylation, transferase-antibiotic complex; HET: TOY; 1.80A {Enterococcus casseliflavus} PDB: 3sg9_A* 3n4v_A 3n4t_A 3n4u_A 3r81_A* 3r80_A* 3r7z_A* 3r82_A* 3vcq_A* 4dbx_A 4de4_A* 4dfb_A* 4dfu_A* 4dt9_A* 4dt8_A* 4dtb_A* 3sgc_A 4dta_A* 3lzh_A Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3tdw_A Gentamicin resistance protein; kinase, phosphoryl transfer, antibiotic resistance, transfer; HET: GDP; 1.70A {Enterococcus gallinarum} PDB: 3tdv_A* Back     alignment and structure
>4gkh_A Aminoglycoside 3'-phosphotransferase APHA1-IAB; pyrazolopyrimidine, 1-Na-PP1, bumped kinase inhibitor, BKI, kinase inhibitor; HET: KAN 0J9; 1.86A {Acinetobacter baumannii} PDB: 4feu_A* 4few_A* 4fex_A* 4fev_A* 4gki_A* 4ej7_A* 3r78_A* Back     alignment and structure
>3ats_A Putative uncharacterized protein; hypothetical protein, putative aminoglycoside phosphortransf transferase; 1.67A {Mycobacterium tuberculosis} PDB: 3att_A* Back     alignment and structure
>2q83_A YTAA protein; 2635576, structural genomics, joint center for structu genomics, JCSG, protein structure initiative, PSI-2, transf; HET: ADN CIT UNL; 2.50A {Bacillus subtilis} Back     alignment and structure
>3jr1_A Putative fructosamine-3-kinase; YP_719053.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE UNL; 2.32A {Haemophilus somnus 129PT} Back     alignment and structure
>2olc_A MTR kinase, methylthioribose kinase; kinase ADP-2HO complex, transferase; HET: CPS ADP; 2.00A {Bacillus subtilis} SCOP: d.144.1.6 PDB: 2pu8_A* 2pui_A* 2pul_A* 2pun_A* 2pup_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>2pyw_A Uncharacterized protein; 5-methylthioribose kinase, plant methionine recycling, refol transferase; HET: SR1 ADP; 1.90A {Arabidopsis thaliana} Back     alignment and structure
>3f7w_A Putative fructosamine-3-kinase; YP_290396.1, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI-2; 1.85A {Thermobifida fusca YX} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3dxq_A Choline/ethanolamine kinase family protein; NP_106042.1, STR genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: MSE; 2.55A {Mesorhizobium loti} Back     alignment and structure
>2ppq_A HSK, HK, homoserine kinase; structural genomics, MCSG, PSI-2, protein structure initiative; 2.00A {Agrobacterium tumefaciens str} SCOP: d.144.1.6 Back     alignment and structure
>3csv_A Aminoglycoside phosphotransferase; YP_614837.1, phosphotransferase enzyme family, structural genomics, JOIN for structural genomics, JCSG; HET: MSE; 2.15A {Silicibacter SP} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>1zyl_A Hypothetical protein YIHE; putative protein kinase, structural genomics, PSI, protein structure initiative; 2.80A {Escherichia coli} SCOP: d.144.1.6 Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>1nw1_A Choline kinase (49.2 KD); phospholipid synthesis, protein kinase fold, transferase; 2.02A {Caenorhabditis elegans} SCOP: d.144.1.8 Back     alignment and structure
>3feg_A Choline/ethanolamine kinase; non-protein kinase, choline kinase, structural genomics CONS SGC, hemicholinium-3, phosphorylation; HET: HC7 ADP AMP; 1.30A {Homo sapiens} PDB: 3lq3_A* 2ig7_A* Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>2qg7_A Ethanolamine kinase PV091845; malaria, SGC, structural genomics consortium, transferase; 2.41A {Plasmodium vivax} Back     alignment and structure
>3c5i_A Choline kinase; choline, kinase, malaria, transferase, structural genomics, structural genomics consortium; 2.20A {Plasmodium knowlesi} PDB: 3fi8_A* Back     alignment and structure
>3i1a_A Spectinomycin phosphotransferase; protein kinase, aminoglycoside phosphotransferase, antibiotic resistance; HET: MES PG4; 1.70A {Legionella pneumophila} PDB: 3i0q_A* 3i0o_A* 3q2m_A* Back     alignment and structure
>2k1k_A Ephrin type-A receptor 1; EPHA1, receptor tyrosine kinase, dimeric transmembrane domain, ATP-binding, glycoprotein, nucleotide-binding; NMR {Homo sapiens} PDB: 2k1l_A Back     alignment and structure
>3mes_A Choline kinase; malaria, structural genomics, structural genomics consortium, SGC, transferase; HET: ADP DME PT3; 2.35A {Cryptosporidium parvum} Back     alignment and structure
>2ks1_B Epidermal growth factor receptor; ERBB1, ERBB2, transmembrane, heterodimer, complex, tyrosine receptor, bicelles, transferase; NMR {Homo sapiens} Back     alignment and structure
>2l2t_A Receptor tyrosine-protein kinase ERBB-4; transmembrane dimer, membrane domain, membrane protei; NMR {Homo sapiens} Back     alignment and structure
>3g15_A CK, chetk-alpha, choline kinase alpha; non-protein kinase, structural genomics CONS SGC, hemicholinium-3, transferase; HET: ADP HC6; 1.70A {Homo sapiens} PDB: 3f2r_A* 2i7q_A 2cko_A 2ckp_A* 2ckq_A* Back     alignment and structure
