Query         008166
Match_columns 575
No_of_seqs    211 out of 651
Neff          6.3 
Searched_HMMs 46136
Date          Thu Mar 28 20:19:22 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/008166.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/008166hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG1362 Choline transporter-li 100.0 7.8E-64 1.7E-68  550.3  34.3  364  186-554   140-558 (577)
  2 PF04515 Choline_transpo:  Plas 100.0 8.1E-59 1.8E-63  486.7  27.7  289  253-541     2-329 (334)
  3 KOG1924 RhoA GTPase effector D  97.8 1.4E-05   3E-10   89.9   3.9   19  273-291   795-813 (1102)
  4 KOG1924 RhoA GTPase effector D  97.5 0.00014   3E-09   82.1   6.1   21  551-571  1046-1066(1102)
  5 PRK15319 AIDA autotransporter-  95.7   0.011 2.4E-07   73.1   5.1    9  353-361  1844-1852(2039)
  6 PHA03247 large tegument protei  94.5    0.05 1.1E-06   69.2   5.9   18  271-288  3121-3138(3151)
  7 PRK15319 AIDA autotransporter-  93.8   0.069 1.5E-06   66.4   5.0    6  136-141  1723-1728(2039)
  8 PF11081 DUF2890:  Protein of u  91.9    0.37 8.1E-06   47.0   6.2   14  142-155   121-134 (187)
  9 KOG3671 Actin regulatory prote  91.8    0.29 6.3E-06   53.8   5.7   15   99-113   403-417 (569)
 10 KOG0162 Myosin class I heavy c  91.5    0.37   8E-06   55.2   6.5   21   56-76    963-983 (1106)
 11 KOG1923 Rac1 GTPase effector F  91.4    0.33 7.3E-06   55.8   6.1    9  507-515   719-727 (830)
 12 KOG3895 Synaptic vesicle prote  91.4    0.39 8.5E-06   50.9   6.1   47   90-138   420-466 (488)
 13 COG5178 PRP8 U5 snRNP spliceos  90.6    0.18 3.8E-06   60.0   3.0   15  123-137    18-32  (2365)
 14 KOG0391 SNF2 family DNA-depend  89.6     0.5 1.1E-05   56.9   5.5   21   98-118  1895-1915(1958)
 15 PRK09752 adhesin; Provisional   89.5    0.33 7.2E-06   58.6   4.1   11  352-362  1062-1072(1250)
 16 KOG0559 Dihydrolipoamide succi  87.5     2.4 5.2E-05   45.3   8.3   18   37-54    123-140 (457)
 17 PRK15313 autotransport protein  87.4    0.81 1.8E-05   54.3   5.4   10  352-361   755-764 (955)
 18 PRK15313 autotransport protein  85.9       1 2.2E-05   53.5   5.0    7  152-158   640-646 (955)
 19 COG5178 PRP8 U5 snRNP spliceos  85.4    0.62 1.3E-05   55.7   3.0    9  288-296   235-243 (2365)
 20 KOG1830 Wiskott Aldrich syndro  82.5     4.5 9.7E-05   44.0   7.7   14   88-101   303-316 (518)
 21 KOG2391 Vacuolar sorting prote  81.3     2.3   5E-05   45.0   5.0   22   56-77    115-141 (365)
 22 KOG1785 Tyrosine kinase negati  80.0     2.7 5.9E-05   45.3   5.0    9  111-119   523-531 (563)
 23 KOG0566 Inositol-1,4,5-triphos  78.2     4.3 9.3E-05   48.2   6.3    6   71-76    992-997 (1080)
 24 KOG4849 mRNA cleavage factor I  77.8     5.2 0.00011   42.5   6.3   17   61-77    214-230 (498)
 25 KOG1922 Rho GTPase effector BN  77.5     6.7 0.00015   46.9   8.1   18   78-95    305-322 (833)
 26 PTZ00438 gamete antigen 27/25-  77.0     1.1 2.4E-05   45.7   1.1   30    9-43    102-131 (374)
 27 PRK14950 DNA polymerase III su  73.9     4.7  0.0001   46.3   5.3    9   66-74    354-362 (585)
 28 PF05750 Rubella_Capsid:  Rubel  72.8     3.4 7.3E-05   40.2   3.2    9  111-119   100-108 (300)
 29 PRK05733 single-stranded DNA-b  72.3     7.3 0.00016   37.8   5.3   38   33-71     71-111 (172)
 30 PF11179 DUF2967:  Protein of u  71.6     3.5 7.6E-05   40.2   3.0   13   48-60     89-101 (258)
 31 KOG1925 Rac1 GTPase effector F  71.2     8.4 0.00018   42.9   6.0   33    4-37    148-180 (817)
 32 PF03154 Atrophin-1:  Atrophin-  70.6      14 0.00029   44.4   7.9   15  550-564   737-751 (982)
 33 KOG0639 Transducin-like enhanc  70.0      16 0.00034   40.9   7.7   23   59-81    243-265 (705)
 34 PRK13335 superantigen-like pro  69.4     6.8 0.00015   41.5   4.7    6   42-47     85-90  (356)
 35 PHA03211 serine/threonine kina  69.1     5.5 0.00012   44.3   4.3   13  528-540   432-444 (461)
 36 KOG4849 mRNA cleavage factor I  68.7     6.5 0.00014   41.8   4.4    9   72-80    243-251 (498)
 37 KOG1925 Rac1 GTPase effector F  68.3     5.8 0.00013   44.1   4.1   14   89-102   229-242 (817)
 38 PRK13855 type IV secretion sys  67.9      15 0.00033   39.8   7.0   21   33-53     12-32  (376)
 39 PRK06863 single-stranded DNA-b  65.0      10 0.00023   36.6   4.8   44   32-75     69-112 (168)
 40 PF05518 Totivirus_coat:  Totiv  64.4      23  0.0005   41.5   8.1   11   72-82    680-690 (759)
 41 PF07462 MSP1_C:  Merozoite sur  64.4     9.1  0.0002   43.0   4.7   21   56-76    237-259 (574)
 42 PLN02983 biotin carboxyl carri  64.3      16 0.00034   37.9   6.1    9   43-51    114-122 (274)
 43 PHA03211 serine/threonine kina  64.2     7.4 0.00016   43.3   4.1    8  146-153    65-72  (461)
 44 PRK13732 single-stranded DNA-b  63.4      14  0.0003   36.0   5.3   43   33-76     72-117 (175)
 45 KOG1546 Metacaspase involved i  63.3      10 0.00022   40.2   4.6   14  122-135    50-63  (362)
 46 PRK03427 cell division protein  62.0      26 0.00056   37.5   7.4   19   37-55     61-79  (333)
 47 KOG0917 Uncharacterized conser  62.0      30 0.00064   35.9   7.4   11  187-197   322-332 (338)
 48 KOG4590 Signal transduction pr  61.8      14  0.0003   40.6   5.5    6   73-78    140-145 (409)
 49 PHA03378 EBNA-3B; Provisional   60.3      17 0.00036   42.0   5.8   11   53-63    669-679 (991)
 50 KOG4307 RNA binding protein RB  59.3      27  0.0006   40.5   7.3   23   40-62    137-159 (944)
 51 COG5373 Predicted membrane pro  58.3      20 0.00044   42.3   6.2    8  136-143   113-120 (931)
 52 KOG3397 Acetyltransferases [Ge  55.8      14 0.00031   35.9   3.8    8   39-46     85-92  (225)
 53 PF15387 DUF4611:  Domain of un  55.8     6.6 0.00014   34.1   1.4   27    6-32     48-76  (96)
 54 COG3115 ZipA Cell division pro  54.4      35 0.00076   35.9   6.6   18   56-73     75-92  (324)
 55 KOG3130 Uncharacterized conser  54.2     7.7 0.00017   42.0   1.9   30   25-54    282-311 (514)
 56 PF00558 Vpu:  Vpu protein;  In  54.0     5.2 0.00011   34.0   0.5   27    6-32     41-67  (81)
 57 PF06570 DUF1129:  Protein of u  53.8 1.8E+02   0.004   28.6  11.6   22  255-276   181-202 (206)
 58 KOG2546 Abl interactor ABI-1,   53.2      16 0.00035   40.0   4.2   23   66-90    318-340 (483)
 59 TIGR00927 2A1904 K+-dependent   53.2 1.1E+02  0.0025   37.2  11.3   13   43-55    287-299 (1096)
 60 KOG1955 Ral-GTPase effector RA  52.3      24 0.00051   39.5   5.3   11   93-103   491-501 (737)
 61 KOG3832 Predicted amino acid t  52.1     9.1  0.0002   38.3   1.9   21   60-80    107-127 (319)
 62 PF02993 MCPVI:  Minor capsid p  51.8     4.8 0.00011   40.8   0.0   10    8-17     98-107 (238)
 63 PLN00034 mitogen-activated pro  51.0      39 0.00083   35.4   6.7   17  526-542   303-319 (353)
 64 KOG3895 Synaptic vesicle prote  50.1      33 0.00072   36.9   5.8   10   89-98    400-409 (488)
 65 PF15451 DUF4632:  Domain of un  49.5     6.5 0.00014   31.5   0.4   20   15-37      6-25  (71)
 66 PTZ00415 transmission-blocking  48.8      11 0.00023   47.7   2.2   16  431-446   636-651 (2849)
 67 KOG2140 Uncharacterized conser  48.5     6.9 0.00015   43.9   0.5   27   11-37    412-438 (739)
 68 PF05297 Herpes_LMP1:  Herpesvi  47.9     6.1 0.00013   41.1   0.0   29  189-217    45-73  (381)
 69 TIGR00927 2A1904 K+-dependent   47.3     8.1 0.00018   46.4   0.9   12  206-217   938-949 (1096)
 70 PRK12270 kgd alpha-ketoglutara  47.2      41 0.00089   41.0   6.5    7    2-8       5-11  (1228)
 71 PLN03132 NADH dehydrogenase (u  47.2      14  0.0003   41.3   2.6   15  442-456   375-389 (461)
 72 PTZ00415 transmission-blocking  46.5     9.2  0.0002   48.2   1.2    8  445-452   697-704 (2849)
 73 PRK08763 single-stranded DNA-b  46.1      37  0.0008   32.7   5.0   42   33-74     70-111 (164)
 74 KOG3837 Uncharacterized conser  45.8      26 0.00056   38.4   4.3   17  111-127   177-193 (523)
 75 TIGR00859 ENaC sodium channel   45.4      27 0.00059   40.3   4.8    6   95-100   555-560 (595)
 76 PF10446 DUF2457:  Protein of u  45.3      43 0.00094   37.0   5.9    8   84-91    282-289 (458)
 77 PRK14971 DNA polymerase III su  45.1      48   0.001   38.5   6.7    8  189-196   500-507 (614)
 78 KOG2677 Stoned B synaptic vesi  43.7      63  0.0014   37.4   7.0   21   56-76     52-72  (922)
 79 KOG2199 Signal transducing ada  43.0      51  0.0011   36.0   5.9   13   98-110   413-425 (462)
 80 PF09849 DUF2076:  Uncharacteri  42.9      33 0.00072   35.2   4.4   18  162-179   147-164 (247)
 81 KOG4090 Uncharacterized conser  42.9      51  0.0011   31.3   5.2    9  102-110    20-28  (157)
 82 PF10110 GPDPase_memb:  Membran  42.1      73  0.0016   29.7   6.3   32  433-464   104-135 (149)
 83 COG3147 DedD Uncharacterized p  41.7 1.2E+02  0.0026   30.6   7.8    7   28-34     39-45  (226)
 84 TIGR01628 PABP-1234 polyadenyl  41.3      36 0.00078   38.6   4.9    7   26-32    298-304 (562)
 85 KOG1985 Vesicle coat complex C  40.5      72  0.0016   37.9   7.0    9  543-551   730-738 (887)
 86 PF10873 DUF2668:  Protein of u  39.8      53  0.0011   31.0   4.8    7   93-99    113-119 (155)
 87 PF15471 TMEM171:  Transmembran  39.7      89  0.0019   32.5   6.8   19   72-90    203-221 (319)
 88 PF14017 DUF4233:  Protein of u  39.4 2.8E+02  0.0062   24.8  10.2   49  221-278    55-103 (107)
 89 PRK13855 type IV secretion sys  39.3      43 0.00092   36.4   4.7   15  379-393   280-294 (376)
 90 PF15449 Retinal:  Retinal prot  38.7   1E+02  0.0022   37.8   7.9    6   65-70   1046-1051(1287)
 91 KOG1955 Ral-GTPase effector RA  38.4      46 0.00099   37.3   4.8   13   64-76    505-517 (737)
 92 PF07462 MSP1_C:  Merozoite sur  38.2      47   0.001   37.6   4.9    7  147-153   332-338 (574)
 93 TIGR01299 synapt_SV2 synaptic   37.9 7.8E+02   0.017   29.4  20.6   19  204-222   214-232 (742)
 94 COG5137 Histone chaperone invo  37.7      15 0.00033   36.7   1.0   21   17-37    183-203 (279)
 95 KOG1922 Rho GTPase effector BN  37.4      95  0.0021   37.3   7.8   11  443-453   716-726 (833)
 96 PF07304 SRA1:  Steroid recepto  37.1      11 0.00024   35.9   0.0    6  189-194    68-73  (157)
 97 KOG1546 Metacaspase involved i  36.9      45 0.00097   35.6   4.3   24  115-138    39-62  (362)
 98 KOG4317 Predicted Zn-finger pr  36.8      16 0.00035   38.5   1.1   30    7-37     71-109 (383)
 99 PRK14971 DNA polymerase III su  36.3      56  0.0012   38.0   5.4    6  211-216   505-510 (614)
100 TIGR01129 secD protein-export   35.7   5E+02   0.011   28.5  12.5   17  198-214   250-266 (397)
101 PF15195 TMEM210:  TMEM210 fami  35.6      45 0.00097   29.3   3.4   11   62-72     81-91  (116)
102 KOG0559 Dihydrolipoamide succi  35.1      81  0.0018   34.2   5.8   13   56-68    134-146 (457)
103 KOG2322 N-methyl-D-aspartate r  35.0 5.2E+02   0.011   26.5  12.2    6  381-386   203-208 (237)
104 PF02724 CDC45:  CDC45-like pro  34.5      22 0.00048   41.3   1.8    7  435-441   557-563 (622)
105 PF15470 DUF4637:  Domain of un  33.3      19 0.00042   33.8   0.9   20  139-158   139-158 (173)
106 PF04625 DEC-1_N:  DEC-1 protei  32.4      81  0.0018   33.5   5.3    9  369-377   334-342 (407)
107 PRK10649 hypothetical protein;  32.3   2E+02  0.0044   33.2   9.1   22  204-225    48-69  (577)
108 PRK10263 DNA translocase FtsK;  32.1      58  0.0013   40.9   4.8   10  392-401  1075-1084(1355)
109 KOG0127 Nucleolar protein fibr  31.0      26 0.00056   39.6   1.5   20   45-64    245-264 (678)
110 PTZ00249 variable surface prot  30.7      81  0.0017   35.5   5.2   45   28-79    220-266 (516)
111 KOG4454 RNA binding protein (R  30.6      44 0.00096   33.8   2.9   15   62-76    136-150 (267)
112 PRK14849 putative lipoprotein/  30.5      30 0.00066   44.4   2.2    9  353-361  1602-1610(1806)
113 PF03153 TFIIA:  Transcription   30.2      20 0.00044   38.6   0.6   18   34-51    302-319 (375)
114 KOG2153 Protein involved in th  29.6      23  0.0005   40.8   0.9   24  529-554   657-680 (704)
115 PF06409 NPIP:  Nuclear pore co  29.3      29 0.00063   35.1   1.4    8   56-63    200-207 (265)
116 KOG2141 Protein involved in hi  29.3      58  0.0013   38.2   3.9   11  411-421   653-663 (822)
117 PF14816 FAM178:  Family of unk  28.3      22 0.00048   38.6   0.5   23   49-71     74-96  (377)
118 PHA03160 hypothetical protein;  28.3      42 0.00091   37.5   2.5   10   10-19    327-336 (499)
119 KOG2181 LIM domain binding pro  27.7      96  0.0021   32.8   4.8   24   53-76    358-381 (415)
120 PF05053 Menin:  Menin;  InterP  27.4      16 0.00035   41.5  -0.8    8  138-145   559-566 (618)
121 KOG1834 Calsyntenin [Extracell  27.4      30 0.00065   39.9   1.3    6   64-69    936-941 (952)
122 PF01698 FLO_LFY:  Floricaula /  27.3      21 0.00045   38.7   0.0    8  187-194    85-92  (386)
123 KOG2652 RNA polymerase II tran  27.1      34 0.00073   36.6   1.5    8   40-47    289-296 (348)
124 PHA03356 tegument protein UL11  26.7 1.3E+02  0.0028   25.8   4.5    6   77-82     52-57  (93)
125 PF05858 BIV_Env:  Bovine immun  26.5      19 0.00041   39.3  -0.5   33   10-42      3-37  (548)
126 PHA03378 EBNA-3B; Provisional   26.5 2.1E+02  0.0045   33.6   7.5   10  130-139   778-787 (991)
127 PF05350 GSK-3_bind:  Glycogen   26.4      22 0.00047   35.3   0.0   13   17-29      8-20  (217)
128 KOG3397 Acetyltransferases [Ge  26.2      78  0.0017   31.0   3.6    6   71-76    159-164 (225)
129 KOG1984 Vesicle coat complex C  25.8 1.1E+02  0.0025   36.6   5.5   28  430-457   608-647 (1007)
130 PF10529 Hist_rich_Ca-bd:  Hist  25.8      31 0.00067   20.2   0.5    8   21-28      5-12  (15)
131 KOG4514 Uncharacterized conser  25.5      94   0.002   30.5   4.0   13    5-17      8-20  (222)
132 PRK14954 DNA polymerase III su  25.4 1.3E+02  0.0029   35.0   6.1    6  191-196   505-510 (620)
133 PF05086 Dicty_REP:  Dictyostel  24.9 1.4E+02   0.003   35.5   5.9   23  278-300   424-447 (911)
134 KOG1146 Homeobox protein [Gene  24.5 1.9E+02  0.0042   36.3   7.3   14  527-540   917-930 (1406)
135 KOG0341 DEAD-box protein abstr  24.4      33  0.0007   37.6   0.8   46  427-472   437-482 (610)
136 PF12273 RCR:  Chitin synthesis  23.8      67  0.0015   29.3   2.7    6  271-276    23-28  (130)
137 PF01698 FLO_LFY:  Floricaula /  23.8      26 0.00057   38.0   0.0   10  416-425   305-315 (386)
138 PF05399 EVI2A:  Ectropic viral  23.7 2.9E+02  0.0063   27.9   7.1   18  135-152   118-135 (227)
139 KOG4425 Uncharacterized conser  23.6 1.1E+02  0.0025   34.2   4.7    8   67-74     38-45  (900)
140 KOG3415 Putative Rab5-interact  23.6 5.7E+02   0.012   23.4   8.4   47  184-242    37-83  (129)
141 PF12868 DUF3824:  Domain of un  23.6 3.7E+02  0.0081   25.2   7.6   13   10-22     29-41  (137)
142 PF15324 TALPID3:  Hedgehog sig  22.6 1.6E+02  0.0034   36.2   5.9   22   33-54    874-895 (1252)
143 KOG2147 Nucleolar protein invo  22.5      54  0.0012   38.5   2.1   19   32-50    314-332 (823)
144 KOG3655 Drebrins and related a  22.5 1.5E+02  0.0034   33.1   5.5  119    2-132   238-363 (484)
145 PF05756 S-antigen:  S-antigen   22.2      47   0.001   28.0   1.2   11   15-25     63-73  (94)
146 PF12526 DUF3729:  Protein of u  22.0 2.1E+02  0.0045   26.0   5.3   11  121-131    88-98  (113)
147 PF15345 TMEM51:  Transmembrane  21.8 1.5E+02  0.0032   30.3   4.8   13   94-106   174-186 (233)
148 PF10669 Phage_Gp23:  Protein g  21.4      27 0.00058   30.7  -0.4   19   11-29     51-69  (121)
149 PHA03132 thymidine kinase; Pro  20.9 2.6E+02  0.0056   32.4   7.1   12  428-439   452-463 (580)
150 PTZ00163 hypothetical protein;  20.8      40 0.00088   32.2   0.6   13    2-15     67-79  (230)
151 KOG0577 Serine/threonine prote  20.6 2.3E+02  0.0049   33.2   6.4   12   70-81    391-402 (948)
152 KOG1174 Anaphase-promoting com  20.3      50  0.0011   36.6   1.2   34   10-43    509-542 (564)
153 KOG0943 Predicted ubiquitin-pr  20.3      85  0.0018   39.0   3.1   17  275-291  2115-2131(3015)
154 PRK06975 bifunctional uroporph  20.2 1.6E+02  0.0034   34.6   5.4   53   84-136   267-319 (656)
155 PF05086 Dicty_REP:  Dictyostel  20.2 1.4E+02   0.003   35.5   4.7    6   71-76    250-255 (911)
156 PF13388 DUF4106:  Protein of u  20.1   2E+02  0.0043   30.4   5.4   12  122-133   237-248 (422)
157 PHA03291 envelope glycoprotein  20.1 2.3E+02   0.005   30.7   6.0   61   73-138   196-256 (401)

