Citrus Sinensis ID: 008412
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 566 | ||||||
| 224077082 | 752 | predicted protein [Populus trichocarpa] | 0.982 | 0.739 | 0.647 | 0.0 | |
| 224125536 | 716 | predicted protein [Populus trichocarpa] | 0.945 | 0.747 | 0.637 | 0.0 | |
| 359483482 | 753 | PREDICTED: LOW QUALITY PROTEIN: glyoxyso | 0.975 | 0.733 | 0.602 | 0.0 | |
| 255536763 | 729 | trypsin domain-containing protein, putat | 0.943 | 0.732 | 0.595 | 1e-179 | |
| 297740411 | 682 | unnamed protein product [Vitis vinifera] | 0.860 | 0.714 | 0.557 | 1e-171 | |
| 356546634 | 749 | PREDICTED: glyoxysomal processing protea | 0.968 | 0.731 | 0.567 | 1e-167 | |
| 111183165 | 753 | putative protease/hydrolase [Solanum lyc | 0.985 | 0.741 | 0.513 | 1e-159 | |
| 357446685 | 819 | Peroxisomal leader peptide-processing pr | 0.978 | 0.676 | 0.503 | 1e-155 | |
| 297851284 | 713 | hypothetical protein ARALYDRAFT_473044 [ | 0.925 | 0.734 | 0.506 | 1e-149 | |
| 18086453 | 709 | At1g28320/F3H9_2 [Arabidopsis thaliana] | 0.918 | 0.733 | 0.510 | 1e-147 |
| >gi|224077082|ref|XP_002305124.1| predicted protein [Populus trichocarpa] gi|222848088|gb|EEE85635.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Score = 717 bits (1850), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 375/579 (64%), Positives = 450/579 (77%), Gaps = 23/579 (3%)
Query: 1 MGLPEMAEFSRNFGVLVRVQGPDPKGLKMRRHAFHQYNSGKTTLSASGMLLPLSFFDTKV 60
MGLPE+ +F+RNF V+VR+QGPDPKGLKMR+HAFHQYNSGKTTLSASG+LLP + +D +
Sbjct: 1 MGLPEIVDFARNFAVMVRIQGPDPKGLKMRKHAFHQYNSGKTTLSASGLLLPDTLYDADL 60
Query: 61 AER-----NWGVNGLIVTVASVVEPFLLPQYRDKDTSEGQPELITGSQIDFLVEGK--LR 113
A R + G+ GL+VTVASV+EPFL ++R+ S+ +PELI G+QID + EGK LR
Sbjct: 61 ANRILEGKSQGL-GLVVTVASVIEPFLSSKHRES-ISQSRPELIPGAQIDVMAEGKSDLR 118
Query: 114 SEKEHEDVDKGSPEWVTAQLMMLVDIPVSSLALQSLMEASSGLPEHEWEVGWSLAPYNNS 173
+ + +DKG+ W+ AQ++ LVD+P+SSLALQSL+EASSG H WEVGWSLA N
Sbjct: 119 NGADG-GLDKGTSHWLRAQVIRLVDVPLSSLALQSLVEASSGSMNHGWEVGWSLASPENG 177
Query: 174 SQPLMGVVKTSIESNKISLMESHRPFAMEESSNLSLMSKSTSRVAILGVSSYLKDLPNIA 233
SQ M VV+T E S+ ES R A EESSN S+M KST+RVAILGV +LKDLPN
Sbjct: 178 SQSFMDVVQTQTEHGNASIAESQR-RAREESSNPSIMGKSTTRVAILGVFLHLKDLPNFE 236
Query: 234 LTPLNKRGDLLLAVGSPFGVLSPMHFFNSVSMGSVANCYPPRSTTRSLLMADIRCLPGME 293
++ ++RGD LLAVGSPFGVLSP+HFFNS+S+GS+ANCYPPRS+ SLLMADIRCLPGME
Sbjct: 237 ISASSRRGDFLLAVGSPFGVLSPVHFFNSLSVGSIANCYPPRSSDISLLMADIRCLPGME 296
Query: 294 GGPVFGEHAHFVGILIRPLRQK-SGAEIQLVIPWEAIATACSDLLLKEPQNAEKEIHINK 352
G PVF E+++F+GILIRPLRQK SGAEIQLVIPWEAIA ACSDLLLKEPQNAEK IHINK
Sbjct: 297 GSPVFCENSNFIGILIRPLRQKSSGAEIQLVIPWEAIALACSDLLLKEPQNAEKGIHINK 356
Query: 353 GNLNAVGNSLLFNSHILNGACCYKYEHVDSRCRSPLPIQKALASVCLITIDDGVWASGVL 412
NLNAVGN+ +S +G K+EH S C SP P++KA+AS+CLITID+ VWASGVL
Sbjct: 357 ENLNAVGNAYSSSS---DGPFPLKHEHHISYCSSPPPVEKAMASICLITIDELVWASGVL 413
Query: 413 LNDQGLILTNAHLLEPWRFGKTTVSGWRNGVSFQ-----PEDSASSGHTGVDQYQKSQTL 467