>3cxl_A N-chimerin; SH2, RHO-GAP, structural genomics consortium, SGC, gtpas activation, metal-binding, phorbol-ester binding, SH2 domai finger; 2.60A {Homo sapiens} PDB: 1xa6_A Back     alignment and structure
>2jwa_A Receptor tyrosine-protein kinase ERBB-2; transmembrane helix dimer, protein kinase receptor membrane domain, ATP-binding, glycoprotein; NMR {Homo sapiens} PDB: 2ks1_A Back     alignment and structure
>4ano_A ESSB; membrane protein, membrane secretion, ESS type V secretion S; HET: MSE; 1.70A {Geobacillus thermodenitrificans ng80-2organism_taxid} Back     alignment and structure
>4ann_A ESSB; membrane protein, membrane secretion, ESS type VII secretion virulence; 1.05A {Staphylococcus aureus subsp} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 577
d1uwha_ 276 d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) 2e-40
d1qpca_ 272 d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Hom 4e-40
d1s9ja_ 322 d.144.1.7 (A:) Dual specificity mitogen-activated 1e-38
d2java1269 d.144.1.7 (A:3-271) Serine/threonine-protein kinas 2e-37
d1jpaa_ 299 d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mou 3e-37
d1k2pa_258 d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Hum 5e-37
d1u5ra_ 309 d.144.1.7 (A:) Serine/threonine protein kinase TAO 1e-36
d1sm2a_263 d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Hu 2e-36
d1u59a_ 285 d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Hum 6e-36
d1t46a_ 311 d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens 7e-36
d2jfla1 288 d.144.1.7 (A:21-308) STE20-like serine/threonine-p 8e-36
d1byga_262 d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) 1e-35
d1vjya_ 303 d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human 1e-35
d1xbba_ 277 d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human 2e-35
d1rjba_325 d.144.1.7 (A:) Fl cytokine receptor {Human (Homo s 4e-35
d1fmka3 285 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human 4e-35
d1lufa_301 d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus n 8e-35
d1opja_ 287 d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mou 1e-34
d2j4za1263 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aur 1e-34
d1t4ha_270 d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sa 2e-34
d1nvra_ 271 d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 { 7e-33
d1omwa3 364 d.144.1.7 (A:186-549) G-protein coupled receptor k 8e-33
d1mqba_ 283 d.144.1.7 (A:) epha2 receptor tyrosine kinase {Hum 3e-32
d1fvra_ 309 d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [ 3e-32
d1r0pa_ 311 d.144.1.7 (A:) Hepatocyte growth factor receptor, 3e-32
d1u46a_273 d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Hum 4e-32
d1uu3a_ 288 d.144.1.7 (A:) 3-phosphoinositide dependent protei 4e-32
d1koaa2 350 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {C 6e-32
d1koba_ 352 d.144.1.7 (A:) Twitchin, kinase domain {California 2e-31
d1mp8a_ 273 d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Huma 4e-31
d1yhwa1 293 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [ 7e-31
d1ywna1 299 d.144.1.7 (A:818-1166) Vascular endothelial growth 2e-30
d1ob3a_ 286 d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmod 4e-30
d1p4oa_ 308 d.144.1.7 (A:) Insulin-like growth factor 1 recept 1e-29
d1phka_ 277 d.144.1.7 (A:) gamma-subunit of glycogen phosphory 2e-29
d1a06a_ 307 d.144.1.7 (A:) Calmodulin-dependent protein kinase 3e-29
d1xkka_ 317 d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb- 3e-29
d1fota_ 316 d.144.1.7 (A:) cAMP-dependent PK, catalytic subuni 1e-28
d1fgka_ 299 d.144.1.7 (A:) Fibroblast growth factor receptor 1 2e-28
d1q5ka_ 350 d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gs 2e-28
d1gz8a_ 298 d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (H 3e-28
d1xjda_ 320 d.144.1.7 (A:) Protein kinase C, theta type {Human 3e-28
d1tkia_ 321 d.144.1.7 (A:) Titin, kinase domain {Human (Homo s 5e-28
d1ua2a_ 299 d.144.1.7 (A:) Cell division protein kinase 7, CDK 2e-26
d1pmea_ 345 d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapien 2e-26
d1o6ya_ 277 d.144.1.7 (A:) Mycobacterial protein kinase PknB, 7e-26
d2ozaa1 335 d.144.1.7 (A:51-385) MAP kinase activated protein 2e-25
d1jksa_ 293 d.144.1.7 (A:) Death-associated protein kinase, Da 4e-25
d1cm8a_ 346 d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo s 2e-24
d1blxa_ 305 d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (H 2e-24
d1xwsa_273 d.144.1.7 (A:) Proto-oncogene serine/threonine-pro 2e-24
d1rdqe_ 350 d.144.1.7 (E:) cAMP-dependent PK, catalytic subuni 2e-24
d1unla_ 292 d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (H 3e-24
d1o6la_ 337 d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sap 1e-23
