Citrus Sinensis ID: 008323

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570

MAAKRESGSGGGSILQFAPFQSSVDEGFWHRLSSLKLNKLGIDESPIPITGFYAPCSHLQVSNHLSLLTESLPSDSDEQSSTAEISRGSRNKCTVPGTLYNSNTLESFYTIDKQSLLKQEAKKIWEDIHSGKAVEDSTVLSRFLVISFADLKKWSFHYWFAFPALVLDPPATVVDLKPASLWFSSQEAESVSAACSDWRNSSLTADVPYFLLTIAPNSRATIRHLKDWEACEGDGQKLLFGFYDPCHLQNHPGWPLRNFLALILTRWKLKSVLFLCYRENRGFTDLGLSLVGEALITVPQGWGDHQCVPNTVGWELNKGRKVPRCISLAKSMDPTRLAISAADLNLKLMRWRQLPSLNLDILSSRKCLLLGAGTLGCQVARMLMAWGVRKITLLDNGRVAMSNPLRQSLYTLDDCLNGGDFKAMAAVKSLERIFPAVAAEGVVMAIPMPGHPVPCQEEDSVLDDCRRLTDLILSHDVIFLLTDTRESRWLPTLLCANTNKITITAALGFDSFLVMRHGPGPFSITHDVKTEAVNGLSADMDNLGLNNRDGGQRLGCYFCNDVVAPTDVIS

ccccccccccccccEEEccccccccHHHHHHHHHccccccccccccCEEEEEEcccccccccccccccccccccccccccccHHcccccccCEEEEEEEEEcccHHHHHHccHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHcccccEEEEEEECcccccccccEEEccccccccccHHHHHHHHHHHHHHHHccccccccEEEEEEccccccEECccccHHHccccccCEEEEEEccccccccccHHHHHHHHHHHHcccccEEEEEEEEcccccccccEEEEEEEEECcccccccccccccEEEEEECccccccCEEcccccccHHHHHHHHHHHHHHHHHHHccccccHHHHccccEEEEcccccHHHHHHHHHHHcccEEEEEEccEEcccccccccccccccccccccHHHHHHHHHHHHHccccCEEEEEEEcccccccccccccHHHHHHHHHHHHHHHcccEEEEccccHHHHHHHHHHHHHccccEEEEECccccEEEEECccccccccccccccccccccccccccccccccccccCEEcccccccccccccc

***************QFAPFQSSVDEGFWHRLSSLKLNKLGIDESPIPITGFYAPCSHLQVSNHLSL***SLP****************RNKCTVPGTLYNSNTLESFYTIDKQSLLKQEAKKIWEDIHSGKAVEDSTVLSRFLVISFADLKKWSFHYWFAFPALVLDPPATVVDLKPASLWF*SQEAESVSAACSDWRNSSLTADVPYFLLTIAPNSRATIRHLKDWEACEGDGQKLLFGFYDPCHLQNHPGWPLRNFLALILTRWKLKSVLFLCYRENRGFTDLGLSLVGEALITVPQGWGDHQCVPNTVGWELNKGRKVPRCISLAKSMDPTRLAISAADLNLKLMRWRQLPSLNLDILSSRKCLLLGAGTLGCQVARMLMAWGVRKITLLDNGRVAMSNPLRQSLYTLDDCLNGGDFKAMAAVKSLERIFPAVAAEGVVMAIPMPGHPVPCQEEDSVLDDCRRLTDLILSHDVIFLLTDTRESRWLPTLLCANTNKITITAALGFDSFLVMRHGPGPFSITHDVK**************GLNNRDGGQRLGCYFCNDVVAPTDV**

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Ubiquitin-like modifier-activating enzyme atg7	E1-like activating enzyme involved in the 2 ubiquitin-like systems required for cytoplasm to vacuole transport (Cvt) and autophagy. Activates ATG12 for its conjugation with ATG5 and ATG8 for its conjugation with phosphatidylethanolamine. Both systems are needed for the ATG8 association to Cvt vesicles and autophagosomes. Involved in the senescence process.	probable	Q94CD5

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3VX8, chain D
Confidence level:very confident
Coverage over the Query: 13-73,88-332
View the alignment between query and template
View the model in PyMOL

Template: 3RUI, chain A
Confidence level:very confident
Coverage over the Query: 333-522,549-569
View the alignment between query and template
View the model in PyMOL