Citrus Sinensis ID: 008248


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570--
MVYILLIIFWASISSSSGQQYYDYSDCSLDPDSYPGSRYTCNSSQKSCLTFLVYRANQQFQTLSNVTDLFQVNPDESNEVLRLNNLTSPSKMLPPGREVLIPINCSCSGQFFQVNFSYAFSGSTTYSDIACSVFESLLKSRTLREENQLQENDLKAGSKLHVPLKCACPDDFSSSKGVKYLVTYPFVEGDTLDLLRMKFGISLEDLCAANLLAPNPTVYPNTTFLIPLKKYPIMNLQITDSQPPSPGFLPTIDIETTGQSKLRTLYVVGSAVGFCLVLVALLVCGLYVKALRKWKVERLLSFNARSSCSIASPRSAQTARSSTNSCLSPDLLVGVTYSLCNYSIDELKRATKGFSEDARIGDQAYKGMIDNVQVMIKQMRFEDTRQVVDVHSKINHINIVSLHGFCYGENVTPWPYIVLELPSNGCLRDCLFNQSNYLRWHKRTQIAFDVATGLHYLHHCIFPTYAHLSVNTKLGNVRPLKRNSSISSSVKGWIAPEYLLHGSVSEKVDIFAFGVVLLELLSAREDMDGRLFKDSTGFLGGASEGGSKACVEDDPLHRPSMDDIMKVLARMV
cHHHHHHHHHHHHHHccccccccccccccccccccccccEEccccccccEEEEEccccccccHHHHHHHHccccccHHHHHHcccccccccccccccEEEEEECccccccccEEEEEEEccccccHHHHHHHHHccHHHHHHHHHcccccccccccccEEEEEEEccccccccccccccCEEEECccccccHHHHHHHHcccHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHccccccccccccccEEEEcccEEEEEEcccccHHHHHHHHHHccccccccEEEEEEccccccccEEEEEccccccHHHHcccccccccHHHHHHHHHHHHHHHHHHHccccccEEEcccccccccccccccccCEEEcccccccHHHHcccccccccccHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHccccccccccHHHHHHHHHHcc
MVYILLIIFWASISSSSGQQYYDYSDCSLDPDSYPGSRYTCNSSQKSCLTFLVYRANQQFQTLSNVTDLFQVNPDESNEVLRLNNLTSPSKMLPPGREVLIPINCSCSGQFFQVNFSYAFSGSTTYSDIACSVFESLLKSRTLREENQLQENDLKAGSKLHVPLKCACPDDFSSSKGVKYLVTYPFVEGDTLDLLRMKFGISLEDLCAANLLAPNPTVYPNTTFLIPLKKYPIMNLQIT*******GFLPTID*******KLRTLYVVGSAVGFCLVLVALLVCGLYVKALRKWK*****************************************YSLCNYSIDELKRATKGFSEDARIGDQAYKGMIDNVQVMIKQMRFEDTRQVVDVHSKINHINIVSLHGFCYGENVTPWPYIVLELPSNGCLRDCLFNQSNYLRWHKRTQIAFDVATGLHYLHHCIFPTYAHLSVNTKLGNVRPLKRNSSISSSVKGWIAPEYLLHGSVSEKVDIFAFGVVLLELLSAREDMDGRLFKDSTGFLGGASEGGSKACVEDDPLHRPSMDDIMKVLARMV
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVYILLIIFWASISSSSGQQYYDYSDCSLDPDSYPGSRYTCNSSQKSCLTFLVYRANQQFQTLSNVTDLFQVNPDESNEVLRLNNLTSPSKMLPPGREVLIPINCSCSGQFFQVNFSYAFSGSTTYSDIACSVFESLLKSRTLREENQLQENDLKAGSKLHVPLKCACPDDFSSSKGVKYLVTYPFVEGDTLDLLRMKFGISLEDLCAANLLAPNPTVYPNTTFLIPLKKYPIMNLQITDSQPPSPGFLPTIDIETTGQSKLRTLYVVGSAVGFCLVLVALLVCGLYVKALRKWKVERLLSFNARSSCSIASPRSAQTARSSTNSCLSPDLLVGVTYSLCNYSIDELKRATKGFSEDARIGDQAYKGMIDNVQVMIKQMRFEDTRQVVDVHSKINHINIVSLHGFCYGENVTPWPYIVLELPSNGCLRDCLFNQSNYLRWHKRTQIAFDVATGLHYLHHCIFPTYAHLSVNTKLGNVRPLKRNSSISSSVKGWIAPEYLLHGSVSEKVDIFAFGVVLLELLSAREDMDGRLFKDSTGFLGGASEGGSKACVEDDPLHRPSMDDIMKVLARMV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
LysM domain receptor-like kinase 4 Lysin motif (LysM) receptor kinase that functions as a cell surface receptor in chitin elicitor (chitooligosaccharides) signaling leading to innate immunity. Recognizes microbe-derived N-acetylglucosamine (NAG)-containing ligands. Involved in the resistance to the pathogenic fungus Alternaria brassicicola and to the bacterial pathogen the bacterial pathogen Pseudomonas syringae pv tomato DC3000, probably by sensing microbe-associated molecular pattern (MAMP) and pathogen-associated molecular patterns (PAMP). May play a role in detecting peptidoglycans (e.g. PGNs) during bacterial growth.probableO64825

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3UIM, chain A
Confidence level:very confident
Coverage over the Query: 338-570
View the alignment between query and template
View the model in PyMOL
Template: 4EBY, chain A
Confidence level:very confident
Coverage over the Query: 46-232
View the alignment between query and template
View the model in PyMOL
Template: 3HGK, chain A
Confidence level:probable
Coverage over the Query: 344-524
View the alignment between query and template
View the model in PyMOL
Template: 2K1K, chain A
Confidence level:probable
Coverage over the Query: 262-267
View the alignment between query and template
View the model in PyMOL