d3blha1 318 d.144.1.7 (A:8-325) Cell division protein kinase 9 4e-23
d3bqca1 328 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subu 5e-23
d1csna_ 293 d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast 7e-23
d1ckia_ 299 d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus n 4e-22
d1vzoa_ 322 d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5 1e-21
d2gfsa1 348 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sa 9e-21
d2b1pa1 355 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3 1e-20
d1zara2191 d.144.1.9 (A:91-281) Rio2 serine protein kinase C- 3e-18
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 1e-16
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 5e-09
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 1e-08
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-07
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 4e-04
d1q8ya_ 362 d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces 1e-15
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 3e-14
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 7e-12
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-07
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-04
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-04
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 5e-04
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-10
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-10
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 8e-05
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 7e-09
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 5e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-08
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-08
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-07
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 4e-07
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 5e-06
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 4e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-04
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 8e-08
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 1e-05
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 3e-04
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 0.002
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 1e-07
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 1e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 4e-07
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 6e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 5e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.002
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 4e-07
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 4e-05
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 3e-04
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 2e-06
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 3e-05
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 6e-05
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 3e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.004
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 7e-05
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 4e-04
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 5e-04
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.004
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 1e-04
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 0.002
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 3e-04
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 0.002
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 7e-04
>d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 276 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: B-Raf kinase
species: Human (Homo sapiens) [TaxId: 9606]
 Score =  145 bits (368), Expect = 2e-40
 Identities = 44/160 (27%), Positives = 72/160 (45%), Gaps = 9/160 (5%)

Query: 417 LIGEGSLGRVYRAEFANGKIMAVKKIDNAALSLQEEDNFLEAVSNMSRLRHPNIVTLAGY 476
            IG GS G VY+ ++     +AVK ++  A + Q+   F   V  + + RH NI+   GY
Sbjct: 15  RIGSGSFGTVYKGKWHGD--VAVKMLNVTAPTPQQLQAFKNEVGVLRKTRHVNILLFMGY 72

Query: 477 CAEHGQRLLVYEYVGNGNLHDMLHFADDSSKNLTWNARVRVALGTARALEYLHEVCLPSV 536
                Q  +V ++    +L+  LH              + +A  TA+ ++YLH     S+
Sbjct: 73  S-TAPQLAIVTQWCEGSSLYHHLH---IIETKFEMIKLIDIARQTAQGMDYLHA---KSI 125

Query: 537 VHRNFKSANILLDDELNPHLSDCGLAALTPNTERQVITGT 576
           +HR+ KS NI L ++L   + D GLA +            
Sbjct: 126 IHRDLKSNNIFLHEDLTVKIGDFGLATVKSRWSGSHQFEQ 165


>d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Length = 272 Back     information, alignment and structure