No 1  
>KOG1362 consensus Choline transporter-like protein [Lipid transport and metabolism]
Probab=100.00  E-value=7.8e-64  Score=550.32  Aligned_cols=364  Identities=23%  Similarity=0.441  Sum_probs=295.9

Q ss_pred             hhhhhHHhhHHHHHHHHHHHHHHHHHHHHHHHHhhhhhHHHHHHHHHHHHHHHHHHH--Hhhcc-------CCc------
Q 008166          186 KEKRVLKYLLPQVEAASLLSISLSFSWQKAVRVWPKFMVHFILWSSFFLSLSAGILL--ICFQK-------PAT------  250 (575)
Q Consensus       186 ~~~~dl~~~~~~i~~~~~is~vls~iwl~llr~~~~~~i~~~vw~~iil~~~~~i~~--~~f~~-------~~~------  250 (575)
                      +...|+..+|+++...+.++++++++|+.++|.+++.    ++|+.+++.+...++.  .|+..       +..      
T Consensus       140 ~i~~~i~~sw~~i~~~~~~~l~~s~i~~~~lr~~~~~----l~~~~~~~~l~~l~~~~~~~~~~y~~~~~~~~~i~~~~~  215 (577)
T KOG1362|consen  140 RIFADILRSWYTILSLLGIALVLSLIFTKLLRFLAAI----LPWILIILVLVGLLSGIWFCWFLYAILRNTKVTIGFTSS  215 (577)
T ss_pred             HHHHHHHHhHHHHHhhhHHHHHHHHHHHHhHHHHHHH----HHHHHHHHHHHHHHHHHHHHHHHhhhhccccceeecchH
Confidence            3678899999999999999999999999999966654    4677666655444331  12111       100      


Q ss_pred             ------------hhHHHHHHHHHHHHHHHHHHhhhhHHHHHHHHHHHHHhhhhcCcchhhHHHHHHHHHHHHHHHHHHHH
Q 008166          251 ------------DGVGVCFIAFAIGNGLYACWVSQRIGFCCKVLIISLQPVSKFSDLNQPTYWMLGTGFLWMSFWILAVI  318 (575)
Q Consensus       251 ------------~~~~i~~ii~ai~~~ly~~~~r~RI~~ai~iLk~As~~i~~~p~l~~~~i~~~ii~~~~~~~W~~~~i  318 (575)
                                  +..+++..++.++.++|++++|+||+++++++|+|+|++.+.|+++++|++++++.++|+++|+.+.+
T Consensus       216 ~~~~~~~~~~~l~~~~Iv~~v~~vv~~l~~i~lr~RI~~a~all~ea~k~i~~~p~~~~~p~~~~~v~~~~i~~wv~~~~  295 (577)
T KOG1362|consen  216 LFVAVGNQLTLLDAVGIVLTVISVVLVLYIIFLRKRIPLAIALLKEATKAIGSLPSTLFPPALTFFVLLLFISLWVFVAL  295 (577)
T ss_pred             HHHHHHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence                        13678888888888788889999999999999999999999999999999999999999999999877


Q ss_pred             hc--cc--------ccCch----HHHHHHHHH-HHHHHHHHhccccccceeeeeeeeecCCC-----chHHHHHHHHHhh
Q 008166          319 GA--LN--------FYFPP----LIIIALVLS-LAWTTEVMRNVVNLTVCRVISLYYILGMQ-----SSTQFCFQRALTQ  378 (575)
Q Consensus       319 G~--~~--------~~~~~----~~~~~~lfs-~~Wt~~vi~nv~~~tvAg~va~WYF~~~~-----~pv~~S~~ra~ty  378 (575)
                      +.  .+        ..+++    .+++++++. ++|+++|++|++|+++||++++|||++++     .|+..|++|+++|
T Consensus       296 ~l~t~~~~~~gg~~~~~~~~~~~~~~~~~vv~~l~Wt~~fi~a~q~~vISgava~~Yf~~~~~~iP~~p~~~al~ra~~y  375 (577)
T KOG1362|consen  296 FLVTSGPNSEGGCACTYSGGSLRILFWLLVVGSLIWTSEFILALQQVVISGAVASWYFARDKQDIPSSPLFSALRRALRY  375 (577)
T ss_pred             HHhhcccccCCCceeeccCCcchhHhHHHHHHHHHHHHHHHHHHHHHhhhhhhheeeEecCCCCCCCchHHHHHHHHHHH
Confidence            22  12        22322    355666666 99999999999999999999999997442     6899999999999


Q ss_pred             hhhhhhhhhhHHHHHHHHHHHHHHhhh-hcCCC----chhHHHHHHHHHHHHHHHHhchhhHhHHHhhcCCchhHhHHHH
Q 008166          379 NLGSACLGSLFVPTIEALRIVARGLNL-LEGED----EFMFSCAHCCLRIMESIFRCGNGWAYVQIAAYGKGFVQASQDT  453 (575)
Q Consensus       379 hfGSIcfGSLIvaiI~~lR~il~~l~~-l~~~~----~~l~~c~~C~l~~le~~l~y~N~~Ayi~iAI~G~~F~~SAk~a  453 (575)
                      |+||||+|||++++|+++|.++|++++ +|+..    ++++||+.||+||+|++++|+|||||+|+|||||+||+|||||
T Consensus       376 hlGSi~~GSliv~iV~i~R~iL~~i~~~lk~~~~~~~~~~~~c~~Cc~w~le~~i~~lNrnAYi~iAiyGk~Fc~SAkda  455 (577)
T KOG1362|consen  376 HLGSICFGSLLVALVRILRVILRYIRHKLKGSQNAAARILLMCLKCCFWCLEKFIKFLNRNAYVMIAIYGKNFCTSAKDA  455 (577)
T ss_pred             hccchhhhhhHHHHHHHHHHHHHHHHHHhccCCChhHHHHHHHHHHHHHHHHHHHHhcCcchheeeeccCccchHHHHHH
Confidence            999999999999999999999999985 55543    5999999999999999999999999999999999999999999


Q ss_pred             HHHHHhcCCcceehhchhHHHHHHhhHHHHHHHHHHHHHHhhccCCc--chhHHHHHHHHHH-HHHHHhhhhhHHHHHHH
Q 008166          454 WALFERQEMEPIVDSDITSSICFLTGVCSGCICVIVTAAWTAKVHQP--FTATISLLTFIIG-YLMTRIAMALPQACVSC  530 (575)
Q Consensus       454 ~~L~~~n~~~alv~d~l~~~vLfLg~l~vg~i~~~~~~~~~~~~~~~--~~~~p~li~f~ig-y~I~~~f~sV~~~~VdT  530 (575)
                      |+|+++|..+....|.++++++|+|++. +++++.+++.|....+..  +++.+.++++++| |+|+++|++|++|+|||
T Consensus       456 ~~ll~~Nv~~vv~~d~vs~~llflgk~l-~~~~~g~~g~~~l~~~~~~l~~y~V~lla~iig~ylIa~~f~~v~~m~Vdt  534 (577)
T KOG1362|consen  456 WELLRRNVLRVVDVDLVSDFLLFLGKLL-GAIGSGVAGIWLLIGRKDVLYYYVVPLLAFIIGAYLIAHIFFSVLEMCVDT  534 (577)
T ss_pred             HHHHHHHHHHHhhhhhhhHHHHHHHHHH-HHHHHHHHHHHHHhcCCCcceeEeHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            9999999444455555777777777665 455666666665554444  5666788888888 99999999999999999


Q ss_pred             HHHHhcccCCCCcccccchhHHHH
Q 008166          531 YYVCYAQNPDNRLFDSTIKDRLSL  554 (575)
Q Consensus       531 ifvCfaeDpe~~~~~~~~p~~~~~  554 (575)
                      +|+||+||||....+.+.|.+.++
T Consensus       535 lflCf~eD~e~n~gs~~~p~~~~~  558 (577)
T KOG1362|consen  535 LFLCFAEDPESNDGSPEKPQFMSE  558 (577)
T ss_pred             hhheeEecHhhcCCCCCcceeeeH
Confidence            999999999953444446654333


No 2  
>PF04515 Choline_transpo:  Plasma-membrane choline transporter;  InterPro: IPR007603  This entry represents a family of proteins probably involved in transport through the plasma membrane []. 
Probab=100.00  E-value=8.1e-59  Score=486.66  Aligned_cols=289  Identities=26%  Similarity=0.501  Sum_probs=257.7

Q ss_pred             HHHHHHHHHHHHHHHHHHhhhhHHHHHHHHHHHHHhhhhcCcchhhHHHHHHHHHHHHHHHHHHHHhc-----cc-----
Q 008166          253 VGVCFIAFAIGNGLYACWVSQRIGFCCKVLIISLQPVSKFSDLNQPTYWMLGTGFLWMSFWILAVIGA-----LN-----  322 (575)
Q Consensus       253 ~~i~~ii~ai~~~ly~~~~r~RI~~ai~iLk~As~~i~~~p~l~~~~i~~~ii~~~~~~~W~~~~iG~-----~~-----  322 (575)
                      .++++.+++++.++++++.||||++|++++|+|+++++++|+++++|+++.++.++|+++|+.+..+.     ..     
T Consensus         2 ~~ii~~i~~~i~~~~~~~~r~rI~~a~~vlk~A~~~l~~~p~l~~~p~~~~~~~~~~~~~w~~~~~~l~~~g~~~~~~~~   81 (334)
T PF04515_consen    2 FAIIFLILALIIILFIIFLRKRIPFAIAVLKVASKALRSNPSLLLVPIITFIVQLVFFVLWIIVVLYLFSIGSPVINPCN   81 (334)
T ss_pred             chHHHHHHHHHHHHHHHHHHhHHHHHHHHHHHHHHHHHhCcchhhhhHHHHHHHHHHHHHHHHHHHHHHHcCCCccCCCC
Confidence            34556666666667778889999999999999999999999999999999999999999999988732     10     


Q ss_pred             c------------c---CchHHHHHHHHHHHHHHHHHhccccccceeeeeeeeecCCC-----chHHHHHHHHHhhhhhh
Q 008166          323 F------------Y---FPPLIIIALVLSLAWTTEVMRNVVNLTVCRVISLYYILGMQ-----SSTQFCFQRALTQNLGS  382 (575)
Q Consensus       323 ~------------~---~~~~~~~~~lfs~~Wt~~vi~nv~~~tvAg~va~WYF~~~~-----~pv~~S~~ra~tyhfGS  382 (575)
                      .            +   ...++.+|++|+++|+++|++|++|+++||++++|||++++     .|+.+|++|+++|||||
T Consensus        82 ~~~~~~~~~~~~~~~~~~~~~~~~~~~f~~~W~~~~i~~~~~~~vag~v~~WYF~~~~~~~~~~~~~~s~~~~~~~~~GS  161 (334)
T PF04515_consen   82 LPFSSGSISCCQFVFDSWSYWLIIYHLFSFFWTSQFILNVQQFTVAGVVAQWYFSRDKPNMPKSPVLRSLKRALTYHFGS  161 (334)
T ss_pred             CCcccccccceeeecCchHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhheecCCcccccchHHHHHHHHHHHHhHHH
Confidence            0            1   12357889999999999999999999999999999997442     68999999999999999


Q ss_pred             hhhhhhHHHHHHHHHHHHHHhhhhcCC-----CchhHHHHHHHHHHHHHHHHhchhhHhHHHhhcCCchhHhHHHHHHHH
Q 008166          383 ACLGSLFVPTIEALRIVARGLNLLEGE-----DEFMFSCAHCCLRIMESIFRCGNGWAYVQIAAYGKGFVQASQDTWALF  457 (575)
Q Consensus       383 IcfGSLIvaiI~~lR~il~~l~~l~~~-----~~~l~~c~~C~l~~le~~l~y~N~~Ayi~iAI~G~~F~~SAk~a~~L~  457 (575)
                      +|+|||++++++++|.+++++++..++     .+++.||+.||++|+|+++||+|||||+|+||||++||+|||++++|+
T Consensus       162 i~~gSlivaiv~~~R~~~~~~~~~~~~~~~~~~~~~~~~~~c~~~~~e~~l~~~n~~ayi~~ai~G~~F~~sak~~~~L~  241 (334)
T PF04515_consen  162 ICFGSLIVAIVQFLRFLLRYLRRRAKKSQNKFVKFILCCLSCCLWCLEKFLEYINKYAYIYIAIYGKSFCESAKRAFELI  241 (334)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHhcccCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcCCchHHHHHHHHHHH
Confidence            999999999999999999998864332     368999999999999999999999999999999999999999999999


Q ss_pred             HhcCCcceehhchhHHHHHHhhHHHHHHHHHHHHHHhhc----cCCcchhHHHHHHHHHHHHHHHhhhhhHHHHHHHHHH
Q 008166          458 ERQEMEPIVDSDITSSICFLTGVCSGCICVIVTAAWTAK----VHQPFTATISLLTFIIGYLMTRIAMALPQACVSCYYV  533 (575)
Q Consensus       458 ~~n~~~alv~d~l~~~vLfLg~l~vg~i~~~~~~~~~~~----~~~~~~~~p~li~f~igy~I~~~f~sV~~~~VdTifv  533 (575)
                      +||+.++..+|++++.++++|+++++.+++++++.+...    .+..+...|+++++++||.++++|++++++++||+|+
T Consensus       242 ~~n~~~~~~~~~l~~~~l~~~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~i~~~f~~v~~~~vdti~v  321 (334)
T PF04515_consen  242 KRNGLRAIIVDGLGSFVLFLGKLFISLLCGLIAYLILSNSSFKNDLSYPIVPALISFFIGYFISSIFMSVYSSAVDTIFV  321 (334)
T ss_pred             HhhchHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhccccCccccchHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            999999999999999999999999999999888877753    3445667899999999999999999999999999999


Q ss_pred             HhcccCCC
Q 008166          534 CYAQNPDN  541 (575)
Q Consensus       534 CfaeDpe~  541 (575)
                      ||+||||.
T Consensus       322 c~~~d~e~  329 (334)
T PF04515_consen  322 CYAEDPEM  329 (334)
T ss_pred             HHHHHhhh
Confidence            99999994


No 3  
>KOG1924 consensus RhoA GTPase effector DIA/Diaphanous [Signal transduction mechanisms; Cytoskeleton]
Probab=97.81  E-value=1.4e-05  Score=89.95  Aligned_cols=19  Identities=11%  Similarity=0.006  Sum_probs=9.5

Q ss_pred             hhHHHHHHHHHHHHHhhhh
Q 008166          273 QRIGFCCKVLIISLQPVSK  291 (575)
Q Consensus       273 ~RI~~ai~iLk~As~~i~~  291 (575)
                      +.|+=+|.-..+||.=+++
T Consensus       795 nniKP~i~avt~ACEE~rk  813 (1102)
T KOG1924|consen  795 NNIKPDIVAVTAACEELRK  813 (1102)
T ss_pred             hhcChHHHHHHHHHHHHHh
Confidence            3444444445555555555


No 4  
>KOG1924 consensus RhoA GTPase effector DIA/Diaphanous [Signal transduction mechanisms; Cytoskeleton]
Probab=97.50  E-value=0.00014  Score=82.13  Aligned_cols=21  Identities=19%  Similarity=0.390  Sum_probs=8.9

Q ss_pred             HHHHHHhcCCCCCCCCCCCcC
Q 008166          551 RLSLMKAGRDVVVPTPRVPHR  571 (575)
Q Consensus       551 ~~~~l~~~~~~~~p~~~~~~~  571 (575)
                      +++.|+++-....+.-|.|||
T Consensus      1046 lLeaLqsgaafr~rrk~~prq 1066 (1102)
T KOG1924|consen 1046 LLEALQSGAAFRTRRKRLPRQ 1066 (1102)
T ss_pred             HHHHHHhhccccCcccccCCC
Confidence            445555543333333334443


No 5  
>PRK15319 AIDA autotransporter-like protein ShdA; Provisional
Probab=95.74  E-value=0.011  Score=73.07  Aligned_cols=9  Identities=11%  Similarity=0.312  Sum_probs=5.9

Q ss_pred             eeeeeeeee
Q 008166          353 CRVISLYYI  361 (575)
Q Consensus       353 Ag~va~WYF  361 (575)
                      .|+.+.||.
T Consensus      1844 LGaYaTWy~ 1852 (2039)
T PRK15319       1844 LGVYATWFA 1852 (2039)
T ss_pred             EEEEEEeec
Confidence            466667775


No 6  
>PHA03247 large tegument protein UL36; Provisional
Probab=94.54  E-value=0.05  Score=69.16  Aligned_cols=18  Identities=6%  Similarity=0.049  Sum_probs=11.3

Q ss_pred             hhhhHHHHHHHHHHHHHh
Q 008166          271 VSQRIGFCCKVLIISLQP  288 (575)
Q Consensus       271 ~r~RI~~ai~iLk~As~~  288 (575)
                      +++|++.+=..|.-.++.
T Consensus      3121 i~r~lr~TR~~L~~~~~~ 3138 (3151)
T PHA03247       3121 IRRQLRRTRHALLDRSGA 3138 (3151)
T ss_pred             HHHHHHHHHHHHHhhHHH
Confidence            467777777666555543


No 7  
>PRK15319 AIDA autotransporter-like protein ShdA; Provisional
Probab=93.81  E-value=0.069  Score=66.41  Aligned_cols=6  Identities=0%  Similarity=-0.075  Sum_probs=2.7

Q ss_pred             cccccc
Q 008166          136 SRTALN  141 (575)
Q Consensus       136 ~~~~~~  141 (575)
                      +.|+|+
T Consensus      1723 ~~P~YR 1728 (2039)
T PRK15319       1723 VAPQYR 1728 (2039)
T ss_pred             Cccccc
Confidence            344553


No 8  
>PF11081 DUF2890:  Protein of unknown function (DUF2890);  InterPro: IPR021304  This entry contains the 33kDa and 22kDa phosphoproteins from vertebrate adenoviruses.
Probab=91.95  E-value=0.37  Score=47.03  Aligned_cols=14  Identities=21%  Similarity=0.306  Sum_probs=8.5

Q ss_pred             CcccccchHHHHHH
Q 008166          142 SKKYTNKISLFLFV  155 (575)
Q Consensus       142 s~~~~d~~~~~lF~  155 (575)
                      .+.+.+++|..|+-
T Consensus       121 wr~lR~~I~~tLya  134 (187)
T PF11081_consen  121 WRELRNRIFPTLYA  134 (187)
T ss_pred             HHHHHHHHHHHHHH
Confidence            45557777766643


No 9  
>KOG3671 consensus Actin regulatory protein (Wiskott-Aldrich syndrome protein) [Signal transduction mechanisms; Cytoskeleton]
Probab=91.76  E-value=0.29  Score=53.84  Aligned_cols=15  Identities=40%  Similarity=0.640  Sum_probs=6.5

Q ss_pred             CCCCCCCCCCCCCCC
Q 008166           99 QPSRQAPRIATPPPS  113 (575)
Q Consensus        99 ~~~~~~~~~~~~~~~  113 (575)
                      +|++.+++.+|||||
T Consensus       403 ~ps~~p~~PpPPPPs  417 (569)
T KOG3671|consen  403 NPSAVPVPPPPPPPS  417 (569)
T ss_pred             CCCCCCCCCCCCCCc
Confidence            344444444444443


No 10 
>KOG0162 consensus Myosin class I heavy chain [Cytoskeleton]
Probab=91.53  E-value=0.37  Score=55.20  Aligned_cols=21  Identities=24%  Similarity=0.305  Sum_probs=12.4

Q ss_pred             CCCCCCCcccccccccCCCCC
Q 008166           56 INGEQRGFNASMMQTLNPTNP   76 (575)
Q Consensus        56 ~~~~~~~~~~~~~~~~~~~~p   76 (575)
                      +|++.+....+.+-.+.|.|+
T Consensus       963 ~~~~~paA~~~p~p~~~~~~~  983 (1106)
T KOG0162|consen  963 QNGVSPAAKGSPLPAQKPVNT  983 (1106)
T ss_pred             CCCCCccccCCCCCCCCCCCc
Confidence            455555555666666666665


No 11 
>KOG1923 consensus Rac1 GTPase effector FRL [Signal transduction mechanisms; Cytoskeleton]
Probab=91.43  E-value=0.33  Score=55.84  Aligned_cols=9  Identities=22%  Similarity=0.648  Sum_probs=3.5

