BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 008276
         (571 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1W36|C Chain C, Recbcd:dna Complex
 pdb|1W36|F Chain F, Recbcd:dna Complex
 pdb|3K70|C Chain C, Crystal Structure Of The Complete Initiation Complex Of
           Recbcd
 pdb|3K70|F Chain F, Crystal Structure Of The Complete Initiation Complex Of
           Recbcd
          Length = 1122

 Score = 29.3 bits (64), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 20/33 (60%)

Query: 205 GYAQNGRFDEALDVCREMESLRIKPDADTMASL 237
           G AQ    +E L VCR+M +    PDA+T A++
Sbjct: 577 GLAQERPLEEWLPVCRDMLNAFFLPDAETEAAM 609


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.322    0.136    0.410 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 16,757,954
Number of Sequences: 62578
Number of extensions: 681481
Number of successful extensions: 1433
Number of sequences better than 100.0: 7
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 6
Number of HSP's that attempted gapping in prelim test: 1432
Number of HSP's gapped (non-prelim): 7
length of query: 571
length of database: 14,973,337
effective HSP length: 104
effective length of query: 467
effective length of database: 8,465,225
effective search space: 3953260075
effective search space used: 3953260075
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 54 (25.4 bits)