>d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 Back     information, alignment and structure
>d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Length = 269 Back     information, alignment and structure
>d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Length = 299 Back     information, alignment and structure
>d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Length = 258 Back     information, alignment and structure
>d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 309 Back     information, alignment and structure
>d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Length = 263 Back     information, alignment and structure
>d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 311 Back     information, alignment and structure
>d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Length = 262 Back     information, alignment and structure
>d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} Length = 303 Back     information, alignment and structure
>d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Length = 277 Back     information, alignment and structure
>d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 325 Back     information, alignment and structure
>d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 301 Back     information, alignment and structure
>d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Length = 287 Back     information, alignment and structure
>d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 263 Back     information, alignment and structure
>d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 270 Back     information, alignment and structure
>d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 271 Back     information, alignment and structure
>d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Length = 364 Back     information, alignment and structure
>d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 283 Back     information, alignment and structure
>d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 309 Back     information, alignment and structure
>d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Length = 311 Back     information, alignment and structure
>d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Length = 350 Back     information, alignment and structure
>d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Length = 352 Back     information, alignment and structure
>d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} Length = 286 Back     information, alignment and structure
>d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 308 Back     information, alignment and structure
>d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 277 Back     information, alignment and structure
>d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 307 Back     information, alignment and structure
>d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 317 Back     information, alignment and structure
>d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 316 Back     information, alignment and structure
>d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Length = 350 Back     information, alignment and structure
>d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} Length = 298 Back     information, alignment and structure
>d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Length = 320 Back     information, alignment and structure
>d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Length = 321 Back     information, alignment and structure
>d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} Length = 345 Back     information, alignment and structure
>d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Length = 277 Back     information, alignment and structure
>d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Length = 335 Back     information, alignment and structure
>d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} Length = 346 Back     information, alignment and structure
>d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Length = 305 Back     information, alignment and structure
>d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Length = 350 Back     information, alignment and structure
>d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} Length = 292 Back     information, alignment and structure
>d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} Length = 318 Back     information, alignment and structure
>d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Length = 328 Back     information, alignment and structure
>d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 293 Back     information, alignment and structure
>d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 299 Back     information, alignment and structure