Q ss_pred             HHHHHHHHH
Q 008166          507 LLTFIIGYL  515 (575)
Q Consensus       507 li~f~igy~  515 (575)
                      +.-|+-.|-
T Consensus       719 f~~F~~~~k  727 (830)
T KOG1923|consen  719 FVRFVRAYK  727 (830)
T ss_pred             HHHHHHHHH
Confidence            333444443


No 12 
>KOG3895 consensus Synaptic vesicle protein Synapsin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport]
Probab=91.42  E-value=0.39  Score=50.87  Aligned_cols=47  Identities=26%  Similarity=0.396  Sum_probs=24.9

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCcccccc
Q 008166           90 PRIATPPPSQPSRQAPRIATPPPSQPSRPRSISTSPPAPTPTPQQASRT  138 (575)
Q Consensus        90 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  138 (575)
                      |+++-|.+.+|.|.||++.|||+++-++|+  ..|+-.+++|||+|+.+
T Consensus       420 ~a~~~pt~~~PprPppqggppP~g~~~~p~--~~~hl~~~gppq~prt~  466 (488)
T KOG3895|consen  420 PAQASPTRRLPPRPPPQGGPPPRGHMSDPV--GSRHLDHDGPPQIPRTG  466 (488)
T ss_pred             CCCCCCCCCCCCCCCCCCCCCCccccCCcc--ccccCCCCCCCCCCCCC
Confidence            444456666667777777777655433333  33444434445544443


No 13 
>COG5178 PRP8 U5 snRNP spliceosome subunit [RNA processing and modification]
Probab=90.64  E-value=0.18  Score=59.97  Aligned_cols=15  Identities=27%  Similarity=0.618  Sum_probs=7.1

Q ss_pred             CCCCCCCCCCccccc
Q 008166          123 TSPPAPTPTPQQASR  137 (575)
Q Consensus       123 ~~~~~~~~~~~~~~~  137 (575)
                      +.||++|||||+|.+
T Consensus        18 ~epps~pppPppPg~   32 (2365)
T COG5178          18 FEPPSQPPPPPPPGV   32 (2365)
T ss_pred             CCCCCCCCCccCCCc
Confidence            334444445555444


No 14 
>KOG0391 consensus SNF2 family DNA-dependent ATPase [General function prediction only]
Probab=89.55  E-value=0.5  Score=56.89  Aligned_cols=21  Identities=38%  Similarity=0.610  Sum_probs=10.3

Q ss_pred             CCCCCCCCCCCCCCCCCCCCC
Q 008166           98 SQPSRQAPRIATPPPSQPSRP  118 (575)
Q Consensus        98 ~~~~~~~~~~~~~~~~~~~~~  118 (575)
                      .|+-.+|-++.|+||+||.|+
T Consensus      1895 pq~~~~pqp~gpqPp~~p~p~ 1915 (1958)
T KOG0391|consen 1895 PQPAAQPQPQGPQPPQQPSPQ 1915 (1958)
T ss_pred             CccCCCCCCCCCCCCCCCCCC
Confidence            333344445555555555553


No 15 
>PRK09752 adhesin; Provisional
Probab=89.50  E-value=0.33  Score=58.56  Aligned_cols=11  Identities=9%  Similarity=0.178  Sum_probs=5.8

Q ss_pred             ceeeeeeeeec
Q 008166          352 VCRVISLYYIL  362 (575)
Q Consensus       352 vAg~va~WYF~  362 (575)
                      -.|+.++||-+
T Consensus      1062 SvGlYaTWy~n 1072 (1250)
T PRK09752       1062 AVGLTSSWFQH 1072 (1250)
T ss_pred             eeeeEEEEEec
Confidence            34555566653


No 16 
>KOG0559 consensus Dihydrolipoamide succinyltransferase (2-oxoglutarate dehydrogenase, E2 subunit) [Energy production and conversion]
Probab=87.52  E-value=2.4  Score=45.29  Aligned_cols=18  Identities=22%  Similarity=0.263  Sum_probs=11.7

Q ss_pred             cceeeeeeecCCCccccC
Q 008166           37 EVVVEEKVVDSNSNVNIN   54 (575)
Q Consensus        37 ~~~~~~~~~~~~~~~~~~   54 (575)
                      .|+++|-.|.....|..+
T Consensus       123 sGvi~e~lvk~gdtV~~g  140 (457)
T KOG0559|consen  123 SGVITELLVKDGDTVTPG  140 (457)
T ss_pred             cceeeEEecCCCCcccCC
Confidence            477888777666555544


No 17 
>PRK15313 autotransport protein MisL; Provisional
Probab=87.41  E-value=0.81  Score=54.27  Aligned_cols=10  Identities=10%  Similarity=0.311  Sum_probs=5.6

Q ss_pred             ceeeeeeeee
Q 008166          352 VCRVISLYYI  361 (575)
Q Consensus       352 vAg~va~WYF  361 (575)
                      -.|+.++||-
T Consensus       755 SlG~YaTWy~  764 (955)
T PRK15313        755 SVGLYGTWYA  764 (955)
T ss_pred             eeEeEEEEec
Confidence            3455566664


No 18 
>PRK15313 autotransport protein MisL; Provisional
Probab=85.86  E-value=1  Score=53.54  Aligned_cols=7  Identities=0%  Similarity=-0.121  Sum_probs=2.8

Q ss_pred             HHHHHHH
Q 008166          152 FLFVLHM  158 (575)
Q Consensus       152 ~lF~~~l  158 (575)
                      ..+..++
T Consensus       640 gsY~ANl  646 (955)
T PRK15313        640 GSYLANN  646 (955)
T ss_pred             HHHHHHH
Confidence            3434433


No 19 
>COG5178 PRP8 U5 snRNP spliceosome subunit [RNA processing and modification]
Probab=85.35  E-value=0.62  Score=55.67  Aligned_cols=9  Identities=11%  Similarity=0.305  Sum_probs=3.6

Q ss_pred             hhhhcCcch
Q 008166          288 PVSKFSDLN  296 (575)
Q Consensus       288 ~i~~~p~l~  296 (575)
                      .+.++|++.
T Consensus       235 ~led~p~vn  243 (2365)
T COG5178         235 DLEDHPSVN  243 (2365)
T ss_pred             ccccCCccc
Confidence            333344443


No 20 
>KOG1830 consensus Wiskott Aldrich syndrome proteins [Cytoskeleton]
Probab=82.51  E-value=4.5  Score=44.02  Aligned_cols=14  Identities=36%  Similarity=0.510  Sum_probs=5.8

Q ss_pred             cCCCCCCCCCCCCC
Q 008166           88 TAPRIATPPPSQPS  101 (575)
Q Consensus        88 ~~~~~~~~~~~~~~  101 (575)
                      +.|||+||..+.+.
T Consensus       303 t~pPP~ppl~~~~g  316 (518)
T KOG1830|consen  303 TQPPPPPPLDSPPG  316 (518)
T ss_pred             CCCCCCCCCCCCCC
Confidence            34444444444443


No 21 
>KOG2391 consensus Vacuolar sorting protein/ubiquitin receptor VPS23 [Posttranslational modification, protein turnover, chaperones; Intracellular trafficking, secretion, and vesicular transport]
Probab=81.27  E-value=2.3  Score=45.04  Aligned_cols=22  Identities=9%  Similarity=0.205  Sum_probs=14.1

Q ss_pred             CCCCCCCcccc-----cccccCCCCCc
Q 008166           56 INGEQRGFNAS-----MMQTLNPTNPL   77 (575)
Q Consensus        56 ~~~~~~~~~~~-----~~~~~~~~~p~   77 (575)
                      +|=.++..+..     |+-+++..+|+
T Consensus       115 h~W~~pssdLv~Liq~l~a~f~~~pP~  141 (365)
T KOG2391|consen  115 HNWDPPSSDLVGLIQELIAAFSEDPPV  141 (365)
T ss_pred             ccCCCccchHHHHHHHHHHHhcCCCcc
Confidence            56666666654     34567888883


No 22 
>KOG1785 consensus Tyrosine kinase negative regulator CBL [Defense mechanisms]
Probab=79.96  E-value=2.7  Score=45.31  Aligned_cols=9  Identities=33%  Similarity=0.678  Sum_probs=3.4

Q ss_pred             CCCCCCCCC
Q 008166          111 PPSQPSRPR  119 (575)
Q Consensus       111 ~~~~~~~~~  119 (575)
                      +|.+|.|++
T Consensus       523 lp~~~~~qr  531 (563)
T KOG1785|consen  523 LPAPPNPQR  531 (563)
T ss_pred             CCCCCCccc
Confidence            333333333


No 23 
>KOG0566 consensus Inositol-1,4,5-triphosphate 5-phosphatase (synaptojanin), INP51/INP52/INP53 family [Intracellular trafficking, secretion, and vesicular transport]
Probab=78.23  E-value=4.3  Score=48.25  Aligned_cols=6  Identities=17%  Similarity=0.451  Sum_probs=2.7

Q ss_pred             cCCCCC
Q 008166           71 LNPTNP   76 (575)
Q Consensus        71 ~~~~~p   76 (575)
                      +++.+|
T Consensus       992 ~r~~~~  997 (1080)
T KOG0566|consen  992 ARSPSP  997 (1080)
T ss_pred             cCCCCC
Confidence            444444


No 24 
>KOG4849 consensus mRNA cleavage factor I subunit/CPSF subunit [RNA processing and modification]
Probab=77.83  E-value=5.2  Score=42.51  Aligned_cols=17  Identities=35%  Similarity=0.452  Sum_probs=11.4

Q ss_pred             CCcccccccccCCCCCc
Q 008166           61 RGFNASMMQTLNPTNPL   77 (575)
Q Consensus        61 ~~~~~~~~~~~~~~~p~   77 (575)
                      .|-.-.|+|+-+|+-|+
T Consensus       214 ~GPPP~~~~Q~~P~P~m  230 (498)
T KOG4849|consen  214 SGPPPLMMQQVRPTPLM  230 (498)
T ss_pred             CCCCCcccccCCCCCCC
Confidence            33466788888776554


No 25 
>KOG1922 consensus Rho GTPase effector BNI1 and related formins [Signal transduction mechanisms; Cytoskeleton]
Probab=77.53  E-value=6.7  Score=46.89  Aligned_cols=18  Identities=17%  Similarity=0.015  Sum_probs=9.4

Q ss_pred             eEEEeCcccccCCCCCCC
Q 008166           78 RIVINGGRRVTAPRIATP   95 (575)
Q Consensus        78 ~~~~~~~~~~~~~~~~~~   95 (575)
                      .--.+.+.+...|+++++
T Consensus       305 ~~~~~~~~~~~~~~p~~~  322 (833)
T KOG1922|consen  305 TFDFNFLQRESPPPPPIL  322 (833)
T ss_pred             ccccccCccccCCCCCCC
Confidence            334455666666654433


No 26 
>PTZ00438 gamete antigen 27/25-like protein; Provisional
Probab=77.04  E-value=1.1  Score=45.73  Aligned_cols=30  Identities=53%  Similarity=0.633  Sum_probs=15.5

Q ss_pred             hhhhhhhhhhcCCCCCCCchhhhhhhcccceeeee
Q 008166            9 ERETQNKEEEEGGGEGGGEEEVKDVEKGEVVVEEK   43 (575)
Q Consensus         9 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   43 (575)
                      ||-||++|+|+.++     ||.++||..|+|-||-
T Consensus       102 ergtq~~e~e~~~v-----e~i~eveevevveeey  131 (374)
T PTZ00438        102 ERGTQKEEEEDEDV-----EEIEEVEEVEVVEEEY  131 (374)
T ss_pred             hcCccchhhhhhhh-----hhhhhhhhhhhhhhhc
Confidence            45555555544443     4555566666544443


No 27 
>PRK14950 DNA polymerase III subunits gamma and tau; Provisional
Probab=73.91  E-value=4.7  Score=46.34  Aligned_cols=9  Identities=11%  Similarity=0.253  Sum_probs=3.7

Q ss_pred             ccccccCCC
Q 008166           66 SMMQTLNPT   74 (575)
Q Consensus        66 ~~~~~~~~~   74 (575)
                      .-+++..+.
T Consensus       354 ~l~~~~~~~  362 (585)
T PRK14950        354 AVIEALLVP  362 (585)
T ss_pred             HHHHHhcCC
Confidence            344444443


No 28 
>PF05750 Rubella_Capsid:  Rubella capsid protein;  InterPro: IPR008819 Rubella virus is an enveloped positive-strand RNA virus of the family Togaviridae. Virions are composed of three structural proteins: a capsid and two membrane-spanning glycoproteins, E2 and E1. During virus assembly, the capsid interacts with genomic RNA to form nucleocapsids. It has been discovered that capsid phosphorylation serves to negatively regulate binding of viral genomic RNA. This may delay the initiation of nucleocapsid assembly until sufficient amounts of virus glycoproteins accumulate at the budding site and/or prevent non-specific binding to cellular RNA when levels of genomic RNA are low. It follows that at a late stage in replication, the capsid may undergo dephosphorylation before nucleocapsid assembly occurs []. This family is found together with IPR008820 from INTERPRO and IPR008821 from INTERPRO.; GO: 0016021 integral to membrane, 0019013 viral nucleocapsid
Probab=72.84  E-value=3.4  Score=40.17  Aligned_cols=9  Identities=67%  Similarity=1.379  Sum_probs=3.9

Q ss_pred             CCCCCCCCC
Q 008166          111 PPSQPSRPR  119 (575)
Q Consensus       111 ~~~~~~~~~  119 (575)
                      |||||+||+
T Consensus       100 ppqqpqppr  108 (300)
T PF05750_consen  100 PPQQPQPPR  108 (300)
T ss_pred             CcCCCCCcc
Confidence            344444443


No 29 
>PRK05733 single-stranded DNA-binding protein; Provisional
Probab=72.27  E-value=7.3  Score=37.82  Aligned_cols=38  Identities=21%  Similarity=0.172  Sum_probs=19.5

Q ss_pred             hhcccceeeeeeecCCCccccCCCCCCCCCcccc---ccccc
Q 008166           33 VEKGEVVVEEKVVDSNSNVNINNINGEQRGFNAS---MMQTL   71 (575)
Q Consensus        33 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~---~~~~~   71 (575)
                      +.||..|.-|--+..++-. .+|.+...-+..++   .++-|
T Consensus        71 l~KGs~V~VeGrLr~~~y~-kdG~~r~~~eVvvd~~g~v~~L  111 (172)
T PRK05733         71 LRKGSQVYIEGKLQTREWE-KDGIKRYTTEIVVDMQGTMQLL  111 (172)
T ss_pred             hCCCCEEEEEEEEEeCcEe-cCCEEEEEEEEEEeecCeEEEC
Confidence            4588655544444444433 44544445555555   45544


No 30 
>PF11179 DUF2967:  Protein of unknown function (DUF2967);  InterPro: IPR021349  This family of proteins with unknown function appears to be restricted to Drosophila. 
Probab=71.61  E-value=3.5  Score=40.24  Aligned_cols=13  Identities=31%  Similarity=0.340  Sum_probs=6.5

Q ss_pred             CCccccCCCCCCC
Q 008166           48 NSNVNINNINGEQ   60 (575)
Q Consensus        48 ~~~~~~~~~~~~~   60 (575)
                      |.|.|.|+|++.-
T Consensus        89 nan~n~~gg~~s~  101 (258)
T PF11179_consen   89 NANANANGGSNSS  101 (258)
T ss_pred             ccccccccCCccc
Confidence            4455555555443


No 31 
>KOG1925 consensus Rac1 GTPase effector FHOS [Signal transduction mechanisms; Cytoskeleton]
Probab=71.19  E-value=8.4  Score=42.87  Aligned_cols=33  Identities=18%  Similarity=0.170  Sum_probs=17.4

Q ss_pred             CCcchhhhhhhhhhhcCCCCCCCchhhhhhhccc
Q 008166            4 SDPVVERETQNKEEEEGGGEGGGEEEVKDVEKGE   37 (575)
Q Consensus         4 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   37 (575)
                      +|-.-|||.-+..=+|++.|-| -|.++..|+||
T Consensus       148 ~~~s~~~~~~k~~F~~~~~~AE-~~~~~A~~~~~  180 (817)
T KOG1925|consen  148 ADTSSERSIYKARFLENVAAAE-TEKQVALAQGR  180 (817)
T ss_pred             cchhhhhhhHHhHHHhhhHHHH-HHHHHHHHhcc
Confidence            3444456665555555544433 24455666665


No 32 
>PF03154 Atrophin-1:  Atrophin-1 family;  InterPro: IPR002951 Atrophin-1 is the protein product of the dentatorubral-pallidoluysian atrophy (DRPLA) gene. DRPLA (OMIM:125370) is a progressive neurodegenerative disorder. It is caused by the expansion of a CAG repeat in the DRPLA gene on chromosome 12p. This results in an extended polyglutamine region in atrophin-1, that is thought to confer toxicity to the protein, possibly through altering its interactions with other proteins [, ]. The expansion of a CAG repeat is also the underlying defect in six other neurodegenerative disorders, including Huntington's disease. One interaction of expanded polyglutamine repeats that is thought to be pathogenic is that with the short glutamine repeat in the transcriptional coactivator CREB binding protein, CBP. This interaction draws CBP away from its usual nuclear location to the expanded polyglutamine repeat protein aggregates that are characteristic of the polyglutamine neurodegenerative disorders. This interferes with CBP-mediated transcription and causes cytotoxicity [].. This entry includes Atrophin-1 and related proteins.
Probab=70.62  E-value=14  Score=44.38  Aligned_cols=15  Identities=27%  Similarity=0.368  Sum_probs=8.1

Q ss_pred             hHHHHHHhcCCCCCC
Q 008166          550 DRLSLMKAGRDVVVP  564 (575)
Q Consensus       550 ~~~~~l~~~~~~~~p  564 (575)
                      |+-|+||..-+++-|
T Consensus       737 eLrdRlK~gfe~kp~  751 (982)
T PF03154_consen  737 ELRDRLKPGFEVKPP  751 (982)
T ss_pred             HHHHhhccccccCCC
Confidence            455666666555443


No 33 
>KOG0639 consensus Transducin-like enhancer of split protein (contains WD40 repeats) [Chromatin structure and dynamics]
Probab=70.04  E-value=16  Score=40.95  Aligned_cols=23  Identities=13%  Similarity=0.076  Sum_probs=13.3

Q ss_pred             CCCCcccccccccCCCCCceEEE
Q 008166           59 EQRGFNASMMQTLNPTNPLRIVI   81 (575)
Q Consensus        59 ~~~~~~~~~~~~~~~~~p~~~~~   81 (575)
                      +....+...+|...+..|--+..
T Consensus       243 ~~g~d~~~~~~~~~~~sp~s~as  265 (705)
T KOG0639|consen  243 ENGVDNGRSLNKDARDSPASVAS  265 (705)
T ss_pred             ccccccchhhhcccccCcchhhh
Confidence            33335556667777777755443


No 34 
>PRK13335 superantigen-like protein; Reviewed
Probab=69.36  E-value=6.8  Score=41.49  Aligned_cols=6  Identities=50%  Similarity=0.429  Sum_probs=2.4

Q ss_pred             eeeecC
Q 008166           42 EKVVDS   47 (575)
Q Consensus        42 ~~~~~~   47 (575)
                      ||+-.|
T Consensus        85 E~~s~S   90 (356)
T PRK13335         85 EKTSAS   90 (356)
T ss_pred             hccccC
Confidence            444333


No 35 
>PHA03211 serine/threonine kinase US3; Provisional
Probab=69.11  E-value=5.5  Score=44.30  Aligned_cols=13  Identities=0%  Similarity=-0.256  Sum_probs=6.2

Q ss_pred             HHHHHHHhcccCC
Q 008166          528 VSCYYVCYAQNPD  540 (575)
Q Consensus       528 VdTifvCfaeDpe  540 (575)
                      -|-|--|+..||+
T Consensus       432 ~dli~~mL~~DP~  444 (461)
T PHA03211        432 EYLVCRALTFDGA  444 (461)
T ss_pred             HHHHHHHcccChh
Confidence            3444445555555


No 36 
>KOG4849 consensus mRNA cleavage factor I subunit/CPSF subunit [RNA processing and modification]
Probab=68.75  E-value=6.5  Score=41.81  Aligned_cols=9  Identities=33%  Similarity=0.427  Sum_probs=4.3

Q ss_pred             CCCCCceEE
Q 008166           72 NPTNPLRIV   80 (575)
Q Consensus        72 ~~~~p~~~~   80 (575)
                      .|.=|+|+-
T Consensus       243 ~P~~~~Q~~  251 (498)
T KOG4849|consen  243 APQMRLQIN  251 (498)
T ss_pred             CcccCcCcC
Confidence            344455554