LNDQGLILTNAHLLEPWRFGKTTV+G +G Q PE+ ++ VD ++K+Q L
Sbjct: 414 LNDQGLILTNAHLLEPWRFGKTTVNGGEDGTKLQDPFIPPEEFPR--YSEVDGHEKTQRL 471
Query: 468 PPKMPKIVDSSV-DEHRAYKLSSFSRGHRKIRVRLDHLDPWIWCDAKIVYVCKGPLDVSL 526
PPK I++SSV DE + YKLS +G IRVRLDH DPWIWCDAK+V+VCKGPLDV+L
Sbjct: 472 PPKTLNIMNSSVADESKGYKLSLSYKGPMNIRVRLDHADPWIWCDAKVVHVCKGPLDVAL 531
Query: 527 LQLGYIPDQLCPIDADFGQPSLGSAAYVIGHGLFGPRCG 565
LQL ++PDQL P DF SLGS AYVIGHGLFGPRCG
Sbjct: 532 LQLEHVPDQLFPTKVDFECSSLGSKAYVIGHGLFGPRCG 570
|
Source: Populus trichocarpa Species: Populus trichocarpa Genus: Populus Family: Salicaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|224125536|ref|XP_002329829.1| predicted protein [Populus trichocarpa] gi|222870891|gb|EEF08022.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|359483482|ref|XP_002273997.2| PREDICTED: LOW QUALITY PROTEIN: glyoxysomal processing protease, glyoxysomal-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|255536763|ref|XP_002509448.1| trypsin domain-containing protein, putative [Ricinus communis] gi|223549347|gb|EEF50835.1| trypsin domain-containing protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|297740411|emb|CBI30593.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|356546634|ref|XP_003541729.1| PREDICTED: glyoxysomal processing protease, glyoxysomal-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|111183165|gb|ABH07902.1| putative protease/hydrolase [Solanum lycopersicum] | Back alignment and taxonomy information |
|---|
| >gi|357446685|ref|XP_003593618.1| Peroxisomal leader peptide-processing protease [Medicago truncatula] gi|355482666|gb|AES63869.1| Peroxisomal leader peptide-processing protease [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|297851284|ref|XP_002893523.1| hypothetical protein ARALYDRAFT_473044 [Arabidopsis lyrata subsp. lyrata] gi|297339365|gb|EFH69782.1| hypothetical protein ARALYDRAFT_473044 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|18086453|gb|AAL57680.1| At1g28320/F3H9_2 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 566 | ||||||
| TAIR|locus:2032142 | 709 | DEG15 "degradation of periplas | 0.575 | 0.459 | 0.475 | 1.7e-124 | |
| DICTYBASE|DDB_G0279049 | 849 | DDB_G0279049 "trypsin-like ser | 0.137 | 0.091 | 0.417 | 1.3e-14 | |
| ZFIN|ZDB-GENE-030131-8525 | 565 | tysnd1 "trypsin domain contain | 0.203 | 0.203 | 0.363 | 4.9e-12 | |
| UNIPROTKB|Q2T9J0 | 566 | TYSND1 "Peroxisomal leader pep | 0.190 | 0.190 | 0.35 | 1.8e-08 | |
| UNIPROTKB|F1SUE6 | 568 | TYSND1 "Uncharacterized protei | 0.174 | 0.174 | 0.366 | 4.7e-08 | |
| RGD|1307354 | 567 | Tysnd1 "trypsin domain contain | 0.204 | 0.204 | 0.328 | 1.5e-07 | |
| UNIPROTKB|F1NN98 | 332 | TYSND1 "Uncharacterized protei | 0.098 | 0.168 | 0.491 | 4.7e-07 | |
| UNIPROTKB|F1P5W4 | 350 | TYSND1 "Uncharacterized protei | 0.098 | 0.16 | 0.491 | 5.9e-07 | |