>d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 Back     information, alignment and structure
>d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} Length = 348 Back     information, alignment and structure
>d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} Length = 355 Back     information, alignment and structure
>d1zara2 d.144.1.9 (A:91-281) Rio2 serine protein kinase C-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]} Length = 191 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 362 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query577
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 100.0
d1nvra_ 271 Cell cycle checkpoint kinase chk1 {Human (Homo sap 100.0
d2j4za1263 Aurora-related kinase 1 (aurora-2) {Human (Homo sa 100.0
d1opja_ 287 Abelsone tyrosine kinase (abl) {Mouse (Mus musculu 100.0
d2java1269 Serine/threonine-protein kinase Nek2 {Human (Homo 100.0
d1t4ha_270 Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 100.0
d1uwha_ 276 B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1s9ja_ 322 Dual specificity mitogen-activated protein kinase 100.0
d1yhwa1 293 pak1 {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1sm2a_263 Tyrosine-protein kinase Itk/Tsk {Human (Homo sapie 100.0
d1qpca_ 272 Lymphocyte kinase (lck) {Human (Homo sapiens) [Tax 100.0
d1jpaa_ 299 ephb2 receptor tyrosine kinase {Mouse (Mus musculu 100.0
d2jfla1 288 STE20-like serine/threonine-protein kinase, SLK {H 99.98
d1uu3a_ 288 3-phosphoinositide dependent protein kinase-1 Pdk1 99.98
d1u5ra_ 309 Serine/threonine protein kinase TAO2 {Rat (Rattus 99.98
d1k2pa_258 Bruton's tyrosine kinase (Btk) {Human (Homo sapien 99.97
d1xbba_ 277 Tyrosine-protein kinase SYK {Human (Homo sapiens) 99.97
d1o6la_ 337 Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9 99.97
d1koaa2 350 Twitchin, kinase domain {Caenorhabditis elegans, p 99.97
d1u59a_ 285 Tyrosine-protein kinase ZAP-70 {Human (Homo sapien 99.97
d1fota_ 316 cAMP-dependent PK, catalytic subunit {Baker's yeas 99.97
d1a06a_ 307 Calmodulin-dependent protein kinase {Rat (Rattus n 99.97
d1koba_ 352 Twitchin, kinase domain {California sea hare (Aply 99.97
d1phka_ 277 gamma-subunit of glycogen phosphorylase kinase (Ph 99.97
d1mqba_ 283 epha2 receptor tyrosine kinase {Human (Homo sapien 99.97
d1fmka3 285 c-src tyrosine kinase {Human (Homo sapiens) [TaxId 99.97
d1jksa_ 293 Death-associated protein kinase, Dap {Human (Homo 99.97
d1omwa3 364 G-protein coupled receptor kinase 2 {Cow (Bos taur 99.97
d1lufa_301 Musk tyrosine kinase {Rat (Rattus norvegicus) [Tax 99.97
d1rjba_325 Fl cytokine receptor {Human (Homo sapiens) [TaxId: 99.97
d1tkia_ 321 Titin, kinase domain {Human (Homo sapiens) [TaxId: 99.97
d1rdqe_ 350 cAMP-dependent PK, catalytic subunit {Mouse (Mus m 99.97
d1gz8a_ 298 Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [T 99.97
d1ob3a_ 286 Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) 99.97
d1xjda_ 320 Protein kinase C, theta type {Human (Homo sapiens) 99.96
d1fvra_ 309 Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} 99.96
d1ua2a_ 299 Cell division protein kinase 7, CDK7 {Human (Homo 99.96
d1p4oa_ 308 Insulin-like growth factor 1 receptor {Human (Homo 99.96
d1mp8a_ 273 Focal adhesion kinase 1 (fak) {Human (Homo sapiens 99.96
d1vjya_ 303 Type I TGF-beta receptor R4 {Human (Homo sapiens) 99.96
d1r0pa_ 311 Hepatocyte growth factor receptor, c-MET {Human (H 99.96
d1o6ya_ 277 Mycobacterial protein kinase PknB, catalytic domai 99.96
d1byga_262 Carboxyl-terminal src kinase (csk) {Human (Homo sa 99.96
d1xkka_ 317 EGF receptor tyrosine kinase, Erbb-1 {Human (Homo 99.96
d1xwsa_273 Proto-oncogene serine/threonine-protein kinase Pim 99.96
d1u46a_273 Activated CDC42 kinase 1, ACK1 {Human (Homo sapien 99.96
d1ywna1 299 Vascular endothelial growth factor receptor 2 (kdr 99.96
d2ozaa1 335 MAP kinase activated protein kinase 2, mapkap2 {Hu 99.96
d1t46a_ 311 c-KIT receptor {Human (Homo sapiens) [TaxId: 9606] 99.96
d1fgka_ 299 Fibroblast growth factor receptor 1 {Human (Homo s 99.96
d1unla_ 292 Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [T 99.96
d1cm8a_ 346 MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 99.95
d1q5ka_ 350 Glycogen synthase kinase-3 beta (Gsk3b) {Human (Ho 99.95
d3bqca1 328 Protein kinase CK2, alpha subunit {Rattus norvegic 99.95
d3blha1 318 Cell division protein kinase 9, CDK9 {Human (Homo 99.95
d1pmea_ 345 MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606 99.95
d1blxa_ 305 Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [T 99.95
d1vzoa_ 322 Ribosomal protein S6 kinase alpha 5, Msk1 {Human ( 99.95
d2gfsa1 348 MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606] 99.94
