Citrus Sinensis ID: 008162


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-----
MFMLSSAARALDVLNFTPLNNKSIRIMYSHRDPSIRKSGTGNIFIKNLDKSIDHKALHDTFSSFGNILSCKIATDGSGQSKGFGFVQFENKESAQNAIDKLNGMLINDKQVFVGHFLRKQERETVAIKTKFNNVFVKNLDESTTDEDLKKIFGEYGTITSAVVMRDGDGKSKCFGFVNFENADDAAKAVEALNGKKFDDREWYVGKAQKKSEREQELKGQFEQAMKETVDKFQGLNLYIKNLGDSIDDEKLKELFSEFGTITSCKVMRDPSGISKGSGFVAFSTPEEASRALAEMNGKMIVSKPLYVAVAQRKEERRARLQAQFSQMRPVAMGPSVPPRMPMYPPGPSGLGQQFLYGQAPPAIIPPQAGFGYQQQLVPGMRPAGAPMPNFFVPVVSQGQQGQRPGGRRGAGPVQQTQQPLPIMPHQMPPRGHAYRYPLGRNMQDFPFDMGAGSMLPVPVDMGAGIPRRDASVGQPMPITALSTALANASPEQQRTLLGESLYPLVEQLERDAAAKVTGMLLEMDQTEVLHLLESPEALKAKVAEAMEVLRSVAQQQANNPADQLASLSLNENLVS
cccHHHHHHHHHHHccccccccCEEEEEccccccccccccccEEEccccccccHHHHHHHHcccccEEEEEEEEccccccccEEEEEcccHHHHHHHHHHHcccccccEEEEEEccccccHHHHHHccccccEEEEccccccccHHHHHHHHcccccccEEEEEEccccccCEEEEEEcccHHHHHHHHHHHcccccccCEEEEEcccccHHHHHHHHHHHHHHHHHHcccccccEEEEEcccccccHHHHHHHHcccccEEEEEEEEccccccccCEEEEcccHHHHHHHHHHHcccEEccEEEEEEEcccHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHcccHHHHHHHHHHcHHHHHHHcccccccccccccccccHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccc
MFMLSSAARALDVLNFTPLNNKSIRIMYSHRDPSIRKSGTGNIFIKNLDKSIDHKALHDTFSSFGNILSCKIATDGSGQSKGFGFVQFENKESAQNAIDKLNGMLINDKQVFVGHFLRKQERETVAIKTKFNNVFVKNLDESTTDEDLKKIFGEYGTITSAVVMRDGDGKSKCFGFVNFENADDAAKAVEALNGKKFDDREWYVG***********************VDKFQGLNLYIKNLGDSIDDEKLKELFSEFGTITSCKVMRDPSGISKGSGFVAFSTPEEASRALAEMNGKMIVSKPLYVAV*******************************PMYPPGPSGL***FLYGQAPPAIIPPQAGFGYQQQLV***********NFFVP****************************************************************************************************RTLLGESLYPLVEQLERDAAAKVTGMLLEMDQTEVLHLLESPEALKAKVAEAME*********************L******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFMLSSAARALDVLNFTPLNNKSIRIMYSHRDPSIRKSGTGNIFIKNLDKSIDHKALHDTFSSFGNILSCKIATDGSGQSKGFGFVQFENKESAQNAIDKLNGMLINDKQVFVGHFLRKQERETVAIKTKFNNVFVKNLDESTTDEDLKKIFGEYGTITSAVVMRDGDGKSKCFGFVNFENADDAAKAVEALNGKKFDDREWYVGKxxxxxxxxxxxxxxxxxxxxxTVDKFQGLNLYIKNLGDSIDDEKLKELFSEFGTITSCKVMRDPSGISKGSGFVAFSTPEEASRALAEMNGKMIVSKPLYVAVAQRKEERRARLQAQFSQMRPVAMGPSVPPRMPMYPPGPSGLGQQFLYGQAPPAIIPPQAGFGYQQQLVPGMRPAGAPMPNFFVPVVSQGQQGQRPGGRRGAGPVQQTQQPLPIMPHQMPPRGHAYRYPLGRNMQDFPFDMGAGSMLPVPVDMGAGIPRRDASVGQPMPITALSTALANASPEQQRTLLGESLYPLVEQLERDAAAKVTGMLLEMDQTEVLHLLESPEALKAKVAEAMEVLRSVAQQQANNPADQLASLSLNENLVS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Polyadenylate-binding protein 1-A Binds the poly(A) tail of mRNA. Appears to be an important mediator of the multiple roles of the poly(A) tail in mRNA biogenesis, stability and translation.probableQ54BM2
Polyadenylate-binding protein 1 Binds the poly(A) tail of mRNA. May be involved in cytoplasmic regulatory processes of mRNA metabolism such as pre-mRNA splicing. Its function in translational initiation regulation can either be enhanced by PAIP1 or repressed by PAIP2. Can probably bind to cytoplasmic RNA sequences other than poly(A) in vivo. Involved in translationally coupled mRNA turnover. Implicated with other RNA-binding proteins in the cytoplasmic deadenylation/translational and decay interplay of the FOS mRNA mediated by the major coding-region determinant of instability (mCRD) domain. Involved in regulation of nonsense-mediated decay (NMD) of mRNAs containing premature stop codons; for the recognition of premature termination codons (PTC) and initiation of NMD a competitive interaction between UPF1 and PABPC1 with the ribosome-bound release factors is proposed.probableQ5R8F7
Polyadenylate-binding protein 1 Binds the poly(A) tail of mRNA. May be involved in cytoplasmic regulatory processes of mRNA metabolism such as pre-mRNA splicing. Its function in translational initiation regulation can either be enhanced by PAIP1 or repressed by PAIP2. Can probably bind to cytoplasmic RNA sequences other than poly(A) in vivo. Involved in translationally coupled mRNA turnover. Implicated with other RNA-binding proteins in the cytoplasmic deadenylation/translational and decay interplay of the FOS mRNA mediated by the major coding-region determinant of instability (mCRD) domain. Involved in regulation of nonsense-mediated decay (NMD) of mRNAs containing premature stop codons; for the recognition of premature termination codons (PTC) and initiation of NMD a competitive interaction between UPF1 and PABPC1 with the ribosome-bound release factors is proposed.probableP61286

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 4F02, chain A
Confidence level:very confident
Coverage over the Query: 40-216
View the alignment between query and template
View the model in PyMOL
Template: 4F02, chain A
Confidence level:very confident
Coverage over the Query: 131-216,233-320
View the alignment between query and template
View the model in PyMOL
Template: 2GHP, chain A
Confidence level:very confident
Coverage over the Query: 1-210
View the alignment between query and template
View the model in PyMOL
Template: 1G9L, chain A
Confidence level:very confident
Coverage over the Query: 477-557
View the alignment between query and template
View the model in PyMOL
Template: 1M2V, chain B
Confidence level:probable
Coverage over the Query: 368-380
View the alignment between query and template
View the model in PyMOL