No 37 
>KOG1925 consensus Rac1 GTPase effector FHOS [Signal transduction mechanisms; Cytoskeleton]
Probab=68.32  E-value=5.8  Score=44.09  Aligned_cols=14  Identities=36%  Similarity=0.717  Sum_probs=7.3

Q ss_pred             CCCCCCCCCCCCCC
Q 008166           89 APRIATPPPSQPSR  102 (575)
Q Consensus        89 ~~~~~~~~~~~~~~  102 (575)
                      -|+|||||..-|.|
T Consensus       229 ~P~~P~~P~~~P~~  242 (817)
T KOG1925|consen  229 EPLIPASPKELPTR  242 (817)
T ss_pred             CCCCCCChhccCCc
Confidence            45555555555533


No 38 
>PRK13855 type IV secretion system protein VirB10; Provisional
Probab=67.89  E-value=15  Score=39.75  Aligned_cols=21  Identities=14%  Similarity=0.085  Sum_probs=9.6

Q ss_pred             hhcccceeeeeeecCCCcccc
Q 008166           33 VEKGEVVVEEKVVDSNSNVNI   53 (575)
Q Consensus        33 ~~~~~~~~~~~~~~~~~~~~~   53 (575)
                      +++..-.|.++-.|+++...+
T Consensus        12 ~~~~~~~~~~~~~~~~~~~~~   32 (376)
T PRK13855         12 VDASGSLVSDTHRRRLSGSQK   32 (376)
T ss_pred             CCCCcccccCcccccCccchh
Confidence            333333444555555555443


No 39 
>PRK06863 single-stranded DNA-binding protein; Provisional
Probab=65.01  E-value=10  Score=36.60  Aligned_cols=44  Identities=18%  Similarity=0.181  Sum_probs=30.7

Q ss_pred             hhhcccceeeeeeecCCCccccCCCCCCCCCcccccccccCCCC
Q 008166           32 DVEKGEVVVEEKVVDSNSNVNINNINGEQRGFNASMMQTLNPTN   75 (575)
Q Consensus        32 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   75 (575)
                      -+.||.-|.-|.-+.+++-.+.+|.....-...+..++-|...+
T Consensus        69 ~LkKGs~V~VeGrL~~r~w~DkdG~~r~~~eI~a~~i~~L~~r~  112 (168)
T PRK06863         69 YLRKGSQVYVEGRLKTRKWQDQNGQDRYTTEIQGDVLQMLGGRN  112 (168)
T ss_pred             HCCCCCEEEEEEEEEeCCccCCCCCEEEEEEEEEeEEEECCCCC
Confidence            45688766666666677666666666666777788888776654


No 40 
>PF05518 Totivirus_coat:  Totivirus coat protein;  InterPro: IPR008871 This family of proteins contain the coat proteins of the Totiviruses.
Probab=64.45  E-value=23  Score=41.52  Aligned_cols=11  Identities=27%  Similarity=0.296  Sum_probs=4.6

Q ss_pred             CCCCCceEEEe
Q 008166           72 NPTNPLRIVIN   82 (575)
Q Consensus        72 ~~~~p~~~~~~   82 (575)
                      -+-.|++.+.+
T Consensus       680 ~rg~P~~~~~~  690 (759)
T PF05518_consen  680 ARGAPLRPTPH  690 (759)
T ss_pred             ccCCCCCcccc
Confidence            34444444433


No 41 
>PF07462 MSP1_C:  Merozoite surface protein 1 (MSP1) C-terminus;  InterPro: IPR010901 This entry represents the C-terminal region of merozoite surface protein 1 (MSP1), which is found in a number of Plasmodium species. MSP-1 is a 200 kDa protein expressed on the surface of the Plasmodium vivax merozoite. MSP-1 of Plasmodium species is synthesised as a high-molecular-weight precursor and then processed into several fragments. At the time of red cell invasion by the merozoite, only the 19 kDa C-terminal fragment (MSP-119), which contains two epidermal growth factor-like domains, remains on the surface. Antibodies against MSP-119 inhibit merozoite entry into red cells, and immunisation with MSP-119 protects monkeys from challenging infections. Hence, MSP-119 is considered a promising vaccine candidate [].; GO: 0009405 pathogenesis, 0016020 membrane
Probab=64.40  E-value=9.1  Score=43.05  Aligned_cols=21  Identities=14%  Similarity=0.164  Sum_probs=11.7

Q ss_pred             CCCCCCCc--ccccccccCCCCC
Q 008166           56 INGEQRGF--NASMMQTLNPTNP   76 (575)
Q Consensus        56 ~~~~~~~~--~~~~~~~~~~~~p   76 (575)
                      |++|+...  -.--||.-+-+=|
T Consensus       237 G~~~~~n~~~Vk~ALq~YqELLP  259 (574)
T PF07462_consen  237 GNDHAKNIAEVKEALQAYQELLP  259 (574)
T ss_pred             CCChhhhHHHHHHHHHHHHHhCC
Confidence            67776665  2234555555555


No 42 
>PLN02983 biotin carboxyl carrier protein of acetyl-CoA carboxylase
Probab=64.32  E-value=16  Score=37.86  Aligned_cols=9  Identities=56%  Similarity=0.619  Sum_probs=5.1

Q ss_pred             eeecCCCcc
Q 008166           43 KVVDSNSNV   51 (575)
Q Consensus        43 ~~~~~~~~~   51 (575)
                      |+|||..-|
T Consensus       114 ~lv~~~di~  122 (274)
T PLN02983        114 KLVDSRDIV  122 (274)
T ss_pred             hhhccccce
Confidence            566665544


No 43 
>PHA03211 serine/threonine kinase US3; Provisional
Probab=64.21  E-value=7.4  Score=43.30  Aligned_cols=8  Identities=0%  Similarity=0.156  Sum_probs=3.9

Q ss_pred             ccchHHHH
Q 008166          146 TNKISLFL  153 (575)
Q Consensus       146 ~d~~~~~l  153 (575)
                      -.++|...
T Consensus        65 ~~~~~~~~   72 (461)
T PHA03211         65 AARLCQIQ   72 (461)
T ss_pred             HHHHHHHH
Confidence            34556544


No 44 
>PRK13732 single-stranded DNA-binding protein; Provisional
Probab=63.42  E-value=14  Score=35.98  Aligned_cols=43  Identities=23%  Similarity=0.179  Sum_probs=19.3

Q ss_pred             hhcccceeeeeeecCCCccccCCCCCCCCCcccc---cccccCCCCC
Q 008166           33 VEKGEVVVEEKVVDSNSNVNINNINGEQRGFNAS---MMQTLNPTNP   76 (575)
Q Consensus        33 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~---~~~~~~~~~p   76 (575)
                      +.||..|.-|--+..++-.+ +|.....-+..+.   .+|-|.+-..
T Consensus        72 L~KG~~V~VeGrL~~r~ye~-dG~kr~~~eIiv~~~g~~~fL~~~~~  117 (175)
T PRK13732         72 LRKGAQVYIEGQLRTRSWED-NGITRYVTEILVKTTGTMQMLGRAPQ  117 (175)
T ss_pred             cCCCCEEEEEEEEEeeeEcc-CCeEEEEEEEEEeecCeEEEecCCCC
Confidence            45886554444444433322 3333333334444   5555554443


No 45 
>KOG1546 consensus Metacaspase involved in regulation of apoptosis [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones]
Probab=63.32  E-value=10  Score=40.21  Aligned_cols=14  Identities=21%  Similarity=0.363  Sum_probs=6.3

Q ss_pred             CCCCCCCCCCCccc
Q 008166          122 STSPPAPTPTPQQA  135 (575)
Q Consensus       122 ~~~~~~~~~~~~~~  135 (575)
                      +||||.|.|+....
T Consensus        50 pPq~~~~~~~~~gk   63 (362)
T KOG1546|consen   50 PPQPPYQYPQMAGK   63 (362)
T ss_pred             CCCCCCCCcccccc
Confidence            44455554444433


No 46 
>PRK03427 cell division protein ZipA; Provisional
Probab=62.03  E-value=26  Score=37.49  Aligned_cols=19  Identities=26%  Similarity=0.067  Sum_probs=9.3

Q ss_pred             cceeeeeeecCCCccccCC
Q 008166           37 EVVVEEKVVDSNSNVNINN   55 (575)
Q Consensus        37 ~~~~~~~~~~~~~~~~~~~   55 (575)
                      |||-|.+|..++.+-..++
T Consensus        61 dGvGevrv~~~~~~~~~~~   79 (333)
T PRK03427         61 EGVGEVRVHRVNHAPANAQ   79 (333)
T ss_pred             cCccceeccCCCCCCCccc
Confidence            4445556665554443333


No 47 
>KOG0917 consensus Uncharacterized conserved protein [Function unknown]
Probab=61.97  E-value=30  Score=35.94  Aligned_cols=11  Identities=18%  Similarity=0.018  Sum_probs=5.7

Q ss_pred             hhhhHHhhHHH
Q 008166          187 EKRVLKYLLPQ  197 (575)
Q Consensus       187 ~~~dl~~~~~~  197 (575)
                      .+.+|++.+.+
T Consensus       322 avenL~KaL~l  332 (338)
T KOG0917|consen  322 AVENLQKALKL  332 (338)
T ss_pred             HHHHHHHHHHH
Confidence            34556665543


No 48 
>KOG4590 consensus Signal transduction protein Enabled, contains WH1 domain [Signal transduction mechanisms]
Probab=61.83  E-value=14  Score=40.57  Aligned_cols=6  Identities=33%  Similarity=0.994  Sum_probs=2.4

Q ss_pred             CCCCce
Q 008166           73 PTNPLR   78 (575)
Q Consensus        73 ~~~p~~   78 (575)
                      |..++|
T Consensus       140 ~se~~~  145 (409)
T KOG4590|consen  140 PSESIR  145 (409)
T ss_pred             cccccc
Confidence            444433


No 49 
>PHA03378 EBNA-3B; Provisional
Probab=60.32  E-value=17  Score=42.05  Aligned_cols=11  Identities=18%  Similarity=0.069  Sum_probs=5.4

Q ss_pred             cCCCCCCCCCc
Q 008166           53 INNINGEQRGF   63 (575)
Q Consensus        53 ~~~~~~~~~~~   63 (575)
                      ++|++-++...
T Consensus       669 ~~hi~~~p~~~  679 (991)
T PHA03378        669 IGHIPYQPSPT  679 (991)
T ss_pred             cCCcCCCCCCC
Confidence            44555554443


No 50 
>KOG4307 consensus RNA binding protein RBM12/SWAN [General function prediction only]
Probab=59.27  E-value=27  Score=40.48  Aligned_cols=23  Identities=22%  Similarity=0.169  Sum_probs=10.2

Q ss_pred             eeeeeecCCCccccCCCCCCCCC
Q 008166           40 VEEKVVDSNSNVNINNINGEQRG   62 (575)
Q Consensus        40 ~~~~~~~~~~~~~~~~~~~~~~~   62 (575)
                      +|...--.|||+++-.-+.+...
T Consensus       137 y~a~~~~~~Sn~t~~~f~~~ss~  159 (944)
T KOG4307|consen  137 YEASYPPQNSNATRTSFNNQSSY  159 (944)
T ss_pred             eeeccCccccccccceecccccc
Confidence            33333334566655543333333


No 51 
>COG5373 Predicted membrane protein [Function unknown]
Probab=58.29  E-value=20  Score=42.29  Aligned_cols=8  Identities=13%  Similarity=0.260  Sum_probs=2.9

Q ss_pred             ccccccCc
Q 008166          136 SRTALNSK  143 (575)
Q Consensus       136 ~~~~~~s~  143 (575)
                      ..+...++
T Consensus       113 ~~ps~aa~  120 (931)
T COG5373         113 VEPSLAAN  120 (931)
T ss_pred             cccccccC
Confidence            33333333


No 52 
>KOG3397 consensus Acetyltransferases [General function prediction only]
Probab=55.84  E-value=14  Score=35.93  Aligned_cols=8  Identities=50%  Similarity=0.426  Sum_probs=3.5

Q ss_pred             eeeeeeec
Q 008166           39 VVEEKVVD   46 (575)
Q Consensus        39 ~~~~~~~~   46 (575)
                      .||.-|||
T Consensus        85 ~VEsVVV~   92 (225)
T KOG3397|consen   85 WVESVVVK   92 (225)
T ss_pred             EEEEEEEe
Confidence            34444444


No 53 
>PF15387 DUF4611:  Domain of unknown function (DUF4611)
Probab=55.82  E-value=6.6  Score=34.12  Aligned_cols=27  Identities=26%  Similarity=0.592  Sum_probs=12.8

Q ss_pred             cchhhhhhhhhh--hcCCCCCCCchhhhh
Q 008166            6 PVVERETQNKEE--EEGGGEGGGEEEVKD   32 (575)
Q Consensus         6 ~~~~~~~~~~~~--~~~~~~~~~~~~~~~   32 (575)
                      |.||+|.+.+.-  .+...+|+||||.||
T Consensus        48 ~lVqqe~~~r~aa~p~E~ldg~deddaed   76 (96)
T PF15387_consen   48 PLVQQEAQDRVAAAPDEALDGDDEDDAED   76 (96)
T ss_pred             HHHHHhhccccccCchhhccCcccccccc
Confidence            556777666432  223334444444444


No 54 
>COG3115 ZipA Cell division protein [Cell division and chromosome partitioning]
Probab=54.43  E-value=35  Score=35.85  Aligned_cols=18  Identities=17%  Similarity=0.229  Sum_probs=8.5

Q ss_pred             CCCCCCCcccccccccCC
Q 008166           56 INGEQRGFNASMMQTLNP   73 (575)
Q Consensus        56 ~~~~~~~~~~~~~~~~~~   73 (575)
                      -+.+|+....+..++.+|
T Consensus        75 ~~~~~~~~~~~p~~q~q~   92 (324)
T COG3115          75 FTQEHEAARQSPQHQYQP   92 (324)
T ss_pred             ccccccccccchhhhhcc
Confidence            344444444455555553


No 55 
>KOG3130 consensus Uncharacterized conserved protein [Function unknown]
Probab=54.23  E-value=7.7  Score=42.01  Aligned_cols=30  Identities=30%  Similarity=0.221  Sum_probs=14.1

Q ss_pred             CCchhhhhhhcccceeeeeeecCCCccccC
Q 008166           25 GGEEEVKDVEKGEVVVEEKVVDSNSNVNIN   54 (575)
Q Consensus        25 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   54 (575)
                      |||||..|-..|+---|+-+|+.|+--.++
T Consensus       282 dDdeeN~ddd~~d~d~e~~~v~dN~~p~i~  311 (514)
T KOG3130|consen  282 DDDEENIDDDDGDNDHEALGVGDNSIPTIY  311 (514)
T ss_pred             cchhhcccccccccchhhhccCCCcCcccc
Confidence            333333333334433455566666655444


No 56 
>PF00558 Vpu:  Vpu protein;  InterPro: IPR008187 The Human immunodeficiency virus 1 (HIV-1) Vpu protein acts in the degradation of CD4 in the endoplasmic reticulum and in the enhancement of virion release from the plasma membrane of infected cells [].; GO: 0019076 release of virus from host; PDB: 2JPX_A 1PI8_A 2GOH_A 2GOF_A 1PI7_A 1PJE_A 1VPU_A 2K7Y_A.
Probab=53.99  E-value=5.2  Score=34.05  Aligned_cols=27  Identities=26%  Similarity=0.467  Sum_probs=18.7

Q ss_pred             cchhhhhhhhhhhcCCCCCCCchhhhh
Q 008166            6 PVVERETQNKEEEEGGGEGGGEEEVKD   32 (575)
Q Consensus         6 ~~~~~~~~~~~~~~~~~~~~~~~~~~~   32 (575)
                      --++|=.|+.|...+|.|||+|||..+
T Consensus        41 ~li~RIreraEDSGnES~Gd~EeeL~~   67 (81)
T PF00558_consen   41 RLIERIRERAEDSGNESDGDEEEELSA   67 (81)
T ss_dssp             HHHHHHHCTTTCCHCTTTTCCHH-CHC
T ss_pred             HHHHHHHcccccCCCCCCCcHHHHHHH
Confidence            345777888888778777777775554


No 57 
>PF06570 DUF1129:  Protein of unknown function (DUF1129);  InterPro: IPR009214 There are currently no experimental data for members of this group or their homologues. However, these proteins contain predicted integral membrane proteins (with several transmembrane segments).
Probab=53.81  E-value=1.8e+02  Score=28.60  Aligned_cols=22  Identities=5%  Similarity=0.117  Sum_probs=10.2

Q ss_pred             HHHHHHHHHHHHHHHHhhhhHH
Q 008166          255 VCFIAFAIGNGLYACWVSQRIG  276 (575)
Q Consensus       255 i~~ii~ai~~~ly~~~~r~RI~  276 (575)
                      ++.++++++.+....|++||.+
T Consensus       181 ~~~iiig~i~~~~~~~lkkk~~  202 (206)
T PF06570_consen  181 WVYIIIGVIAFALRFYLKKKYN  202 (206)
T ss_pred             HHHHHHHHHHHHHHHHHHHHhC
Confidence            3334455444333345567654


No 58 
>KOG2546 consensus Abl interactor ABI-1, contains SH3 domain [Signal transduction mechanisms; Cytoskeleton]
Probab=53.18  E-value=16  Score=39.97  Aligned_cols=23  Identities=22%  Similarity=0.312  Sum_probs=11.6

Q ss_pred             ccccccCCCCCceEEEeCcccccCC
Q 008166           66 SMMQTLNPTNPLRIVINGGRRVTAP   90 (575)
Q Consensus        66 ~~~~~~~~~~p~~~~~~~~~~~~~~   90 (575)
                      .++|-++|.-|.  .+|+-..+++|
T Consensus       318 ~p~q~~~~~~P~--~~n~~vs~aP~  340 (483)
T KOG2546|consen  318 IPLQPKHPIPPN--SVNKRVSFAPP  340 (483)
T ss_pred             cccccCCCCCCc--cccCccccCCC
Confidence            356666665553  34444444444


No 59 
>TIGR00927 2A1904 K+-dependent Na+/Ca+ exchanger.
Probab=53.16  E-value=1.1e+02  Score=37.19  Aligned_cols=13  Identities=38%  Similarity=0.368  Sum_probs=9.8

Q ss_pred             eeecCCCccccCC
Q 008166           43 KVVDSNSNVNINN   55 (575)
Q Consensus        43 ~~~~~~~~~~~~~   55 (575)
                      +-+|+||.-||-+
T Consensus       287 ~~~~~~~~~~~~~  299 (1096)
T TIGR00927       287 RRVESNSSTNHWG  299 (1096)
T ss_pred             cccccCCCcCccc
Confidence            4578888887765


No 60 
>KOG1955 consensus Ral-GTPase effector RALBP1 [Intracellular trafficking, secretion, and vesicular transport]
Probab=52.35  E-value=24  Score=39.47  Aligned_cols=11  Identities=36%  Similarity=0.634  Sum_probs=7.2

Q ss_pred             CCCCCCCCCCC
Q 008166           93 ATPPPSQPSRQ  103 (575)
Q Consensus        93 ~~~~~~~~~~~  103 (575)
                      +|||..|++|.
T Consensus       491 ~ppPrpq~sHs  501 (737)
T KOG1955|consen  491 EPPPRPQSSHS  501 (737)
T ss_pred             CCCCCCccccc
Confidence            36677777764


No 61 
>KOG3832 consensus Predicted amino acid transporter [General function prediction only]
Probab=52.15  E-value=9.1  Score=38.31  Aligned_cols=21  Identities=19%  Similarity=0.165  Sum_probs=15.6

Q ss_pred             CCCcccccccccCCCCCceEE
Q 008166           60 QRGFNASMMQTLNPTNPLRIV   80 (575)
Q Consensus        60 ~~~~~~~~~~~~~~~~p~~~~   80 (575)
                      .+.+.-..+||---+||..|.
T Consensus       107 aekrpilsvqrrgspnpfeis  127 (319)
T KOG3832|consen  107 AEKRPILSVQRRGSPNPFEIS  127 (319)
T ss_pred             cccCCcceecccCCCCcceee
Confidence            334556678998999998886


No 62 
>PF02993 MCPVI:  Minor capsid protein VI;  InterPro: IPR004243 This minor capsid protein may act as a link between the external capsid and the internal DNA-protein core. Residues at the C-terminal end of the protein may act as a protease cofactor leading to activation of the adenovirus proteinase [].; GO: 0019028 viral capsid; PDB: 1AVP_B.
Probab=51.76  E-value=4.8  Score=40.82  Aligned_cols=10  Identities=20%  Similarity=0.508  Sum_probs=0.0