d1csna_ 293 Casein kinase-1, CK1 {Fission yeast (Schizosacchar 99.94
d2b1pa1 355 c-jun N-terminal kinase (jnk3s) {Human (Homo sapie 99.94
d1ckia_ 299 Casein kinase-1, CK1 {Rat (Rattus norvegicus) [Tax 99.93
d1zara2191 Rio2 serine protein kinase C-terminal domain {Arch 99.88
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.88
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.86
d1q8ya_ 362 Sky1p {Baker's yeast (Saccharomyces cerevisiae) [T 99.86
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.83
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.82
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.81
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.76
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.74
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.7
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.66
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.64
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.61
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.59
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.59
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.59
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.58
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.56
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.54
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.53
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.53
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.53
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.51
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.46
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.41
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.34
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.33
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.27
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.24
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.23
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.21
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.04
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.03
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 98.82
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.77
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.55
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.42
d1j7la_263 Type IIIa 3',5"-aminoglycoside phosphotransferase 98.37
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.36
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.21
d1nd4a_255 Aminoglycoside 3'-phosphotransferase IIa (Kanamyci 97.99
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.75
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.67
d2pula1 392 Methylthioribose kinase MtnK {Bacillus subtilis [T 97.5
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.99
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.96
d1zyla1325 RdoA {Escherichia coli [TaxId: 562]} 96.39
d1nw1a_ 395 Choline kinase {Caenorhabditis elegans [TaxId: 623 95.93
d2ppqa1316 Homoserine kinase ThrB {Agrobacterium tumefaciens 95.01
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
Probab=100.00  E-value=6.9e-35  Score=293.33  Aligned_cols=219  Identities=27%  Similarity=0.466  Sum_probs=174.2

Q ss_pred             CCChHHHHHHHHHHHhcCCCCCCCCCCCCCCCCCCCCCccEEeeC----CcEEEEEcCCCCCcc--cccccccCCCCCCE
Q 008107           38 TTDSSDVQALQVLYTSLNSPSVLTNWKGNEGDPCGESWKGVACEG----SAVVSIDISGLGLSG--TMGYLLSDLLSLRK  111 (577)
Q Consensus        38 ~~~~~~~~~l~~~~~~~~~~~~l~~w~~~~~~~c~~~w~gv~C~~----~~v~~l~l~~~~l~g--~~~~~~~~l~~L~~  111 (577)
                      -|.++|++||++||+++.++..+.+|.. +.|||.+.|.||+|+.    .||+.|+|++++++|  .+|+.+++|++|++
T Consensus         2 ~c~~~e~~aLl~~k~~~~~~~~l~sW~~-~~d~C~~~w~gv~C~~~~~~~~v~~L~L~~~~l~g~~~lp~~l~~L~~L~~   80 (313)
T d1ogqa_           2 LCNPQDKQALLQIKKDLGNPTTLSSWLP-TTDCCNRTWLGVLCDTDTQTYRVNNLDLSGLNLPKPYPIPSSLANLPYLNF   80 (313)
T ss_dssp             CSCHHHHHHHHHHHHHTTCCGGGTTCCT-TSCTTTTCSTTEEECCSSSCCCEEEEEEECCCCSSCEECCGGGGGCTTCSE
T ss_pred             CCCHHHHHHHHHHHHHCCCCCcCCCCCC-CCCCCCCcCCCeEEeCCCCcEEEEEEECCCCCCCCCCCCChHHhcCccccc
Confidence            4789999999999999999888999985 5799977899999985    279999999999998  57899999999999


Q ss_pred             EEccC-CCcCCcCCCCCC--CCccEEEccCCcCCCcCCCCccCCCCccEEEeccCCCcccccccccCCCCCcEEeCcCCc
Q 008107          112 FDLSG-NSIHDTIPYQLP--PNLTSLNLASNNFSGNLPYSIASMVSLSYLNVSRNSLTQSIGDIFGNLAGLATLDLSFNN  188 (577)
Q Consensus       112 L~Ls~-N~l~~~~p~~~~--~~L~~L~l~~N~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~p~~~~~l~~L~~L~Ls~N~  188 (577)
                      |||++ |+++|.+|..+.  ++|++|+|++|+|.+..|..+..+.+|+++++++|++.+.+|..+.+++.|+++++++|.