| MGI|MGI:1919017 | 568 | Tysnd1 "trypsin domain contain | 0.157 | 0.156 | 0.373 | 9e-07 | |
| UNIPROTKB|E1BF31 | 565 | E1BF31 "Uncharacterized protei | 0.157 | 0.157 | 0.383 | 4.4e-06 |
| TAIR|locus:2032142 DEG15 "degradation of periplasmic proteins 15" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 725 (260.3 bits), Expect = 1.7e-124, Sum P(2) = 1.7e-124
Identities = 164/345 (47%), Positives = 213/345 (61%)
Query: 1 MGLPEMAEFSRNFGVLVRVQGPDPKGLKMRRHAFHQYNSGKTTLSASGMLLPLSFF-DTK 59
M + ++ FSRNF VLV+V+GPDPKGLKMR+HAFHQY+SG TLSASG+LLP F +
Sbjct: 1 MDVSKVVSFSRNFAVLVKVEGPDPKGLKMRKHAFHQYHSGNATLSASGILLPRDIFLSGE 60
Query: 60 VAERNWGVNGLIVTVASVVEPFLLPQYR-DKDTSEGQPELITGSQIDFLVEGKLRSEKEH 118
VA + G + + V + P TS I+ + + + E
Sbjct: 61 VAAKVLFEAGQDMALVLTVASVVEPFLTLGHRTSSS----ISQDPVKLIPGAMIEIMVEG 116
Query: 119 E-DVDKGSPEWVTAQLMMLVDIPVSSLALQSLMEASSGLPEHEWEVGWSLAPYNNSSQPL 177
+ +K +P WV AQL+ LVD+PVSS ALQSL+EASSG + W++GWSL N SQP
Sbjct: 117 QLKSEKEAPFWVPAQLLSLVDVPVSSAALQSLIEASSGSKDSGWDIGWSLVSAANGSQPS 176
Query: 178 MGVVKTSIESNKISLMESHRPFAXXXXXXXXXXXXXXXRVAILGVSSYLKDLPNIALTPL 237
+ +IE LM+ P R+AILGV L P++
Sbjct: 177 I-----NIEHYSKPLMQLDEPH------NANFMAKSATRMAILGVPLSLLGQPSMNFASS 225
Query: 238 NKRGDLLLAVGSPFGVLSPMHFFNSVSMGSVANCYPPRSTTRSLLMADIRCLPGMEGGPV 297
+ +GD L+A+GSPFG+LSP++FFNSVS GS+AN YP S +SL++AD+RCLPGMEG PV
Sbjct: 226 SSKGDTLVALGSPFGILSPVNFFNSVSTGSIANSYPSGSLKKSLMIADVRCLPGMEGAPV 285
Query: 298 FGEHAHFVGILIRPLRQK-SGAEIQLVIPWEAIATACSDLLLKEP 341
F ++ H +GILIRPLRQK SG EIQLV+PW AI TACS LLL+EP
Sbjct: 286 FAKNGHLIGILIRPLRQKNSGVEIQLVVPWGAITTACSHLLLEEP 330
|
|
| DICTYBASE|DDB_G0279049 DDB_G0279049 "trypsin-like serine protease family protein" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-030131-8525 tysnd1 "trypsin domain containing 1" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q2T9J0 TYSND1 "Peroxisomal leader peptide-processing protease" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1SUE6 TYSND1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| RGD|1307354 Tysnd1 "trypsin domain containing 1" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NN98 TYSND1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1P5W4 TYSND1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1919017 Tysnd1 "trypsin domain containing 1" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BF31 E1BF31 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| eugene3.00040486 | hypothetical protein (752 aa) | |||||||
(Populus trichocarpa) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 566 | |||
| pfam13365 | 138 | pfam13365, Trypsin_2, Trypsin-like peptidase domai | 0.002 |
| >gnl|CDD|222077 pfam13365, Trypsin_2, Trypsin-like peptidase domain | Back alignment and domain information |
|---|
Score = 38.7 bits (90), Expect = 0.002
Identities = 24/91 (26%), Positives = 32/91 (35%), Gaps = 2/91 (2%)