Q ss_pred             hhhhhhhhhh
Q 008166            8 VERETQNKEE   17 (575)
Q Consensus         8 ~~~~~~~~~~   17 (575)
                      ||||.|++-|
T Consensus        98 vq~~lekrle  107 (238)
T PF02993_consen   98 VQKDLEKRLE  107 (238)
T ss_dssp             ----------
T ss_pred             HHHHHHHHhc
Confidence            5566665444


No 63 
>PLN00034 mitogen-activated protein kinase kinase; Provisional
Probab=50.98  E-value=39  Score=35.43  Aligned_cols=17  Identities=18%  Similarity=0.395  Sum_probs=12.3

Q ss_pred             HHHHHHHHHhcccCCCC
Q 008166          526 ACVSCYYVCYAQNPDNR  542 (575)
Q Consensus       526 ~~VdTifvCfaeDpe~~  542 (575)
                      ...|-+--|...||+.|
T Consensus       303 ~l~~li~~~l~~~P~~R  319 (353)
T PLN00034        303 EFRHFISCCLQREPAKR  319 (353)
T ss_pred             HHHHHHHHHccCChhhC
Confidence            44566667999999964


No 64 
>KOG3895 consensus Synaptic vesicle protein Synapsin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport]
Probab=50.10  E-value=33  Score=36.89  Aligned_cols=10  Identities=40%  Similarity=0.378  Sum_probs=4.1

Q ss_pred             CCCCCCCCCC
Q 008166           89 APRIATPPPS   98 (575)
Q Consensus        89 ~~~~~~~~~~   98 (575)
                      +++|+.|-.+
T Consensus       400 a~sP~rp~t~  409 (488)
T KOG3895|consen  400 AESPARPTTS  409 (488)
T ss_pred             CCCCCCCccc
Confidence            4444443333


No 65 
>PF15451 DUF4632:  Domain of unknown function (DUF4632)
Probab=49.51  E-value=6.5  Score=31.46  Aligned_cols=20  Identities=45%  Similarity=0.697  Sum_probs=9.9

Q ss_pred             hhhhcCCCCCCCchhhhhhhccc
Q 008166           15 KEEEEGGGEGGGEEEVKDVEKGE   37 (575)
Q Consensus        15 ~~~~~~~~~~~~~~~~~~~~~~~   37 (575)
                      ||.+|.|+|+||||   +-|||.
T Consensus         6 kesgdad~e~d~e~---ese~ga   25 (71)
T PF15451_consen    6 KESGDADGEADEEE---ESEKGA   25 (71)
T ss_pred             cccccccccccccc---ccccCC
Confidence            45555555555333   345564


No 66 
>PTZ00415 transmission-blocking target antigen s230; Provisional
Probab=48.80  E-value=11  Score=47.70  Aligned_cols=16  Identities=25%  Similarity=0.235  Sum_probs=7.4

Q ss_pred             chhhHhHHHhhcCCch
Q 008166          431 GNGWAYVQIAAYGKGF  446 (575)
Q Consensus       431 ~N~~Ayi~iAI~G~~F  446 (575)
                      +|+--|--+.|.-+..
T Consensus       636 ~nk~~~~niem~p~~l  651 (2849)
T PTZ00415        636 INKAKYANIEIFPKML  651 (2849)
T ss_pred             cccccccChhccchhh
Confidence            4554444445544433


No 67 
>KOG2140 consensus Uncharacterized conserved protein [General function prediction only]
Probab=48.48  E-value=6.9  Score=43.93  Aligned_cols=27  Identities=37%  Similarity=0.684  Sum_probs=14.4

Q ss_pred             hhhhhhhhcCCCCCCCchhhhhhhccc
Q 008166           11 ETQNKEEEEGGGEGGGEEEVKDVEKGE   37 (575)
Q Consensus        11 ~~~~~~~~~~~~~~~~~~~~~~~~~~~   37 (575)
                      ++||.+.++++.|+++|||++++|..|
T Consensus       412 dsen~d~~~~s~E~~~eee~e~~ee~~  438 (739)
T KOG2140|consen  412 DSENEDDEDGSSEDDDEEEDESVEEDE  438 (739)
T ss_pred             ccccccccccccccccccccccccccc
Confidence            334444455555566666665555443


No 68 
>PF05297 Herpes_LMP1:  Herpesvirus latent membrane protein 1 (LMP1);  InterPro: IPR007961 This family consists of several latent membrane protein 1 or LMP1s mostly from Epstein-Barr virus (strain GD1) (HHV-4) (Human herpesvirus 4). LMP1 of HHV-4 is a 62-65 kDa plasma membrane protein possessing six membrane spanning regions, a short cytoplasmic N terminus and a long cytoplasmic carboxy tail of 200 amino acids. HHV-4 virus latent membrane protein 1 (LMP1) is essential for HHV-4 mediated transformation and has been associated with several cases of malignancies. HHV-4-like viruses in Macaca fascicularis (Cynomolgus monkeys) have been associated with high lymphoma rates in immunosuppressed monkeys [].; GO: 0019087 transformation of host cell by virus, 0016021 integral to membrane; PDB: 1CZY_E 1ZMS_B.
Probab=47.90  E-value=6.1  Score=41.12  Aligned_cols=29  Identities=7%  Similarity=-0.165  Sum_probs=0.0

Q ss_pred             hhHHhhHHHHHHHHHHHHHHHHHHHHHHH
Q 008166          189 RVLKYLLPQVEAASLLSISLSFSWQKAVR  217 (575)
Q Consensus       189 ~dl~~~~~~i~~~~~is~vls~iwl~llr  217 (575)
                      +|+..+...++.++++-+++-.+.+.++|
T Consensus        45 sd~t~~a~~vl~sfAvvliiIIiIImlF~   73 (381)
T PF05297_consen   45 SDLTQGALTVLYSFAVVLIIIIIIIMLFK   73 (381)
T ss_dssp             -----------------------------
T ss_pred             hccccchHHHHHHHHHHHHHHHHHHHHHH
Confidence            34444333444455555544444555555


No 69 
>TIGR00927 2A1904 K+-dependent Na+/Ca+ exchanger.
Probab=47.33  E-value=8.1  Score=46.41  Aligned_cols=12  Identities=17%  Similarity=0.207  Sum_probs=5.1

Q ss_pred             HHHHHHHHHHHH
Q 008166          206 ISLSFSWQKAVR  217 (575)
Q Consensus       206 ~vls~iwl~llr  217 (575)
                      ++.|++|+.++-
T Consensus       938 Fi~SIiwIsi~S  949 (1096)
T TIGR00927       938 FLGSIMWIAMFS  949 (1096)
T ss_pred             HHHHHHHHHHHH
Confidence            334444544333


No 70 
>PRK12270 kgd alpha-ketoglutarate decarboxylase; Reviewed
Probab=47.21  E-value=41  Score=40.96  Aligned_cols=7  Identities=29%  Similarity=0.487  Sum_probs=3.3

Q ss_pred             CCCCcch
Q 008166            2 GASDPVV    8 (575)
Q Consensus         2 ~~~~~~~    8 (575)
                      |+.|-.|
T Consensus         5 G~NewlV   11 (1228)
T PRK12270          5 GQNEWLV   11 (1228)
T ss_pred             CcchHHH
Confidence            4444444


No 71 
>PLN03132 NADH dehydrogenase (ubiquinone) flavoprotein 1; Provisional
Probab=47.17  E-value=14  Score=41.30  Aligned_cols=15  Identities=7%  Similarity=-0.026  Sum_probs=8.1

Q ss_pred             cCCchhHhHHHHHHH
Q 008166          442 YGKGFVQASQDTWAL  456 (575)
Q Consensus       442 ~G~~F~~SAk~a~~L  456 (575)
                      .+++=|.-+|.....
T Consensus       375 ESCGqCtPCReGt~~  389 (461)
T PLN03132        375 ESCGQCTPCREGTGW  389 (461)
T ss_pred             cCCCCCCChhhHHHH
Confidence            455556555555443


No 72 
>PTZ00415 transmission-blocking target antigen s230; Provisional
Probab=46.47  E-value=9.2  Score=48.23  Aligned_cols=8  Identities=13%  Similarity=0.281  Sum_probs=3.5

Q ss_pred             chhHhHHH
Q 008166          445 GFVQASQD  452 (575)
Q Consensus       445 ~F~~SAk~  452 (575)
                      +|-.-||.
T Consensus       697 p~n~i~k~  704 (2849)
T PTZ00415        697 PFNHIAKK  704 (2849)
T ss_pred             ehhhhhHH
Confidence            34444443


No 73 
>PRK08763 single-stranded DNA-binding protein; Provisional
Probab=46.14  E-value=37  Score=32.72  Aligned_cols=42  Identities=17%  Similarity=0.090  Sum_probs=27.4

Q ss_pred             hhcccceeeeeeecCCCccccCCCCCCCCCcccccccccCCC
Q 008166           33 VEKGEVVVEEKVVDSNSNVNINNINGEQRGFNASMMQTLNPT   74 (575)
Q Consensus        33 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   74 (575)
                      +.||..|.-|--+..++-.+.++.++..-+..+..++.+..-
T Consensus        70 L~KGs~V~VeGrL~~~~y~dkdG~kr~~~eIva~~i~~L~~~  111 (164)
T PRK08763         70 LRKGSQCYIEGSIRYDKFTGQDGQERYVTEIVADEMQMLGGR  111 (164)
T ss_pred             cCCCCEEEEEEEEEeceeECCCCCEEEEEEEEEeEEEECCCC
Confidence            568876666666666666666665556666667777766543


No 74 
>KOG3837 consensus Uncharacterized conserved protein, contains DM14 and C2 domains [General function prediction only]
Probab=45.78  E-value=26  Score=38.44  Aligned_cols=17  Identities=35%  Similarity=0.602  Sum_probs=6.6

Q ss_pred             CCCCCCCCCCCCCCCCC
Q 008166          111 PPSQPSRPRSISTSPPA  127 (575)
Q Consensus       111 ~~~~~~~~~~~~~~~~~  127 (575)
                      +|++|++++..++.|-.
T Consensus       177 l~~~Ppaqp~~Pt~pss  193 (523)
T KOG3837|consen  177 LPSQPPAQPTAPTTPSS  193 (523)
T ss_pred             CCCCCCCCCCCCCCCCC
Confidence            33344444333333333


No 75 
>TIGR00859 ENaC sodium channel transporter. This model is designed from the vertebrate members of the ENaC family.
Probab=45.44  E-value=27  Score=40.31  Aligned_cols=6  Identities=17%  Similarity=0.495  Sum_probs=2.2

Q ss_pred             CCCCCC
Q 008166           95 PPPSQP  100 (575)
Q Consensus        95 ~~~~~~  100 (575)
                      |..+.+
T Consensus       555 ~~~~~~  560 (595)
T TIGR00859       555 SADTPP  560 (595)
T ss_pred             CCCCcc
Confidence            333333


No 76 
>PF10446 DUF2457:  Protein of unknown function (DUF2457);  InterPro: IPR018853  This entry represents a family of uncharacterised proteins. 
Probab=45.33  E-value=43  Score=37.00  Aligned_cols=8  Identities=25%  Similarity=0.634  Sum_probs=4.4

Q ss_pred             cccccCCC
Q 008166           84 GRRVTAPR   91 (575)
Q Consensus        84 ~~~~~~~~   91 (575)
                      -.|+..||
T Consensus       282 PkR~~SPP  289 (458)
T PF10446_consen  282 PKRLRSPP  289 (458)
T ss_pred             cccccCCC
Confidence            35555665


No 77 
>PRK14971 DNA polymerase III subunits gamma and tau; Provisional
Probab=45.07  E-value=48  Score=38.48  Aligned_cols=8  Identities=25%  Similarity=0.414  Sum_probs=4.5

Q ss_pred             hhHHhhHH
Q 008166          189 RVLKYLLP  196 (575)
Q Consensus       189 ~dl~~~~~  196 (575)
                      .++...|.
T Consensus       500 e~l~~~W~  507 (614)
T PRK14971        500 EDLQYYWQ  507 (614)
T ss_pred             HHHHHHHH
Confidence            35666664


No 78 
>KOG2677 consensus Stoned B synaptic vesicle biogenesis protein [Intracellular trafficking, secretion, and vesicular transport]
Probab=43.73  E-value=63  Score=37.38  Aligned_cols=21  Identities=19%  Similarity=0.124  Sum_probs=12.1

Q ss_pred             CCCCCCCcccccccccCCCCC
Q 008166           56 INGEQRGFNASMMQTLNPTNP   76 (575)
Q Consensus        56 ~~~~~~~~~~~~~~~~~~~~p   76 (575)
                      +|+..+|-+-.++|.++|+-=
T Consensus        52 ~~~~~~~~~~~~~~~~~~~~~   72 (922)
T KOG2677|consen   52 GHTGDAPTASEPVQELSPTPE   72 (922)
T ss_pred             CCcCCCCCccCcccccCCCcc
Confidence            444445555566777777643


No 79 
>KOG2199 consensus Signal transducing adaptor protein STAM/STAM2 [Signal transduction mechanisms]
Probab=42.96  E-value=51  Score=36.04  Aligned_cols=13  Identities=31%  Similarity=0.491  Sum_probs=5.7

Q ss_pred             CCCCCCCCCCCCC
Q 008166           98 SQPSRQAPRIATP  110 (575)
Q Consensus        98 ~~~~~~~~~~~~~  110 (575)
                      -||.++||.+.+.
T Consensus       413 ~~pl~~Pp~~~~~  425 (462)
T KOG2199|consen  413 QQPLQQPPNSNPA  425 (462)
T ss_pred             cCCCCCCCccCCC
Confidence            3444444444443


No 80 
>PF09849 DUF2076:  Uncharacterized protein conserved in bacteria (DUF2076);  InterPro: IPR018648  This family of hypothetical prokaryotic proteins has no known function but includes putative perimplasmic ligand-binding sensor proteins.
Probab=42.89  E-value=33  Score=35.23  Aligned_cols=18  Identities=28%  Similarity=0.261  Sum_probs=9.6

Q ss_pred             HHHHHHHhhhcccccccc
Q 008166          162 IGLVGFLVFKGIQGLILA  179 (575)
Q Consensus       162 i~~~~~~~~~~~~~~~~~  179 (575)
                      .+.-+++.+.++.++.+.
T Consensus       147 GVAGG~lL~n~i~~lF~~  164 (247)
T PF09849_consen  147 GVAGGMLLANGIESLFGG  164 (247)
T ss_pred             HHHHHHHHHHHHHHHhcC
Confidence            344445556666665544


No 81 
>KOG4090 consensus Uncharacterized conserved protein [Function unknown]
Probab=42.87  E-value=51  Score=31.35  Aligned_cols=9  Identities=33%  Similarity=0.523  Sum_probs=3.4

Q ss_pred             CCCCCCCCC
Q 008166          102 RQAPRIATP  110 (575)
Q Consensus       102 ~~~~~~~~~  110 (575)
                      |.|+..+.|
T Consensus        20 rap~~~aap   28 (157)
T KOG4090|consen   20 RAPSPAAAP   28 (157)
T ss_pred             cCCCcccCC
Confidence            333333333


No 82 
>PF10110 GPDPase_memb:  Membrane domain of glycerophosphoryl diester phosphodiesterase;  InterPro: IPR018476 Members of this family comprise the membrane domain of the prokaryotic enzyme glycerophosphoryl diester phosphodiesterase [].
Probab=42.11  E-value=73  Score=29.70  Aligned_cols=32  Identities=19%  Similarity=0.246  Sum_probs=26.9

Q ss_pred             hhHhHHHhhcCCchhHhHHHHHHHHHhcCCcc
Q 008166          433 GWAYVQIAAYGKGFVQASQDTWALFERQEMEP  464 (575)
Q Consensus       433 ~~Ayi~iAI~G~~F~~SAk~a~~L~~~n~~~a  464 (575)
                      -++.-.+.+.++++.+|-|++|++.++|.++.
T Consensus       104 if~lp~~vle~~~~~~A~k~Sw~ltk~~~~~~  135 (149)
T PF10110_consen  104 IFVLPLIVLENKSFKEALKESWQLTKGRFWRI  135 (149)
T ss_pred             HHHHHHHHHcCCCHHHHHHHHHHHHcCcHHHH
Confidence            35667788999999999999999999876543


No 83 
>COG3147 DedD Uncharacterized protein conserved in bacteria [Function unknown]
Probab=41.68  E-value=1.2e+02  Score=30.62  Aligned_cols=7  Identities=0%  Similarity=-0.178  Sum_probs=2.6

Q ss_pred             hhhhhhh
Q 008166           28 EEVKDVE   34 (575)
Q Consensus        28 ~~~~~~~   34 (575)
                      +...+++
T Consensus        39 ~a~p~pp   45 (226)
T COG3147          39 AAIPLPP   45 (226)
T ss_pred             cccCCCC
Confidence            3333333


No 84 
>TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family. There are four paralogs in Homo sapiens which are expressed in testis, platelets, broadly expressed, or of unknown tissue range.
Probab=41.32  E-value=36  Score=38.62  Aligned_cols=7  Identities=14%  Similarity=0.648  Sum_probs=2.8

Q ss_pred             Cchhhhh
Q 008166           26 GEEEVKD   32 (575)
Q Consensus        26 ~~~~~~~   32 (575)
                      +|||.++
T Consensus       298 ~~~~L~~  304 (562)
T TIGR01628       298 TDEKLRE  304 (562)
T ss_pred             CHHHHHH
Confidence            3344443


No 85 
>KOG1985 consensus Vesicle coat complex COPII, subunit SEC24/subunit SFB2 [Intracellular trafficking, secretion, and vesicular transport]
Probab=40.50  E-value=72  Score=37.95  Aligned_cols=9  Identities=11%  Similarity=0.006  Sum_probs=4.4

Q ss_pred             cccccchhH
Q 008166          543 LFDSTIKDR  551 (575)
Q Consensus       543 ~~~~~~p~~  551 (575)
                      +....+|++
T Consensus       730 L~k~IYP~L  738 (887)
T KOG1985|consen  730 LMKYIYPTL  738 (887)
T ss_pred             HHhhhcccc
Confidence            334456663


No 86 
>PF10873 DUF2668:  Protein of unknown function (DUF2668);  InterPro: IPR022640  Members in this family of proteins are annotated as cysteine and tyrosine-rich protein 1, however currently no function is known []. 
Probab=39.80  E-value=53  Score=31.00  Aligned_cols=7  Identities=57%  Similarity=0.719  Sum_probs=2.8

Q ss_pred             CCCCCCC
Q 008166           93 ATPPPSQ   99 (575)
Q Consensus        93 ~~~~~~~   99 (575)
                      +|||-+-
T Consensus       113 apPpysy  119 (155)
T PF10873_consen  113 APPPYSY  119 (155)
T ss_pred             CCCCccc
Confidence            3444433


No 87 
>PF15471 TMEM171:  Transmembrane protein family 171
Probab=39.69  E-value=89  Score=32.50  Aligned_cols=19  Identities=16%  Similarity=0.475  Sum_probs=13.0

Q ss_pred             CCCCCceEEEeCcccccCC
Q 008166           72 NPTNPLRIVINGGRRVTAP   90 (575)
Q Consensus        72 ~~~~p~~~~~~~~~~~~~~   90 (575)
                      +-+.|.||++.+.--+-+|
T Consensus       203 qs~Ep~qVTVGDaViiFPP  221 (319)
T PF15471_consen  203 QSTEPVQVTVGDAVIIFPP  221 (319)
T ss_pred             CCCCCEEEEecCEEEEcCC
Confidence            4567999998766555554


No 88 
>PF14017 DUF4233:  Protein of unknown function (DUF4233)
Probab=39.37  E-value=2.8e+02  Score=24.81  Aligned_cols=49  Identities=20%  Similarity=0.259  Sum_probs=28.9

Q ss_pred             hhhHHHHHHHHHHHHHHHHHHHHhhccCCchhHHHHHHHHHHHHHHHHHHhhhhHHHH
Q 008166          221 KFMVHFILWSSFFLSLSAGILLICFQKPATDGVGVCFIAFAIGNGLYACWVSQRIGFC  278 (575)
Q Consensus       221 ~~~i~~~vw~~iil~~~~~i~~~~f~~~~~~~~~i~~ii~ai~~~ly~~~~r~RI~~a  278 (575)
                      |......-|..=+..++.++..        ...+++.++|+..+ .|..++|+||+.-
T Consensus        55 rpwa~~~g~~lQv~~i~~g~v~--------p~m~vvG~iF~~~W-~~~l~lg~~i~~~  103 (107)
T PF14017_consen   55 RPWAYWLGWVLQVLLIAGGFVH--------PAMFVVGVIFAAVW-WYALYLGRRIDRR  103 (107)
T ss_pred             CcHHHHHHHHHHHHHHHHHHHH--------HHHHHHHHHHHHHH-HHHHHHHHHHHHH
Confidence            4444445555444433333321        24566777888777 6777888888754