T Consensus        81 L~Ls~~N~l~g~iP~~i~~L~~L~~L~Ls~N~l~~~~~~~~~~~~~L~~l~l~~N~~~~~~p~~l~~l~~L~~l~l~~n~  160 (313)
T d1ogqa_          81 LYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIPDFLSQIKTLVTLDFSYNALSGTLPPSISSLPNLVGITFDGNR  160 (313)
T ss_dssp             EEEEEETTEESCCCGGGGGCTTCSEEEEEEECCEEECCGGGGGCTTCCEEECCSSEEESCCCGGGGGCTTCCEEECCSSC
T ss_pred             cccccccccccccccccccccccchhhhccccccccccccccchhhhcccccccccccccCchhhccCcccceeeccccc
Confidence            99997 899999998876  899999999999988888777778888888888887777777777777777777777777


Q ss_pred             ccCCCCCCccCCCCC-CeEEccCccccc-----------------------------------------------ccccC
Q 008107          189 FSGDLPNSFISLSNI-SSLYLQNNQVTG-----------------------------------------------SLNVF  220 (577)
Q Consensus       189 l~g~~p~~~~~l~~L-~~L~l~~N~l~~-----------------------------------------------~~~~~  220 (577)
                      ++|.+|..+..+.++ +.+++++|++++                                               .++.+
T Consensus       161 l~~~ip~~~~~l~~l~~~l~~~~n~l~~~~~~~~~~l~~~~l~l~~~~~~~~~~~~~~~~~~l~~l~~~~~~l~~~~~~~  240 (313)
T d1ogqa_         161 ISGAIPDSYGSFSKLFTSMTISRNRLTGKIPPTFANLNLAFVDLSRNMLEGDASVLFGSDKNTQKIHLAKNSLAFDLGKV  240 (313)
T ss_dssp             CEEECCGGGGCCCTTCCEEECCSSEEEEECCGGGGGCCCSEEECCSSEEEECCGGGCCTTSCCSEEECCSSEECCBGGGC
T ss_pred             cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
Confidence            777777666555543 455555555443                                               22222


Q ss_pred             CCCC-ccEEEeecCccccccCccccc---ccceeecCCcCC
Q 008107          221 SGLP-LTTLNVANNHFSGWIPRELIS---IRTFIYDGNSFD  257 (577)
Q Consensus       221 ~~~~-L~~L~l~~N~l~g~~p~~l~~---l~~l~~~~n~~~  257 (577)
                      ...+ |+.|+|++|+|+|.+|+++.+   ++.|++++|.+.
T Consensus       241 ~~~~~L~~L~Ls~N~l~g~iP~~l~~L~~L~~L~Ls~N~l~  281 (313)
T d1ogqa_         241 GLSKNLNGLDLRNNRIYGTLPQGLTQLKFLHSLNVSFNNLC  281 (313)
T ss_dssp             CCCTTCCEEECCSSCCEECCCGGGGGCTTCCEEECCSSEEE
T ss_pred             ccccccccccCccCeecccCChHHhCCCCCCEEECcCCccc
Confidence            2222 788888888888888887654   566778888775



>d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Back     information, alignment and structure
>d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Back     information, alignment and structure
>d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1zara2 d.144.1.9 (A:91-281) Rio2 serine protein kinase C-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j7la_ d.144.1.6 (A:) Type IIIa 3',5"-aminoglycoside phosphotransferase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nd4a_ d.144.1.6 (A:) Aminoglycoside 3'-phosphotransferase IIa (Kanamycin kinase) {Bacteria (Klebsiella pneumoniae) [TaxId: 573]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d2pula1 d.144.1.6 (A:5-396) Methylthioribose kinase MtnK {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1zyla1 d.144.1.6 (A:4-328) RdoA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nw1a_ d.144.1.8 (A:) Choline kinase {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d2ppqa1 d.144.1.6 (A:5-320) Homoserine kinase ThrB {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure