BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 008408
         (566 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3LYE|A Chain A, Crystal Structure Of Oxaloacetate Acetylhydrolase
 pdb|3M0J|A Chain A, Structure Of Oxaloacetate Acetylhydrolase In Complex With
           The Inhibitor 3,3-Difluorooxalacetate
 pdb|3M0K|A Chain A, Structure Of Oxaloacetate Acetylhydrolase In Complex With
           The Product Oxalate
          Length = 307

 Score = 30.4 bits (67), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 23/46 (50%), Gaps = 2/46 (4%)

Query: 143 EKGSEPLITVEALHQL--HILIFFLAVFHVLYSAITMMLGRLKIRG 186
           E G  PLITVE    +   I+IF  A     Y+AI   L RL+  G
Sbjct: 224 ENGHSPLITVEEAKAMGFRIMIFSFATLAPAYAAIRETLVRLRDHG 269


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.325    0.137    0.436 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 14,942,206
Number of Sequences: 62578
Number of extensions: 543619
Number of successful extensions: 1158
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 1157
Number of HSP's gapped (non-prelim): 2
length of query: 566
length of database: 14,973,337
effective HSP length: 104
effective length of query: 462
effective length of database: 8,465,225
effective search space: 3910933950
effective search space used: 3910933950
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 54 (25.4 bits)