No 89 
>PRK13855 type IV secretion system protein VirB10; Provisional
Probab=39.26  E-value=43  Score=36.41  Aligned_cols=15  Identities=7%  Similarity=0.306  Sum_probs=5.8

Q ss_pred             hhhhhhhhhhHHHHH
Q 008166          379 NLGSACLGSLFVPTI  393 (575)
Q Consensus       379 hfGSIcfGSLIvaiI  393 (575)
                      ||+.+-=+++++++|
T Consensus       280 Hf~~rFGsAlLlS~I  294 (376)
T PRK13855        280 HFWQRFSGAMLLSVV  294 (376)
T ss_pred             HHHHHHHHHHHHHHH
Confidence            333333333444433


No 90 
>PF15449 Retinal:  Retinal protein
Probab=38.74  E-value=1e+02  Score=37.83  Aligned_cols=6  Identities=17%  Similarity=0.108  Sum_probs=2.3

Q ss_pred             cccccc
Q 008166           65 ASMMQT   70 (575)
Q Consensus        65 ~~~~~~   70 (575)
                      .--+|+
T Consensus      1046 ~P~v~~ 1051 (1287)
T PF15449_consen 1046 LPSVQR 1051 (1287)
T ss_pred             CCcCCC
Confidence            333444


No 91 
>KOG1955 consensus Ral-GTPase effector RALBP1 [Intracellular trafficking, secretion, and vesicular transport]
Probab=38.38  E-value=46  Score=37.31  Aligned_cols=13  Identities=8%  Similarity=0.038  Sum_probs=5.9

Q ss_pred             ccccccccCCCCC
Q 008166           64 NASMMQTLNPTNP   76 (575)
Q Consensus        64 ~~~~~~~~~~~~p   76 (575)
                      ..+|-||+++.-+
T Consensus       505 sLd~n~~fq~~~~  517 (737)
T KOG1955|consen  505 SLDANQRFQAKKL  517 (737)
T ss_pred             ccchhcccccccc
Confidence            3444455554443


No 92 
>PF07462 MSP1_C:  Merozoite surface protein 1 (MSP1) C-terminus;  InterPro: IPR010901 This entry represents the C-terminal region of merozoite surface protein 1 (MSP1), which is found in a number of Plasmodium species. MSP-1 is a 200 kDa protein expressed on the surface of the Plasmodium vivax merozoite. MSP-1 of Plasmodium species is synthesised as a high-molecular-weight precursor and then processed into several fragments. At the time of red cell invasion by the merozoite, only the 19 kDa C-terminal fragment (MSP-119), which contains two epidermal growth factor-like domains, remains on the surface. Antibodies against MSP-119 inhibit merozoite entry into red cells, and immunisation with MSP-119 protects monkeys from challenging infections. Hence, MSP-119 is considered a promising vaccine candidate [].; GO: 0009405 pathogenesis, 0016020 membrane
Probab=38.19  E-value=47  Score=37.64  Aligned_cols=7  Identities=43%  Similarity=0.401  Sum_probs=2.7

Q ss_pred             cchHHHH
Q 008166          147 NKISLFL  153 (575)
Q Consensus       147 d~~~~~l  153 (575)
                      +.+..|+
T Consensus       332 ~vi~~p~  338 (574)
T PF07462_consen  332 KVIALPL  338 (574)
T ss_pred             ceeeccC
Confidence            3333343


No 93 
>TIGR01299 synapt_SV2 synaptic vesicle protein SV2. This model describes a tightly conserved subfamily of the larger family of sugar (and other) transporters described by pfam model pfam00083. Members of this subfamily include closely related forms SV2A and SV2B of synaptic vesicle protein from vertebrates and a more distantly related homolog (below trusted cutoff) from Drosophila melanogaster. Members are predicted to have two sets of six transmembrane helices.
Probab=37.87  E-value=7.8e+02  Score=29.42  Aligned_cols=19  Identities=11%  Similarity=0.050  Sum_probs=10.0

Q ss_pred             HHHHHHHHHHHHHHHhhhh
Q 008166          204 LSISLSFSWQKAVRVWPKF  222 (575)
Q Consensus       204 is~vls~iwl~llr~~~~~  222 (575)
                      ..++-+++|-.+...+-|.
T Consensus       214 G~iiG~li~G~LsDR~GRR  232 (742)
T TIGR01299       214 GMMVGAFFWGGLADKLGRK  232 (742)
T ss_pred             HHHHHHHHHHHHHHHhCcH
Confidence            3444455555566655554


No 94 
>COG5137 Histone chaperone involved in gene silencing [Transcription / Chromatin structure and dynamics]
Probab=37.68  E-value=15  Score=36.74  Aligned_cols=21  Identities=43%  Similarity=0.515  Sum_probs=9.2

Q ss_pred             hhcCCCCCCCchhhhhhhccc
Q 008166           17 EEEGGGEGGGEEEVKDVEKGE   37 (575)
Q Consensus        17 ~~~~~~~~~~~~~~~~~~~~~   37 (575)
                      ++..|.|+++|||+.+.+.||
T Consensus       183 eE~d~~EeeeDee~~~~~~gE  203 (279)
T COG5137         183 EESDGREEEEDEEVGSDSYGE  203 (279)
T ss_pred             hhhccchhhhhhccccccccc
Confidence            334444444444444444444


No 95 
>KOG1922 consensus Rho GTPase effector BNI1 and related formins [Signal transduction mechanisms; Cytoskeleton]
Probab=37.41  E-value=95  Score=37.25  Aligned_cols=11  Identities=18%  Similarity=0.462  Sum_probs=5.3

Q ss_pred             CCchhHhHHHH
Q 008166          443 GKGFVQASQDT  453 (575)
Q Consensus       443 G~~F~~SAk~a  453 (575)
                      +..|+.+.++-
T Consensus       716 ~~~f~~~~~~f  726 (833)
T KOG1922|consen  716 GDPFSKVKKEF  726 (833)
T ss_pred             cchhhhhhhhh
Confidence            34555555443


No 96 
>PF07304 SRA1:  Steroid receptor RNA activator (SRA1);  InterPro: IPR009917 This entry consists of several hypothetical mammalian steroid receptor RNA activator proteins. The SRA-RNAs encode stable proteins that are widely expressed and upregulated in breast cancer cell lines. SRA-RNA is a steroid receptor co-activator which acts as a functional RNA. This domain is also found at the C terminus of Sec31, a component of the coat protein complex II (COPII, which promotes the formation of transport vesicles from the endoplasmic reticulum (ER). COPII has two main functions, the physical deformation of the endoplasmic reticulum membrane into vesicles and the selection of cargo molecules. ; PDB: 2YRU_A.
Probab=37.14  E-value=11  Score=35.90  Aligned_cols=6  Identities=0%  Similarity=-0.191  Sum_probs=2.7

Q ss_pred             hhHHhh
Q 008166          189 RVLKYL  194 (575)
Q Consensus       189 ~dl~~~  194 (575)
                      .|+.+-
T Consensus        68 ~D~~KR   73 (157)
T PF07304_consen   68 DDIEKR   73 (157)
T ss_dssp             HHHHHH
T ss_pred             HHHHHH
Confidence            454443


No 97 
>KOG1546 consensus Metacaspase involved in regulation of apoptosis [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones]
Probab=36.91  E-value=45  Score=35.60  Aligned_cols=24  Identities=21%  Similarity=0.296  Sum_probs=11.3

Q ss_pred             CCCCCCCCCCCCCCCCCCcccccc
Q 008166          115 PSRPRSISTSPPAPTPTPQQASRT  138 (575)
Q Consensus       115 ~~~~~~~~~~~~~~~~~~~~~~~~  138 (575)
                      |+|.+.--++|||+||-++++...
T Consensus        39 ppP~~~~~~~PpPq~~~~~~~~~g   62 (362)
T KOG1546|consen   39 PPPQPSSYPNPPPQPPYQYPQMAG   62 (362)
T ss_pred             CCCCCCCCCCCCCCCCCCCccccc
Confidence            333444456665554444444433


No 98 
>KOG4317 consensus Predicted Zn-finger protein [Function unknown]
Probab=36.78  E-value=16  Score=38.45  Aligned_cols=30  Identities=40%  Similarity=0.633  Sum_probs=19.5

Q ss_pred             chhhhhhhhhhhcCCC---------CCCCchhhhhhhccc
Q 008166            7 VVERETQNKEEEEGGG---------EGGGEEEVKDVEKGE   37 (575)
Q Consensus         7 ~~~~~~~~~~~~~~~~---------~~~~~~~~~~~~~~~   37 (575)
                      .+.|-.|+ |||+++|         +|+|||++||+..+|
T Consensus        71 ~lkr~~q~-e~eddgg~~gi~sgp~~~gd~~~~edla~~E  109 (383)
T KOG4317|consen   71 ELKRKMQK-EEEDDGGWSGIESGPPLDGDDEEQEDLADWE  109 (383)
T ss_pred             HHHHHHhh-hhccCCcccccccCCCCCCchHhHHhcCchh
Confidence            35455555 4444443         467888999988876


No 99 
>PRK14971 DNA polymerase III subunits gamma and tau; Provisional
Probab=36.34  E-value=56  Score=37.98  Aligned_cols=6  Identities=33%  Similarity=0.778  Sum_probs=2.5

Q ss_pred             HHHHHH
Q 008166          211 SWQKAV  216 (575)
Q Consensus       211 iwl~ll  216 (575)
                      .|..+.
T Consensus       505 ~W~~~~  510 (614)
T PRK14971        505 YWQEFA  510 (614)
T ss_pred             HHHHHH
Confidence            444333


No 100
>TIGR01129 secD protein-export membrane protein SecD. SecD from Mycobacterium tuberculosis has a long Pro-rich insert.
Probab=35.73  E-value=5e+02  Score=28.50  Aligned_cols=17  Identities=18%  Similarity=0.196  Sum_probs=8.0

Q ss_pred             HHHHHHHHHHHHHHHHH
Q 008166          198 VEAASLLSISLSFSWQK  214 (575)
Q Consensus       198 i~~~~~is~vls~iwl~  214 (575)
                      ...+.++++++-+++++
T Consensus       250 ~~~a~~ig~ilV~l~~~  266 (397)
T TIGR01129       250 GIKAGLIGLVLVLVFMI  266 (397)
T ss_pred             HHHHHHHHHHHHHHHHH
Confidence            33444555554444444


No 101
>PF15195 TMEM210:  TMEM210 family
Probab=35.62  E-value=45  Score=29.25  Aligned_cols=11  Identities=36%  Similarity=0.567  Sum_probs=6.0

Q ss_pred             CcccccccccC
Q 008166           62 GFNASMMQTLN   72 (575)
Q Consensus        62 ~~~~~~~~~~~   72 (575)
                      ..+++|++-+.
T Consensus        81 DleVsmm~~Le   91 (116)
T PF15195_consen   81 DLEVSMMPPLE   91 (116)
T ss_pred             CccccccCccc
Confidence            34566665543


No 102
>KOG0559 consensus Dihydrolipoamide succinyltransferase (2-oxoglutarate dehydrogenase, E2 subunit) [Energy production and conversion]
Probab=35.05  E-value=81  Score=34.17  Aligned_cols=13  Identities=8%  Similarity=-0.008  Sum_probs=5.0

Q ss_pred             CCCCCCCcccccc
Q 008166           56 INGEQRGFNASMM   68 (575)
Q Consensus        56 ~~~~~~~~~~~~~   68 (575)
                      |+--..|.....+
T Consensus       134 gdtV~~g~~la~i  146 (457)
T KOG0559|consen  134 GDTVTPGQKLAKI  146 (457)
T ss_pred             CCcccCCceeEEe
Confidence            3333344443333


No 103
>KOG2322 consensus N-methyl-D-aspartate receptor glutamate-binding subunit [Signal transduction mechanisms]
Probab=34.95  E-value=5.2e+02  Score=26.52  Aligned_cols=6  Identities=17%  Similarity=0.279  Sum_probs=2.3

Q ss_pred             hhhhhh
Q 008166          381 GSACLG  386 (575)
Q Consensus       381 GSIcfG  386 (575)
                      |++.|-
T Consensus       203 gAllf~  208 (237)
T KOG2322|consen  203 GALLFC  208 (237)
T ss_pred             HHHHHh
Confidence            333333


No 104
>PF02724 CDC45:  CDC45-like protein;  InterPro: IPR003874 CDC45 is an essential gene required for initiation of DNA replication in Saccharomyces cerevisiae (cell division control protein 45), forming a complex with MCM5/CDC46. Homologs of CDC45 have been identified in human [], mouse and the smut fungus, Melampsora spp., (tsd2 protein) among others.; GO: 0006270 DNA-dependent DNA replication initiation
Probab=34.51  E-value=22  Score=41.31  Aligned_cols=7  Identities=14%  Similarity=0.591  Sum_probs=3.5

Q ss_pred             HhHHHhh
Q 008166          435 AYVQIAA  441 (575)
Q Consensus       435 Ayi~iAI  441 (575)
                      .|+.+|+
T Consensus       557 ~~lVvGv  563 (622)
T PF02724_consen  557 TYLVVGV  563 (622)
T ss_pred             eEEEEEe
Confidence            4444555


No 105
>PF15470 DUF4637:  Domain of unknown function (DUF4637)
Probab=33.34  E-value=19  Score=33.77  Aligned_cols=20  Identities=30%  Similarity=0.165  Sum_probs=10.1

Q ss_pred             cccCcccccchHHHHHHHHH
Q 008166          139 ALNSKKYTNKISLFLFVLHM  158 (575)
Q Consensus       139 ~~~s~~~~d~~~~~lF~~~l  158 (575)
                      ++--+|+.+.=+-+.|+.|-
T Consensus       139 ILfCkKC~tLHs~payVaHc  158 (173)
T PF15470_consen  139 ILFCKKCRTLHSHPAYVAHC  158 (173)
T ss_pred             eeeehhhccccCchHHHHHH
Confidence            44445554444555555553


No 106
>PF04625 DEC-1_N:  DEC-1 protein, N-terminal region;  InterPro: IPR006719 The defective chorion-1 gene (dec-1) in Drosophila encodes follicle cell proteins necessary for proper eggshell assembly. Multiple products of the dec-1 gene are formed by alternative RNA splicing and proteolytic processing []. Cleavage products include S80 (80 kDa) which is incorporated into the eggshell, and further proteolysis of S80 gives S60 (60 kDa).  This domain is present at the N-terminal of these proteins.; GO: 0005213 structural constituent of chorion, 0007304 chorion-containing eggshell formation, 0005576 extracellular region, 0042600 chorion
Probab=32.39  E-value=81  Score=33.50  Aligned_cols=9  Identities=33%  Similarity=0.357  Sum_probs=3.6

Q ss_pred             HHHHHHHHh
Q 008166          369 QFCFQRALT  377 (575)
Q Consensus       369 ~~S~~ra~t  377 (575)
                      ++-+.|+++
T Consensus       334 RADIE~ALR  342 (407)
T PF04625_consen  334 RADIERALR  342 (407)
T ss_pred             HHHHHHHHH
Confidence            333444443


No 107
>PRK10649 hypothetical protein; Provisional
Probab=32.33  E-value=2e+02  Score=33.16  Aligned_cols=22  Identities=18%  Similarity=0.288  Sum_probs=15.1

Q ss_pred             HHHHHHHHHHHHHHHhhhhhHH
Q 008166          204 LSISLSFSWQKAVRVWPKFMVH  225 (575)
Q Consensus       204 is~vls~iwl~llr~~~~~~i~  225 (575)
                      =+++++++|+..+-.+|+..-.
T Consensus        48 ~~~~~~~~~~~~~~l~p~~~~~   69 (577)
T PRK10649         48 DALLFSSLWLIPVFLFPRRIRI   69 (577)
T ss_pred             HHHHHHHHHHHHHHHhhHHHHH
Confidence            3666777888777777777443


No 108
>PRK10263 DNA translocase FtsK; Provisional
Probab=32.07  E-value=58  Score=40.88  Aligned_cols=10  Identities=30%  Similarity=0.348  Sum_probs=5.1

Q ss_pred             HHHHHHHHHH
Q 008166          392 TIEALRIVAR  401 (575)
Q Consensus       392 iI~~lR~il~  401 (575)
                      +.+.+|++.+
T Consensus      1075 a~~aLr~lV~ 1084 (1355)
T PRK10263       1075 AANALRWCVN 1084 (1355)
T ss_pred             HHHHHHHHHH
Confidence            3455555553


No 109
>KOG0127 consensus Nucleolar protein fibrillarin NOP77 (RRM superfamily) [RNA processing and modification]
Probab=30.99  E-value=26  Score=39.63  Aligned_cols=20  Identities=20%  Similarity=0.149  Sum_probs=8.9

Q ss_pred             ecCCCccccCCCCCCCCCcc
Q 008166           45 VDSNSNVNINNINGEQRGFN   64 (575)
Q Consensus        45 ~~~~~~~~~~~~~~~~~~~~   64 (575)
                      +|-||..-..++-.|-++..
T Consensus       245 ~D~~se~~ee~~~~Eee~~~  264 (678)
T KOG0127|consen  245 TDGNSEAFEEGEESEEEEDD  264 (678)
T ss_pred             ccccchhhhccccccccccc
Confidence            45555554433333433333


No 110
>PTZ00249 variable surface protein Vir28; Provisional
Probab=30.65  E-value=81  Score=35.53  Aligned_cols=45  Identities=20%  Similarity=0.240  Sum_probs=20.2

Q ss_pred             hhhhhhhcc--cceeeeeeecCCCccccCCCCCCCCCcccccccccCCCCCceE
Q 008166           28 EEVKDVEKG--EVVVEEKVVDSNSNVNINNINGEQRGFNASMMQTLNPTNPLRI   79 (575)
Q Consensus        28 ~~~~~~~~~--~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~~   79 (575)
                      ||+|.|-.-  .+.-+|+---..+.+.--+-||++++-+       ||+||..+
T Consensus       220 ee~k~~~~~~~~~~~~~~~~~~~~s~ss~~~h~r~~~~t-------~~~~~vs~  266 (516)
T PTZ00249        220 EEQKAVTAHAHRRISGEARPPKHISFSSPHAHGRPPVET-------RPPNPVSV  266 (516)
T ss_pred             ccccccchhhhccccccCCCCccccccCchhccCCCccc-------CCCCceec
Confidence            455555422  1223333333333333334555555543       77777544


No 111
>KOG4454 consensus RNA binding protein (RRM superfamily) [General function prediction only]
Probab=30.65  E-value=44  Score=33.77  Aligned_cols=15  Identities=0%  Similarity=-0.239  Sum_probs=9.5

Q ss_pred             CcccccccccCCCCC
Q 008166           62 GFNASMMQTLNPTNP   76 (575)
Q Consensus        62 ~~~~~~~~~~~~~~p   76 (575)
                      ...-.++|++++++|
T Consensus       136 ~~~P~~~~~y~~l~~  150 (267)
T KOG4454|consen  136 CAVPFALDLYQGLEL  150 (267)
T ss_pred             hcCcHHhhhhcccCc
Confidence            334456677777777


No 112
>PRK14849 putative lipoprotein/autotransporter domain-containing protein; Provisional
Probab=30.51  E-value=30  Score=44.39  Aligned_cols=9  Identities=11%  Similarity=0.386  Sum_probs=4.3

Q ss_pred             eeeeeeeee
Q 008166          353 CRVISLYYI  361 (575)
Q Consensus       353 Ag~va~WYF  361 (575)
                      .|+.++||-
T Consensus      1602 vG~YaTWy~ 1610 (1806)
T PRK14849       1602 AGLYATWYQ 1610 (1806)
T ss_pred             EEEEEEEEc
Confidence            344455553


No 113
>PF03153 TFIIA:  Transcription factor IIA, alpha/beta subunit;  InterPro: IPR004855 Transcription factor IIA (TFIIA) is one of several factors that form part of a transcription pre-initiation complex along with RNA polymerase II, the TATA-box-binding protein (TBP) and TBP-associated factors, on the TATA-box sequence upstream of the initiation start site. After initiation, some components of the pre-initiation complex (including TFIIA) remain attached and re-initiate a subsequent round of transcription. TFIIA binds to TBP to stabilise TBP binding to the TATA element. TFIIA also inhibits the cytokine HMGB1 (high mobility group 1 protein) binding to TBP [], and can dissociate HMGB1 already bound to TBP/TATA-box. Human and Drosophila TFIIA have three subunits: two large subunits, LN/alpha and LC/beta, derived from the same gene, and a small subunit, S/gamma. Yeast TFIIA has two subunits: a large TOA1 subunit that shows sequence similarity to the N-terminal of LN/alpha and the C-terminal of LC/beta, and a small subunit, TOA2 that is highly homologous with S/gamma. The conserved regions of the large and small subunits of TFIIA combine to form two domains: a four-helix bundle (helical domain) composed of two helices from each of the N-terminal regions of TOA1 and TOA2 in yeast; and a beta-barrel (beta-barrel domain) composed of beta-sheets from the C-terminal regions of TOA1 and TOA2 []. This entry represents the precursor that yields both the alpha and beta subunits of TFIIA. The TFIIA heterotrimer is an essential general transcription initiation factor for the expression of genes transcribed by RNA polymerase II []. ; GO: 0006367 transcription initiation from RNA polymerase II promoter, 0005672 transcription factor TFIIA complex; PDB: 1NVP_B 1YTF_B 1RM1_C 1NH2_B.
Probab=30.23  E-value=20  Score=38.63  Aligned_cols=18  Identities=28%  Similarity=0.442  Sum_probs=0.0

