Citrus Sinensis ID: 008220

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570---
MNPYGLKPNEQRSFRFVRKTQVLLSSKYGLQFFTLNSKMGLKVLEPNTCIRGCCSSQSIPLHLPPSSYTLLSPIARGAESVVYEATLDGRKVAVKKPILSTSEELDNFHKELQLLCKLDHPGLAKFVAAHAKPPNYMFFFEFYESRNLAEKLHVEEWSPSVDQVLMIAAQLAKALQYLHNLGIVHRDVKPANVLLDRNLCPHLADFGLAEYRENLKEISLKNWRSSGKPTGGFHKKNMVGTLIYMAPEILKKEIHSEKSDVYSFGISINELLTGVVPYTDLRAEAQAHTVLEMNYTEQQLTAAVVSGGLRPILASLELGLPASILSLIQRCWDGNPHNRPSFSDIALELDLVLEHRKSLKEEDLCAGKSYVTYDDKLINSGNNMHTYHESINWTAQGEHSSKKASHAAESDVKLWLESANDALTYYPVLSWGSFATCGRRETMEDTHFLMPHMYNQKEIHMFGIFDGHRGSAAAEFSARALPGFLQNLGSTTRPTDALLEAFIRTDVAFRNELDSLRKSKRVVQKDWHPGCTAIAALIVRNRLFVANAGDCRAILCRGGHPFALSRVRQEFWL
ccccccccccccHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEccEEEEEEEcccccHHHHHHHHHHHHHHHHcccccEEEEEEEEEccccEEEEEEccccccHHHHHccccccccHHHHHHHHHHHHHHHHHHHcccccccccccccEEEccccccEECcccccccccccHHHHHccccccccccccccccccccccccccHHHHccccccccccHHcHHHHHHHHHccccccccccHHHHHHHHHHHcccHHHHHHHHHcccccccccccccccHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHccccccccccccccccccHHccccccccccccccccccccccccccccccccHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccEEEEECccccccHHHHHHHHHHHHHHHHcccccccHHHHHHHHHcccHHHHHHHHHHHHHcccccccccccHHHHHHHHccccEEEEEccccEEEEECccccccccHHHHHHcc
*************FRFV*********************************RGCCSSQSIPLHLPPSSYTLLSPIARGAESVVYEATLDGRKVAVKKPILSTSEELDNFHKELQLLCKLDHPGLAKFVAAHAKPPNYMFFFEFYESRNLAEKLHVEEWSPSVDQVLMIAAQLAKALQYLHNLGIVHRDVKPANVLLDRNLCPHLADFGLAEYRENLKEISLKNWRSSGKPTGGFHKKNMVGTLIYMAPEILKKEIHSEKSDVYSFGISINELLTGVVPYTDLRAEAQAHTVLEMNYTEQQLTAAVVSGGLRPILASLELGLPASILSLIQRCWDGNPHNRPSFSDIALELDLVLEHR*******************************************************************TYYPVLSWGSFATCGRRETMEDTHFLMPHMYNQKEIHMFGIFDGHRGSAAAEFSARALPGFLQNLGSTTRPTDALLEAFIRTDVAFRNELDSLRKSKRVVQKDWHPGCTAIAALIVRNRLFVANAGDCRAILCRGGHPFALSRVRQEFWL
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNPYGLKPNEQRSFRFVRKTQVLLSSKYGLQFFTLNSKMGLKVLEPNTCIRGCCSSQSIPLHLPPSSYTLLSPIARGAESVVYEATLDGRKVAVKKPILSTSEELDNFHKELQLLCKLDHPGLAKFVAAHAKPPNYMFFFEFYESRNLAEKLHVEEWSPSVDQVLMIAAQLAKALQYLHNLGIVHRDVKPANVLLDRNLCPHLADFGLAEYRENLKEISLKNWRSSGKPTGGFHKKNMVGTLIYMAPEILKKEIHSEKSDVYSFGISINELLTGVVPYTDLRAEAQAHTVLEMNYTEQQLTAAVVSGGLRPILASLELGLPASILSLIQRCWDGNPHNRPSFSDIALELDLVLEHRKSLKEEDLCAGKSYVTYDDKLINSGNNMHTYHESINWTAQGEHSSKKASHAAESDVKLWLESANDALTYYPVLSWGSFATCGRRETMEDTHFLMPHMYNQKEIHMFGIFDGHRGSAAAEFSARALPGFLQNLGSTTRPTDALLEAFIRTDVAFRNELDSLRKSKRVVQKDWHPGCTAIAALIVRNRLFVANAGDCRAILCRGGHPFALSRVRQEFWL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein kinase and PP2C-like domain-containing protein probableQ940A2
Protein kinase and PP2C-like domain-containing protein probableQ5JJY4

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3RP9, chain A
Confidence level:very confident
Coverage over the Query: 65-223,240-353
View the alignment between query and template
View the model in PyMOL
Template: 2I0O, chain A
Confidence level:very confident
Coverage over the Query: 426-571
View the alignment between query and template
View the model in PyMOL
Template: 4APC, chain A
Confidence level:confident
Coverage over the Query: 68-219,230-281,296-379
View the alignment between query and template
View the model in PyMOL
Template: 4FOB, chain A
Confidence level:probable
Coverage over the Query: 45-225,238-279,294-345
View the alignment between query and template
View the model in PyMOL