Query: 217 VAILGVSSYLKDLPNIALTPLNKRGDLLLAVGSPFGVLSPMHFFNSVSMGSVANCYPPRS 276
+A+L V L + + G ++ VG P G+ G V+
Sbjct: 50 LALLKVDGPLLPAAPLLASSAAPLGGSVVVVGGPGGIGLGASGGGGGVGGLVSGSLGGVD 109
Query: 277 TTRSLLMADIRCLPGMEGGPVFGEHAHFVGI 307
L AD PG GGPVF VGI
Sbjct: 110 GRYILTDADTS--PGSSGGPVFDADGEVVGI 138
|
This family includes trypsin like peptidase domains. Length = 138 |
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 566 | |||
| PRK10139 | 455 | serine endoprotease; Provisional | 99.86 | |
| PRK10942 | 473 | serine endoprotease; Provisional | 99.81 | |
| TIGR02038 | 351 | protease_degS periplasmic serine pepetdase DegS. T | 99.81 | |
| PRK10898 | 353 | serine endoprotease; Provisional | 99.8 | |
| TIGR02037 | 428 | degP_htrA_DO periplasmic serine protease, Do/DeqQ | 99.78 | |
| COG0265 | 347 | DegQ Trypsin-like serine proteases, typically peri | 99.75 | |
| PRK10898 | 353 | serine endoprotease; Provisional | 99.55 | |
| TIGR02038 | 351 | protease_degS periplasmic serine pepetdase DegS. T | 99.54 | |
| PRK10139 | 455 | serine endoprotease; Provisional | 99.53 | |
| TIGR02037 | 428 | degP_htrA_DO periplasmic serine protease, Do/DeqQ | 99.43 | |
| PRK10942 | 473 | serine endoprotease; Provisional | 99.38 | |
| KOG1320 | 473 | consensus Serine protease [Posttranslational modif | 99.25 | |
| COG0265 | 347 | DegQ Trypsin-like serine proteases, typically peri | 99.07 | |
| PF13365 | 120 | Trypsin_2: Trypsin-like peptidase domain; PDB: 1Y8 | 98.7 | |
| KOG1320 | 473 | consensus Serine protease [Posttranslational modif | 97.86 | |
| PF13365 | 120 | Trypsin_2: Trypsin-like peptidase domain; PDB: 1Y8 | 97.78 | |
| cd00190 | 232 | Tryp_SPc Trypsin-like serine protease; Many of the | 97.47 | |
| PF00089 | 220 | Trypsin: Trypsin; InterPro: IPR001254 In the MEROP | 97.36 | |
| smart00020 | 229 | Tryp_SPc Trypsin-like serine protease. Many of the | 97.16 | |
| PF00089 | 220 | Trypsin: Trypsin; InterPro: IPR001254 In the MEROP | 96.57 | |
| KOG1421 | 955 | consensus Predicted signaling-associated protein ( | 96.43 | |
| COG3591 | 251 | V8-like Glu-specific endopeptidase [Amino acid tra | 94.09 | |
| PF10459 | 698 | Peptidase_S46: Peptidase S46; InterPro: IPR019500 | 93.83 | |
| PF10459 | 698 | Peptidase_S46: Peptidase S46; InterPro: IPR019500 | 92.35 | |
| PF00863 | 235 | Peptidase_C4: Peptidase family C4 This family belo | 91.99 | |
| PF02907 | 148 | Peptidase_S29: Hepatitis C virus NS3 protease; Int | 91.49 | |
| PF00949 | 132 | Peptidase_S7: Peptidase S7, Flavivirus NS3 serine | 89.74 | |
| cd00190 | 232 | Tryp_SPc Trypsin-like serine protease; Many of the | 88.83 | |
| smart00020 | 229 | Tryp_SPc Trypsin-like serine protease. Many of the | 86.94 | |
| PF08192 | 695 | Peptidase_S64: Peptidase family S64; InterPro: IPR | 86.16 | |
| PF00863 | 235 | Peptidase_C4: Peptidase family C4 This family belo | 80.7 |
