BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 008253
(572 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|1V77|A Chain A, Crystal Structure Of The Ph1877 Protein
pdb|2CZV|A Chain A, Crystal Structure Of Archeal Rnase P Protein Ph1481p In
Complex With Ph1877p
pdb|2CZV|B Chain B, Crystal Structure Of Archeal Rnase P Protein Ph1481p In
Complex With Ph1877p
Length = 212
Score = 29.3 bits (64), Expect = 6.4, Method: Compositional matrix adjust.
Identities = 20/69 (28%), Positives = 37/69 (53%), Gaps = 2/69 (2%)
Query: 14 LTYSDLILDVQLRRQMISNAKLLVDWTRGKNLILSSGASSVTELRGPYDVANLSSLLGIS 73
L YS+ L R M+ KL+ + + L+S A ++R P D+ +L ++G+
Sbjct: 134 LLYSNPYERANLLRFMMKAWKLVEKYKVRR--FLTSSAQEKWDVRYPRDLISLGVVIGME 191
Query: 74 MERAKAAVS 82
+ +AKA++S
Sbjct: 192 IPQAKASIS 200
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.311 0.128 0.356
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 16,236,085
Number of Sequences: 62578
Number of extensions: 660405
Number of successful extensions: 1123
Number of sequences better than 100.0: 7
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 6
Number of HSP's that attempted gapping in prelim test: 1121
Number of HSP's gapped (non-prelim): 8
length of query: 572
length of database: 14,973,337
effective HSP length: 104
effective length of query: 468
effective length of database: 8,465,225
effective search space: 3961725300
effective search space used: 3961725300
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 54 (25.4 bits)