Q ss_pred             hcccceeeeeeecCCCcc
Q 008166           34 EKGEVVVEEKVVDSNSNV   51 (575)
Q Consensus        34 ~~~~~~~~~~~~~~~~~~   51 (575)
                      ++.+..++|..-||...+
T Consensus       302 ~~~~~~~~~~~~~~~dd~  319 (375)
T PF03153_consen  302 EDDEDAINSDLDDSDDDV  319 (375)
T ss_dssp             ------------------
T ss_pred             ccccccccCCcCCccccc
Confidence            333445555555555444


No 114
>KOG2153 consensus Protein involved in the nuclear export of pre-ribosomes [Translation, ribosomal structure and biogenesis; Intracellular trafficking, secretion, and vesicular transport]
Probab=29.63  E-value=23  Score=40.79  Aligned_cols=24  Identities=13%  Similarity=-0.060  Sum_probs=16.7

Q ss_pred             HHHHHHhcccCCCCcccccchhHHHH
Q 008166          529 SCYYVCYAQNPDNRLFDSTIKDRLSL  554 (575)
Q Consensus       529 dTifvCfaeDpe~~~~~~~~p~~~~~  554 (575)
                      +-.+--+|.+||  +...+-.++|+.
T Consensus       657 ~~~~~~~a~~p~--~s~~sa~~L~~~  680 (704)
T KOG2153|consen  657 VGATGEGALPPE--LSNLSAAELFEQ  680 (704)
T ss_pred             CCccCcCCCCcc--ccCchHHHHhhh
Confidence            344566788888  566677777776


No 115
>PF06409 NPIP:  Nuclear pore complex interacting protein (NPIP);  InterPro: IPR009443 This family consists of a series of primate specific nuclear pore complex interacting protein (NPIP) sequences. The function of this family is unknown but is well conserved from African apes to humans [].
Probab=29.30  E-value=29  Score=35.15  Aligned_cols=8  Identities=13%  Similarity=0.256  Sum_probs=4.1

Q ss_pred             CCCCCCCc
Q 008166           56 INGEQRGF   63 (575)
Q Consensus        56 ~~~~~~~~   63 (575)
                      +|||..|.
T Consensus       200 eh~hssgl  207 (265)
T PF06409_consen  200 EHHHSSGL  207 (265)
T ss_pred             HhccCCCC
Confidence            45555553


No 116
>KOG2141 consensus Protein involved in high osmolarity signaling pathway [Signal transduction mechanisms]
Probab=29.29  E-value=58  Score=38.16  Aligned_cols=11  Identities=45%  Similarity=0.908  Sum_probs=7.0

Q ss_pred             chhHHHHHHHH
Q 008166          411 EFMFSCAHCCL  421 (575)
Q Consensus       411 ~~l~~c~~C~l  421 (575)
                      ++..-.++||+
T Consensus       653 EI~~VllhC~l  663 (822)
T KOG2141|consen  653 EIARVLLHCCL  663 (822)
T ss_pred             HHHHHHHHHHh
Confidence            55566677765


No 117
>PF14816 FAM178:  Family of unknown function, FAM178
Probab=28.29  E-value=22  Score=38.63  Aligned_cols=23  Identities=13%  Similarity=0.089  Sum_probs=16.6

Q ss_pred             CccccCCCCCCCCCccccccccc
Q 008166           49 SNVNINNINGEQRGFNASMMQTL   71 (575)
Q Consensus        49 ~~~~~~~~~~~~~~~~~~~~~~~   71 (575)
                      -+|..+.+-+.|+|-.++++.+.
T Consensus        74 fsv~~~~Ip~~HPGE~IF~~~~~   96 (377)
T PF14816_consen   74 FSVSLQAIPDVHPGEEIFNLSKS   96 (377)
T ss_pred             hchhhccCCCCCCchhhcCcccc
Confidence            34446788899999999865544


No 118
>PHA03160 hypothetical protein; Provisional
Probab=28.28  E-value=42  Score=37.55  Aligned_cols=10  Identities=30%  Similarity=0.418  Sum_probs=4.1

Q ss_pred             hhhhhhhhhc
Q 008166           10 RETQNKEEEE   19 (575)
Q Consensus        10 ~~~~~~~~~~   19 (575)
                      |-..||+||+
T Consensus       327 ~~~krkree~  336 (499)
T PHA03160        327 RPNKRKREDF  336 (499)
T ss_pred             cccccccccc
Confidence            3344444433


No 119
>KOG2181 consensus LIM domain binding protein LDB1/NLI/CLIM [Transcription]
Probab=27.73  E-value=96  Score=32.84  Aligned_cols=24  Identities=29%  Similarity=0.328  Sum_probs=16.9

Q ss_pred             cCCCCCCCCCcccccccccCCCCC
Q 008166           53 INNINGEQRGFNASMMQTLNPTNP   76 (575)
Q Consensus        53 ~~~~~~~~~~~~~~~~~~~~~~~p   76 (575)
                      .+..|++|.|+.-++-|.-||..-
T Consensus       358 ~~~~n~~~~g~~~sP~~g~np~~~  381 (415)
T KOG2181|consen  358 RNMMNQHHPGMQPSPGQGHNPPHS  381 (415)
T ss_pred             ccchhccCCCCCCCccccCCCcch
Confidence            355677777777777777777654


No 120
>PF05053 Menin:  Menin;  InterPro: IPR007747 MEN1, the gene responsible for multiple endocrine neoplasia type 1, is a tumour suppressor gene that encodes a protein called Menin which may be an atypical GTPase stimulated by nm23 [].; GO: 0005634 nucleus; PDB: 3RE2_A 3U84_B 3U86_A 3U88_B 3U85_A.
Probab=27.42  E-value=16  Score=41.52  Aligned_cols=8  Identities=38%  Similarity=0.389  Sum_probs=3.0

Q ss_pred             ccccCccc
Q 008166          138 TALNSKKY  145 (575)
Q Consensus       138 ~~~~s~~~  145 (575)
                      -.+.|.|.
T Consensus       559 i~l~S~KM  566 (618)
T PF05053_consen  559 ITLYSQKM  566 (618)
T ss_dssp             CC--SHHH
T ss_pred             EEeehHHH
Confidence            34455554


No 121
>KOG1834 consensus Calsyntenin [Extracellular structures]
Probab=27.40  E-value=30  Score=39.93  Aligned_cols=6  Identities=17%  Similarity=-0.025  Sum_probs=2.2

Q ss_pred             cccccc
Q 008166           64 NASMMQ   69 (575)
Q Consensus        64 ~~~~~~   69 (575)
                      |+.|.+
T Consensus       936 n~~Rq~  941 (952)
T KOG1834|consen  936 NNQRQV  941 (952)
T ss_pred             ccceee
Confidence            333333


No 122
>PF01698 FLO_LFY:  Floricaula / Leafy protein;  InterPro: IPR002910 This family consists of various plant development proteins which are homologues of Floricaula (FLO) and leafy (LFY) proteins which are floral meristem identity proteins. Mutations in the sequences of these proteins affect flower and leaf development.; GO: 0003677 DNA binding, 0006355 regulation of transcription, DNA-dependent; PDB: 2VY1_A 2VY2_A.
Probab=27.25  E-value=21  Score=38.74  Aligned_cols=8  Identities=13%  Similarity=-0.155  Sum_probs=0.0

Q ss_pred             hhhhHHhh
Q 008166          187 EKRVLKYL  194 (575)
Q Consensus       187 ~~~dl~~~  194 (575)
                      ++.|+.++
T Consensus        85 ELDdmM~s   92 (386)
T PF01698_consen   85 ELDDMMNS   92 (386)
T ss_dssp             --------
T ss_pred             HHHHHHHH
Confidence            55665554


No 123
>KOG2652 consensus RNA polymerase II transcription initiation factor TFIIA, large chain [Transcription]
Probab=27.08  E-value=34  Score=36.56  Aligned_cols=8  Identities=50%  Similarity=0.675  Sum_probs=3.1

Q ss_pred             eeeeeecC
Q 008166           40 VEEKVVDS   47 (575)
Q Consensus        40 ~~~~~~~~   47 (575)
                      +||.-.+|
T Consensus       289 ~Eeeplns  296 (348)
T KOG2652|consen  289 VEEEPLNS  296 (348)
T ss_pred             cccccccC
Confidence            34443333


No 124
>PHA03356 tegument protein UL11; Provisional
Probab=26.75  E-value=1.3e+02  Score=25.82  Aligned_cols=6  Identities=50%  Similarity=0.850  Sum_probs=5.0

Q ss_pred             ceEEEe
Q 008166           77 LRIVIN   82 (575)
Q Consensus        77 ~~~~~~   82 (575)
                      |||++|
T Consensus        52 lrvVTq   57 (93)
T PHA03356         52 LRVVTQ   57 (93)
T ss_pred             ceEEec
Confidence            788887


No 125
>PF05858 BIV_Env:  Bovine immunodeficiency virus surface protein (SU);  InterPro: IPR008411 (Bovine immunodeficiency virus) (BIV), like the human immunodeficiency virus, is a lentivirus. It shows a great deal of genomic diversity, mostly in the viral envelope gene []. This property of the BIV group of viruses may play an important role in the pathobiology of the virus, particularly the conserved (C) 2, hypervariable (V) 1, V2 and C3 regions []. The surface protein (SU) attaches the virus to the host cell by binding to its receptor. This interaction triggers the refolding of the transmembrane protein (TM) and is thought to activate its fusogenic potential by unmasking its fusion peptide. Fusion occurs at the host cell plasma membrane. The transmembrane protein (TM) acts as a class I viral fusion protein. Under the current model, the protein has at least 3 conformational states: pre-fusion native state, pre-hairpin intermediate state, and post-fusion hairpin state. During viral and target cell membrane fusion, the coiled coil regions (heptad repeats) assume a trimer-of-hairpins structure, positioning the fusion peptide in close proximity to the C-terminal region of the ectodomain. The formation of this structure appears to drive apposition and subsequent fusion of viral and target cell membranes. Membranes fusion leads to delivery of the nucleocapsid into the cytoplasm. ; GO: 0016021 integral to membrane, 0030120 vesicle coat
Probab=26.48  E-value=19  Score=39.31  Aligned_cols=33  Identities=24%  Similarity=0.392  Sum_probs=19.6

Q ss_pred             hhhhhhhhhcCCCCCCCc--hhhhhhhcccceeee
Q 008166           10 RETQNKEEEEGGGEGGGE--EEVKDVEKGEVVVEE   42 (575)
Q Consensus        10 ~~~~~~~~~~~~~~~~~~--~~~~~~~~~~~~~~~   42 (575)
                      .|+.|+|++|++||.|+-  --|||++||.-.-.|
T Consensus         3 qdl~r~ErgE~~G~s~elr~LlQe~i~~grLT~rE   37 (548)
T PF05858_consen    3 QDLDRVERGEGEGRSEELRDLLQEDIDKGRLTARE   37 (548)
T ss_pred             ccccccccccccCCcchHHHHHHHHhhcCcccHHH
Confidence            355667766666555442  247888888643333


No 126
>PHA03378 EBNA-3B; Provisional
Probab=26.46  E-value=2.1e+02  Score=33.64  Aligned_cols=10  Identities=30%  Similarity=0.594  Sum_probs=4.3

Q ss_pred             CCCccccccc
Q 008166          130 PTPQQASRTA  139 (575)
Q Consensus       130 ~~~~~~~~~~  139 (575)
                      |+||-++.+.
T Consensus       778 ~pPq~~P~~~  787 (991)
T PHA03378        778 PPPQAPPAPQ  787 (991)
T ss_pred             CCCCCCCccc
Confidence            3444444443


No 127
>PF05350 GSK-3_bind:  Glycogen synthase kinase-3 binding;  InterPro: IPR008014 Glycogen synthase kinase-3 (GSK-3) sequentially phosphorylates four serine residues on glycogen synthase (GS), in the sequence SxxxSxxxSxxx-SxxxS(p), by recognising and phosphorylating the first serine in the sequence motif SxxxS(P) (where S(p) represents a phosphoserine). Interaction of GSK-3 with a peptide derived from GSK-3 binding protein prevents GSK-3 interaction with Axin. This interaction thereby inhibits the Axin-dependent phosphorylation of beta-catenin by GSK-3 [].; PDB: 1GNG_Y 3ZRM_X 3ZRK_Y 4AFJ_Y 3ZRL_Y.
Probab=26.38  E-value=22  Score=35.29  Aligned_cols=13  Identities=69%  Similarity=0.969  Sum_probs=0.0

Q ss_pred             hhcCCCCCCCchh
Q 008166           17 EEEGGGEGGGEEE   29 (575)
Q Consensus        17 ~~~~~~~~~~~~~   29 (575)
                      |||.+.|.++|||
T Consensus         8 ~~e~g~~~~g~e~   20 (217)
T PF05350_consen    8 EEEAGEEAEGEEE   20 (217)
T ss_dssp             -------------
T ss_pred             hhcccccccCccc
Confidence            4444444444433


No 128
>KOG3397 consensus Acetyltransferases [General function prediction only]
Probab=26.23  E-value=78  Score=31.00  Aligned_cols=6  Identities=17%  Similarity=0.180  Sum_probs=2.3

Q ss_pred             cCCCCC
Q 008166           71 LNPTNP   76 (575)
Q Consensus        71 ~~~~~p   76 (575)
                      +++..|
T Consensus       159 ~~~~a~  164 (225)
T KOG3397|consen  159 QNAAAS  164 (225)
T ss_pred             hccccC
Confidence            344333


No 129
>KOG1984 consensus Vesicle coat complex COPII, subunit SFB3 [Intracellular trafficking, secretion, and vesicular transport]
Probab=25.81  E-value=1.1e+02  Score=36.63  Aligned_cols=28  Identities=29%  Similarity=0.083  Sum_probs=16.2

Q ss_pred             hchhhHhHHHhhc------------CCchhHhHHHHHHHH
Q 008166          430 CGNGWAYVQIAAY------------GKGFVQASQDTWALF  457 (575)
Q Consensus       430 y~N~~Ayi~iAI~------------G~~F~~SAk~a~~L~  457 (575)
                      |+..+|||=+|--            =+...+|=+|..+|.
T Consensus       608 F~t~~ayvDvAtlg~v~~~TgG~vy~Y~~F~a~~D~~rl~  647 (1007)
T KOG1984|consen  608 FLTPNAYVDVATLGVVPALTGGQVYKYYPFQALTDGPRLL  647 (1007)
T ss_pred             EEcccceeeeeeecccccccCceeEEecchhhcccHHHHH
Confidence            5666777766533            234446666666663


No 130
>PF10529 Hist_rich_Ca-bd:  Histidine-rich Calcium-binding repeat region;  InterPro: IPR019552  This entry represents a histidine-rich calcium-binding repeat which appears in proteins called histidine-rich-calcium binding proteins (HRC). HRC is a high capacity, low affinity Ca2+-binding protein, residing in the lumen of the sarcoplasmic reticulum. HRC binds directly to triadin. This binding interaction occurs between the histidine-rich region of HRC and multiple clusters of charged amino acids, named KEKE motifs, in the lumenal domain of triadin. This repeat is found in the acidic region of the protein, which can be long and variable. There is also a cysteine-rich region further towards the C terminus []. HRC may regulate sarcoplasmic reticular calcium transport, play a critical role in maintaining calcium homeostasis, and function in the heart. HRC is a candidate regulator of sarcoplasmic reticular calcium uptake. 
Probab=25.81  E-value=31  Score=20.21  Aligned_cols=8  Identities=25%  Similarity=0.397  Sum_probs=3.2

Q ss_pred             CCCCCCch
Q 008166           21 GGEGGGEE   28 (575)
Q Consensus        21 ~~~~~~~~   28 (575)
                      |+++|+||
T Consensus         5 gH~~eeDe   12 (15)
T PF10529_consen    5 GHREEEDE   12 (15)
T ss_pred             cccccccc
Confidence            34443333


No 131
>KOG4514 consensus Uncharacterized conserved protein [Function unknown]
Probab=25.47  E-value=94  Score=30.50  Aligned_cols=13  Identities=23%  Similarity=0.235  Sum_probs=5.4

Q ss_pred             Ccchhhhhhhhhh
Q 008166            5 DPVVERETQNKEE   17 (575)
Q Consensus         5 ~~~~~~~~~~~~~   17 (575)
                      +|+-..+.-|+|.
T Consensus         8 ~~~~~~~~~~g~k   20 (222)
T KOG4514|consen    8 IPGSTKTRPNGEK   20 (222)
T ss_pred             CCCCcccccchhh
Confidence            3444344444443


No 132
>PRK14954 DNA polymerase III subunits gamma and tau; Provisional
Probab=25.44  E-value=1.3e+02  Score=34.98  Aligned_cols=6  Identities=17%  Similarity=0.119  Sum_probs=2.4

Q ss_pred             HHhhHH
Q 008166          191 LKYLLP  196 (575)
Q Consensus       191 l~~~~~  196 (575)
                      ++.-|.
T Consensus       505 l~~~w~  510 (620)
T PRK14954        505 LRMEWN  510 (620)
T ss_pred             HHHHHH
Confidence            333444


No 133
>PF05086 Dicty_REP:  Dictyostelium (Slime Mold) REP protein;  InterPro: IPR007778 This family consists of REP proteins from a number of Dictyostelium species (Slime molds). REP protein is probably involved in transcription regulation and control of DNA replication, specifically the amplification of plasmid at low copy numbers. The formation of homomultimers may be required for their regulatory activity [].
Probab=24.92  E-value=1.4e+02  Score=35.46  Aligned_cols=23  Identities=17%  Similarity=0.091  Sum_probs=11.4

Q ss_pred             HHHHHHHHHHhhhh-cCcchhhHH
Q 008166          278 CCKVLIISLQPVSK-FSDLNQPTY  300 (575)
Q Consensus       278 ai~iLk~As~~i~~-~p~l~~~~i  300 (575)
                      ...++..|.+..-+ +.-+++++.
T Consensus       424 s~evf~l~k~l~~eKntNilipT~  447 (911)
T PF05086_consen  424 SDEVFDLSKRLSFEKNTNILIPTQ  447 (911)
T ss_pred             cHHHHHHhhheEeeccccEEeeec
Confidence            34555555554433 555554443


No 134
>KOG1146 consensus Homeobox protein [General function prediction only]
Probab=24.52  E-value=1.9e+02  Score=36.35  Aligned_cols=14  Identities=7%  Similarity=0.059  Sum_probs=7.7

Q ss_pred             HHHHHHHHhcccCC
Q 008166          527 CVSCYYVCYAQNPD  540 (575)
Q Consensus       527 ~VdTifvCfaeDpe  540 (575)
                      .+-++|.|+..+++
T Consensus       917 ~i~~~~~~q~~~~~  930 (1406)
T KOG1146|consen  917 IIKACYEAQRTPTM  930 (1406)
T ss_pred             HHHHHHhhccCChH
Confidence            45555666655554


No 135
>KOG0341 consensus DEAD-box protein abstrakt [RNA processing and modification]
Probab=24.35  E-value=33  Score=37.56  Aligned_cols=46  Identities=15%  Similarity=0.063  Sum_probs=29.4

Q ss_pred             HHHhchhhHhHHHhhcCCchhHhHHHHHHHHHhcCCcceehhchhH
Q 008166          427 IFRCGNGWAYVQIAAYGKGFVQASQDTWALFERQEMEPIVDSDITS  472 (575)
Q Consensus       427 ~l~y~N~~Ayi~iAI~G~~F~~SAk~a~~L~~~n~~~alv~d~l~~  472 (575)
                      +-+|+=--..=-+||||-.=-+--..+.+.|+.+--+.+|.-|+.+
T Consensus       437 IhEYLLlKGVEavaIHGGKDQedR~~ai~afr~gkKDVLVATDVAS  482 (610)
T KOG0341|consen  437 IHEYLLLKGVEAVAIHGGKDQEDRHYAIEAFRAGKKDVLVATDVAS  482 (610)
T ss_pred             HHHHHHHccceeEEeecCcchhHHHHHHHHHhcCCCceEEEecchh
Confidence            3444444444457999987777667778888776666666554543