| >PRK10139 serine endoprotease; Provisional | Back alignment and domain information |
|---|
Probab=99.86 E-value=2.4e-21 Score=209.01 Aligned_cols=126 Identities=22% Similarity=0.338 Sum_probs=105.8
Q ss_pred ccccccC-CCcceEEEEEEccCCCCCC--cccCCCCCCCCCeEEEEeCCCCCCCCCccCCceEEEEEecccCCCC---CC
Q 008412 205 SNLSLMS-KSTSRVAILGVSSYLKDLP--NIALTPLNKRGDLLLAVGSPFGVLSPMHFFNSVSMGSVANCYPPRS---TT 278 (566)
Q Consensus 205 ~~~~~l~-~~~tdlAvLki~~~~~~~~--~~~~S~~~~~Gd~V~aiGSPFG~lsP~~F~nsvS~GiISn~~~~~~---~~ 278 (566)
-+++++| +..+||||||++.. .+++ .+++|..+++||+|+|||+|||+ ..++|.||||++.+... ..
T Consensus 127 ~~a~vvg~D~~~DlAvlkv~~~-~~l~~~~lg~s~~~~~G~~V~aiG~P~g~------~~tvt~GivS~~~r~~~~~~~~ 199 (455)
T PRK10139 127 FDAKLIGSDDQSDIALLQIQNP-SKLTQIAIADSDKLRVGDFAVAVGNPFGL------GQTATSGIISALGRSGLNLEGL 199 (455)
T ss_pred EEEEEEEEcCCCCEEEEEecCC-CCCceeEecCccccCCCCEEEEEecCCCC------CCceEEEEEccccccccCCCCc
Confidence 3478888 55599999999742 2344 56688899999999999999994 78999999999876421 23
Q ss_pred CceEEEecCCCCCCCCcceeccCCcEEEEEeeeccCCC-CcceEEEeeHHHHHHHHHhhh
Q 008412 279 RSLLMADIRCLPGMEGGPVFGEHAHFVGILIRPLRQKS-GAEIQLVIPWEAIATACSDLL 337 (566)
Q Consensus 279 ~~liqTDA~ilPGnsGGpVfn~~G~lIGIv~~~l~~~~-g~gl~faIP~~~i~~~~~~ll 337 (566)
..+|||||+++||||||||||.+|+||||+++.++..+ ..|++||||++.++.++.+++
T Consensus 200 ~~~iqtda~in~GnSGGpl~n~~G~vIGi~~~~~~~~~~~~gigfaIP~~~~~~v~~~l~ 259 (455)
T PRK10139 200 ENFIQTDASINRGNSGGALLNLNGELIGINTAILAPGGGSVGIGFAIPSNMARTLAQQLI 259 (455)
T ss_pred ceEEEECCccCCCCCcceEECCCCeEEEEEEEEEcCCCCccceEEEEEhHHHHHHHHHHh
Confidence 56899999999999999999999999999999887653 359999999999999888765
|
|
| >PRK10942 serine endoprotease; Provisional | Back alignment and domain information |
|---|
| >TIGR02038 protease_degS periplasmic serine pepetdase DegS | Back alignment and domain information |
|---|
| >PRK10898 serine endoprotease; Provisional | Back alignment and domain information |
|---|
| >TIGR02037 degP_htrA_DO periplasmic serine protease, Do/DeqQ family | Back alignment and domain information |
|---|
| >COG0265 DegQ Trypsin-like serine proteases, typically periplasmic, contain C-terminal PDZ domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK10898 serine endoprotease; Provisional | Back alignment and domain information |
|---|
| >TIGR02038 protease_degS periplasmic serine pepetdase DegS | Back alignment and domain information |
|---|
| >PRK10139 serine endoprotease; Provisional | Back alignment and domain information |
|---|
| >TIGR02037 degP_htrA_DO periplasmic serine protease, Do/DeqQ family | Back alignment and domain information |
|---|
| >PRK10942 serine endoprotease; Provisional | Back alignment and domain information |
|---|
| >KOG1320 consensus Serine protease [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG0265 DegQ Trypsin-like serine proteases, typically periplasmic, contain C-terminal PDZ domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13365 Trypsin_2: Trypsin-like peptidase domain; PDB: 1Y8T_A 2Z9I_A 3QO6_A 1L1J_A 1QY6_A 2O8L_A 3OTP_E 2ZLE_I 1KY9_A 3CS0_A | Back alignment and domain information |