No 136
>PF12273 RCR:  Chitin synthesis regulation, resistance to Congo red;  InterPro: IPR020999  RCR proteins are ER membrane proteins that regulate chitin deposition in fungal cell walls. Although chitin, a linear polymer of beta-1,4-linked N-acetylglucosamine, constitutes only 2% of the cell wall it plays a vital role in the overall protection of the cell wall against stress, noxious chemicals and osmotic pressure changes. Congo red is a cell wall-disrupting benzidine-type dye extensively used in many cell wall mutant studies that specifically targets chitin in yeast cells and inhibits growth. RCR proteins render the yeasts resistant to Congo red by diminishing the content of chitin in the cell wall []. RCR proteins are probably regulating chitin synthase III interact directly with ubiquitin ligase Rsp5, and the VPEY motif is necessary for this, via interaction with the WW domains of Rsp5 []. 
Probab=23.83  E-value=67  Score=29.34  Aligned_cols=6  Identities=17%  Similarity=0.025  Sum_probs=3.0

Q ss_pred             hhhhHH
Q 008166          271 VSQRIG  276 (575)
Q Consensus       271 ~r~RI~  276 (575)
                      .|||.+
T Consensus        23 ~rRR~r   28 (130)
T PF12273_consen   23 NRRRRR   28 (130)
T ss_pred             HHHHhh
Confidence            355554


No 137
>PF01698 FLO_LFY:  Floricaula / Leafy protein;  InterPro: IPR002910 This family consists of various plant development proteins which are homologues of Floricaula (FLO) and leafy (LFY) proteins which are floral meristem identity proteins. Mutations in the sequences of these proteins affect flower and leaf development.; GO: 0003677 DNA binding, 0006355 regulation of transcription, DNA-dependent; PDB: 2VY1_A 2VY2_A.
Probab=23.81  E-value=26  Score=37.98  Aligned_cols=10  Identities=30%  Similarity=0.853  Sum_probs=4.4

Q ss_pred             HHHHH-HHHHH
Q 008166          416 CAHCC-LRIME  425 (575)
Q Consensus       416 c~~C~-l~~le  425 (575)
                      .++|. |.|++
T Consensus       305 yvhcyalhcld  315 (386)
T PF01698_consen  305 YVHCYALHCLD  315 (386)
T ss_dssp             CHHHHHHHHH-
T ss_pred             heeeeeeeccC
Confidence            44443 46664


No 138
>PF05399 EVI2A:  Ectropic viral integration site 2A protein (EVI2A);  InterPro: IPR008608 This family contains several mammalian ectropic viral integration site 2A (EVI2A) proteins. The function of this protein is unknown although it is thought to be a membrane protein and may function as an oncogene in retrovirus induced myeloid tumours [, ].; GO: 0016021 integral to membrane
Probab=23.66  E-value=2.9e+02  Score=27.86  Aligned_cols=18  Identities=22%  Similarity=0.150  Sum_probs=11.5

Q ss_pred             cccccccCcccccchHHH
Q 008166          135 ASRTALNSKKYTNKISLF  152 (575)
Q Consensus       135 ~~~~~~~s~~~~d~~~~~  152 (575)
                      +..|--+..|+--.+|.+
T Consensus       118 k~~CEen~~K~amLIClI  135 (227)
T PF05399_consen  118 KEICEENNNKMAMLICLI  135 (227)
T ss_pred             hhhhhcCccchhHHHHHH
Confidence            455555666776667766


No 139
>KOG4425 consensus Uncharacterized conserved protein [Function unknown]
Probab=23.63  E-value=1.1e+02  Score=34.18  Aligned_cols=8  Identities=0%  Similarity=0.044  Sum_probs=3.2

Q ss_pred             cccccCCC
Q 008166           67 MMQTLNPT   74 (575)
Q Consensus        67 ~~~~~~~~   74 (575)
                      -|-||.++
T Consensus        38 alkm~grp   45 (900)
T KOG4425|consen   38 ALKMQGRP   45 (900)
T ss_pred             HHhhcCCC
Confidence            34444443


No 140
>KOG3415 consensus Putative Rab5-interacting protein [Intracellular trafficking, secretion, and vesicular transport]
Probab=23.56  E-value=5.7e+02  Score=23.35  Aligned_cols=47  Identities=30%  Similarity=0.492  Sum_probs=28.9

Q ss_pred             chhhhhhHHhhHHHHHHHHHHHHHHHHHHHHHHHHhhhhhHHHHHHHHHHHHHHHHHHH
Q 008166          184 KRKEKRVLKYLLPQVEAASLLSISLSFSWQKAVRVWPKFMVHFILWSSFFLSLSAGILL  242 (575)
Q Consensus       184 ~~~~~~dl~~~~~~i~~~~~is~vls~iwl~llr~~~~~~i~~~vw~~iil~~~~~i~~  242 (575)
                      ++.++.|..++...+     ++++++++|=.+      .+.++ +|+..++.+..++.+
T Consensus        37 DKdellDViyW~rQV-----i~l~lGviwGi~------pL~G~-l~iv~f~~issgIvy   83 (129)
T KOG3415|consen   37 DKDELLDVIYWIRQV-----IGLILGVIWGII------PLVGF-LGIVLFLGISSGIVY   83 (129)
T ss_pred             CHHHHHHHHHHHHHH-----HHHHHHHHHhhc------hhhhH-HHHHHHHHhhhhHHH
Confidence            345778888877655     577778887542      22222 466666666666653


No 141
>PF12868 DUF3824:  Domain of unknwon function (DUF3824);  InterPro: IPR024436 This repeating domain is proline-rich but its function is unknown.
Probab=23.56  E-value=3.7e+02  Score=25.18  Aligned_cols=13  Identities=38%  Similarity=0.506  Sum_probs=5.2

Q ss_pred             hhhhhhhhhcCCC
Q 008166           10 RETQNKEEEEGGG   22 (575)
Q Consensus        10 ~~~~~~~~~~~~~   22 (575)
                      |..+||||.|-+.
T Consensus        29 rk~kK~~erer~r   41 (137)
T PF12868_consen   29 RKEKKKEERERER   41 (137)
T ss_pred             HHhhhhhhhcccc
Confidence            4444444433333


No 142
>PF15324 TALPID3:  Hedgehog signalling target
Probab=22.56  E-value=1.6e+02  Score=36.21  Aligned_cols=22  Identities=23%  Similarity=0.108  Sum_probs=11.2

Q ss_pred             hhcccceeeeeeecCCCccccC
Q 008166           33 VEKGEVVVEEKVVDSNSNVNIN   54 (575)
Q Consensus        33 ~~~~~~~~~~~~~~~~~~~~~~   54 (575)
                      ||.-.|---.-.||..--||-+
T Consensus       874 Ve~~~ggglQLfVDAGvPVdsd  895 (1252)
T PF15324_consen  874 VEAAGGGGLQLFVDAGVPVDSD  895 (1252)
T ss_pred             hhhccCceeEEEEeCCCCCCHH
Confidence            4432333345567766666644


No 143
>KOG2147 consensus Nucleolar protein involved in 40S ribosome biogenesis [Translation, ribosomal structure and biogenesis]
Probab=22.52  E-value=54  Score=38.47  Aligned_cols=19  Identities=32%  Similarity=0.468  Sum_probs=13.6

Q ss_pred             hhhcccceeeeeeecCCCc
Q 008166           32 DVEKGEVVVEEKVVDSNSN   50 (575)
Q Consensus        32 ~~~~~~~~~~~~~~~~~~~   50 (575)
                      |+++|.+..+|..+++++-
T Consensus       314 ~~ddgk~l~~ED~~e~~~~  332 (823)
T KOG2147|consen  314 DFDDGKGLEEEDTVEKSSI  332 (823)
T ss_pred             ccccccccccccchhhccc
Confidence            5667778888888866553


No 144
>KOG3655 consensus Drebrins and related actin binding proteins [Cytoskeleton]
Probab=22.46  E-value=1.5e+02  Score=33.09  Aligned_cols=119  Identities=21%  Similarity=0.273  Sum_probs=0.0

Q ss_pred             CCCCcchhhhhhhhhhhcCCCCCCCchhhhhhhcccceeeeeeecCCCccccCCCCCCCCCccccccc----ccCC---C
Q 008166            2 GASDPVVERETQNKEEEEGGGEGGGEEEVKDVEKGEVVVEEKVVDSNSNVNINNINGEQRGFNASMMQ----TLNP---T   74 (575)
Q Consensus         2 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~----~~~~---~   74 (575)
                      ++++|-.+|..+-+|..-.--++++++-++-.+.++-.++.| +|+--.+-+-+      +.-..-++    .--|   .
T Consensus       238 ~k~e~q~~~~s~~~~~~~~~~~e~~~~~~~k~~~a~~~i~~k-~~~~~~~fkqk------e~~~~~~~~s~~~~~P~~~~  310 (484)
T KOG3655|consen  238 LKAEPQPRRWSEQNEIFGRNRDEEEETHMKKSEEAAAIISQK-VDSPREFFKQK------ERVLSASAGSCDVESPFNHR  310 (484)
T ss_pred             cccCcCCCCcchhcchhhcccCHHHHhHhhhhHHHHhHhhcc-CCCcccccchh------cccccccccCCCCCCcccCC


Q ss_pred             CCceEEEeCcccccCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q 008166           75 NPLRIVINGGRRVTAPRIATPPPSQPSRQAPRIATPPPSQPSRPRSISTSPPAPTPTP  132 (575)
Q Consensus        75 ~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  132 (575)
                      -|.|.-.+   |...|-  |+++.+|++++...-|+-+..|+..-..+-.-|+|||+|
T Consensus       311 ~~~r~~~~---~~~~P~--~~~~pt~p~~a~~~ep~aa~~~~~~~e~~~~~P~p~p~P  363 (484)
T KOG3655|consen  311 PGPRLRSH---RRNAPT--PISTPTPPDTATEAEPVAAAIPRTLAEVPSSQPAPPPPP  363 (484)
T ss_pred             CCcccccc---cccCCC--CCCCCCCCcccccCCCcccCCCccccCCcccCCCCCCCc


No 145
>PF05756 S-antigen:  S-antigen protein;  InterPro: IPR008825  S-antigens are heat stable proteins that are found in the blood of individuals infected with malaria [].
Probab=22.16  E-value=47  Score=28.05  Aligned_cols=11  Identities=27%  Similarity=0.374  Sum_probs=4.5

Q ss_pred             hhhhcCCCCCC
Q 008166           15 KEEEEGGGEGG   25 (575)
Q Consensus        15 ~~~~~~~~~~~   25 (575)
                      +.|+|+|+|++
T Consensus        63 e~egenddeed   73 (94)
T PF05756_consen   63 EKEGENDDEED   73 (94)
T ss_pred             hccCCCccccc
Confidence            33344444433


No 146
>PF12526 DUF3729:  Protein of unknown function (DUF3729) ;  InterPro: IPR022202  This domain of unknown function is found in viruses. Proteins in this family are typically between 145 and 1707 amino acids in length. The family is found in association with PF01443 from PFAM, PF01661 from PFAM, PF05417 from PFAM, PF01660 from PFAM, PF00978 from PFAM. There is a single completely conserved residue L that may be functionally important. 
Probab=21.97  E-value=2.1e+02  Score=26.03  Aligned_cols=11  Identities=27%  Similarity=0.715  Sum_probs=4.5

Q ss_pred             CCCCCCCCCCC
Q 008166          121 ISTSPPAPTPT  131 (575)
Q Consensus       121 ~~~~~~~~~~~  131 (575)
                      .+++++.+.++
T Consensus        88 ~~P~pPvr~pp   98 (113)
T PF12526_consen   88 TTPPPPVRKPP   98 (113)
T ss_pred             CCCCCCCCCCC
Confidence            34444444333


No 147
>PF15345 TMEM51:  Transmembrane protein 51
Probab=21.84  E-value=1.5e+02  Score=30.25  Aligned_cols=13  Identities=31%  Similarity=0.493  Sum_probs=6.1

Q ss_pred             CCCCCCCCCCCCC
Q 008166           94 TPPPSQPSRQAPR  106 (575)
Q Consensus        94 ~~~~~~~~~~~~~  106 (575)
                      |++.+.|.|+.+|
T Consensus       174 p~~g~~p~R~~Sr  186 (233)
T PF15345_consen  174 PSTGSPPNRSNSR  186 (233)
T ss_pred             CCCCCCcccccCh
Confidence            3344445555554


No 148
>PF10669 Phage_Gp23:  Protein gp23 (Bacteriophage A118);  InterPro: IPR018926  This entry is represented by the major tail subunit protein, Gp23 of Listeria phage A118 and prophage found in Bacilli. The function is currently unknown. 
Probab=21.39  E-value=27  Score=30.72  Aligned_cols=19  Identities=26%  Similarity=0.317  Sum_probs=10.5

Q ss_pred             hhhhhhhhcCCCCCCCchh
Q 008166           11 ETQNKEEEEGGGEGGGEEE   29 (575)
Q Consensus        11 ~~~~~~~~~~~~~~~~~~~   29 (575)
                      |.+++|+++++-|-|.+||
T Consensus        51 ER~K~E~~~q~r~rES~~E   69 (121)
T PF10669_consen   51 ERSKKEEKRQKRNRESKRE   69 (121)
T ss_pred             HHHHHHHHHHHHhhhhHHH
Confidence            5566666665555444433


No 149
>PHA03132 thymidine kinase; Provisional
Probab=20.86  E-value=2.6e+02  Score=32.41  Aligned_cols=12  Identities=17%  Similarity=0.019  Sum_probs=4.9

Q ss_pred             HHhchhhHhHHH
Q 008166          428 FRCGNGWAYVQI  439 (575)
Q Consensus       428 l~y~N~~Ayi~i  439 (575)
                      ++||..---+.+
T Consensus       452 lqyf~~e~~v~~  463 (580)
T PHA03132        452 LQYFTPEDIVQV  463 (580)
T ss_pred             hcCCChHHHHHH
Confidence            344444443333


No 150
>PTZ00163 hypothetical protein; Provisional
Probab=20.80  E-value=40  Score=32.19  Aligned_cols=13  Identities=38%  Similarity=0.708  Sum_probs=8.3

Q ss_pred             CCCCcchhhhhhhh
Q 008166            2 GASDPVVERETQNK   15 (575)
Q Consensus         2 ~~~~~~~~~~~~~~   15 (575)
                      |.+.|.. ||..+.
T Consensus        67 gnknpq~-r~~k~e   79 (230)
T PTZ00163         67 GNKNPQK-RERKNE   79 (230)
T ss_pred             CCCChhh-ccccch
Confidence            6677777 776443


No 151
>KOG0577 consensus Serine/threonine protein kinase [Signal transduction mechanisms]
Probab=20.57  E-value=2.3e+02  Score=33.22  Aligned_cols=12  Identities=17%  Similarity=0.315  Sum_probs=5.8

Q ss_pred             ccCCCCCceEEE
Q 008166           70 TLNPTNPLRIVI   81 (575)
Q Consensus        70 ~~~~~~p~~~~~   81 (575)
                      +..|+.|-...+
T Consensus       391 ~~gpp~p~~amm  402 (948)
T KOG0577|consen  391 EEGPPAPEMAMM  402 (948)
T ss_pred             hcCCCCchhhhh
Confidence            345555554443


No 152
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones]
Probab=20.30  E-value=50  Score=36.56  Aligned_cols=34  Identities=18%  Similarity=0.215  Sum_probs=22.6

Q ss_pred             hhhhhhhhhcCCCCCCCchhhhhhhcccceeeee
Q 008166           10 RETQNKEEEEGGGEGGGEEEVKDVEKGEVVVEEK   43 (575)
Q Consensus        10 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   43 (575)
                      |-.++-|.++.+-+--||+|+.|||+.+|.-||.
T Consensus       509 ~Gl~~lEK~~~~~DATdE~D~~~V~D~~G~~EE~  542 (564)
T KOG1174|consen  509 RGLRLLEKSDDESDATDESDQQSVNDLTGLCEET  542 (564)
T ss_pred             HHHHHHHhccCCCCccccccccchhhccCcchhh
Confidence            3445556666666667777777888887755553


No 153
>KOG0943 consensus Predicted ubiquitin-protein ligase/hyperplastic discs protein, HECT superfamily [Posttranslational modification, protein turnover, chaperones]
Probab=20.25  E-value=85  Score=39.01  Aligned_cols=17  Identities=6%  Similarity=0.221  Sum_probs=10.6

Q ss_pred             HHHHHHHHHHHHHhhhh
Q 008166          275 IGFCCKVLIISLQPVSK  291 (575)
Q Consensus       275 I~~ai~iLk~As~~i~~  291 (575)
                      +.++-++++.+.+--+.
T Consensus      2115 LhY~hSLlRlanDEakD 2131 (3015)
T KOG0943|consen 2115 LHYAHSLLRLANDEAKD 2131 (3015)
T ss_pred             HHHHHHHHHhccccccc
Confidence            66677777766654433


No 154
>PRK06975 bifunctional uroporphyrinogen-III synthetase/uroporphyrin-III C-methyltransferase; Reviewed
Probab=20.21  E-value=1.6e+02  Score=34.56  Aligned_cols=53  Identities=17%  Similarity=0.337  Sum_probs=0.0

Q ss_pred             cccccCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCcccc
Q 008166           84 GRRVTAPRIATPPPSQPSRQAPRIATPPPSQPSRPRSISTSPPAPTPTPQQAS  136 (575)
Q Consensus        84 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  136 (575)
                      +++..+.+.+|-+.......++-+++|.|.+++..+++++.||.+++.+++..
T Consensus       267 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  319 (656)
T PRK06975        267 DAAAQPATAAPAPSRMTDTNDSKSVTSQPAAAAAAPAPPPNPPATPPEPPARR  319 (656)
T ss_pred             hcccCCcccCCCCCCCCCCCcccCCCCCCCCCCcCCCCCCCCCCCCcCCcccc


No 155
>PF05086 Dicty_REP:  Dictyostelium (Slime Mold) REP protein;  InterPro: IPR007778 This family consists of REP proteins from a number of Dictyostelium species (Slime molds). REP protein is probably involved in transcription regulation and control of DNA replication, specifically the amplification of plasmid at low copy numbers. The formation of homomultimers may be required for their regulatory activity [].
Probab=20.17  E-value=1.4e+02  Score=35.47  Aligned_cols=6  Identities=17%  Similarity=0.063  Sum_probs=3.0

Q ss_pred             cCCCCC
Q 008166           71 LNPTNP   76 (575)
Q Consensus        71 ~~~~~p   76 (575)
                      ..++|+
T Consensus       250 ~~~~~~  255 (911)
T PF05086_consen  250 SKRPNK  255 (911)
T ss_pred             CCCCCC
Confidence            345555


No 156
>PF13388 DUF4106:  Protein of unknown function (DUF4106)
Probab=20.15  E-value=2e+02  Score=30.35  Aligned_cols=12  Identities=25%  Similarity=0.553  Sum_probs=4.9

Q ss_pred             CCCCCCCCCCCc
Q 008166          122 STSPPAPTPTPQ  133 (575)
Q Consensus       122 ~~~~~~~~~~~~  133 (575)
                      .+||-.+-|.+|
T Consensus       237 nQQpTvQNpaQQ  248 (422)
T PF13388_consen  237 NQQPTVQNPAQQ  248 (422)
T ss_pred             ccCCCCCCcccC
Confidence            344444433333


No 157
>PHA03291 envelope glycoprotein I; Provisional
Probab=20.09  E-value=2.3e+02  Score=30.65  Aligned_cols=61  Identities=18%  Similarity=0.291  Sum_probs=0.0

Q ss_pred             CCCCceEEEeCcccccCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCcccccc
Q 008166           73 PTNPLRIVINGGRRVTAPRIATPPPSQPSRQAPRIATPPPSQPSRPRSISTSPPAPTPTPQQASRT  138 (575)
Q Consensus        73 ~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  138 (575)
                      ++||-+|-+-++.|   |+  +--...|-.+++++.+-+|++...|.+.+.-|++++++.+.++..
T Consensus       196 rl~~~~v~~P~~~~---p~--~~t~~~p~~t~~p~~~~~p~~tt~p~~~~~~~~~~~~~~~~~~~t  256 (401)
T PHA03291        196 RLGPADVFVPATPR---PT--PRTTASPETTPTPSTTTSPPSTTIPAPSTTIAAPQAGTTPEAEGT  256 (401)
T ss_pred             ccCccceeccCCCC---CC--cccCCCCcccCCCCCCCCCCCCCCCCCcCCCCCCCCCCccCCCCC


Done!