|---|
| >KOG1320 consensus Serine protease [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13365 Trypsin_2: Trypsin-like peptidase domain; PDB: 1Y8T_A 2Z9I_A 3QO6_A 1L1J_A 1QY6_A 2O8L_A 3OTP_E 2ZLE_I 1KY9_A 3CS0_A | Back alignment and domain information |
|---|
| >cd00190 Tryp_SPc Trypsin-like serine protease; Many of these are synthesized as inactive precursor zymogens that are cleaved during limited proteolysis to generate their active forms | Back alignment and domain information |
|---|
| >PF00089 Trypsin: Trypsin; InterPro: IPR001254 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >smart00020 Tryp_SPc Trypsin-like serine protease | Back alignment and domain information |
|---|
| >PF00089 Trypsin: Trypsin; InterPro: IPR001254 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >KOG1421 consensus Predicted signaling-associated protein (contains a PDZ domain) [General function prediction only] | Back alignment and domain information |
|---|
| >COG3591 V8-like Glu-specific endopeptidase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PF10459 Peptidase_S46: Peptidase S46; InterPro: IPR019500 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >PF10459 Peptidase_S46: Peptidase S46; InterPro: IPR019500 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >PF00863 Peptidase_C4: Peptidase family C4 This family belongs to family C4 of the peptidase classification | Back alignment and domain information |
|---|
| >PF02907 Peptidase_S29: Hepatitis C virus NS3 protease; InterPro: IPR004109 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >PF00949 Peptidase_S7: Peptidase S7, Flavivirus NS3 serine protease ; InterPro: IPR001850 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >cd00190 Tryp_SPc Trypsin-like serine protease; Many of these are synthesized as inactive precursor zymogens that are cleaved during limited proteolysis to generate their active forms | Back alignment and domain information |
|---|
| >smart00020 Tryp_SPc Trypsin-like serine protease | Back alignment and domain information |
|---|
| >PF08192 Peptidase_S64: Peptidase family S64; InterPro: IPR012985 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >PF00863 Peptidase_C4: Peptidase family C4 This family belongs to family C4 of the peptidase classification | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 566 | |||
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 2e-11 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 3e-06 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 3e-04 |
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Score = 65.6 bits (159), Expect = 2e-11
Identities = 81/608 (13%), Positives = 184/608 (30%), Gaps = 158/608 (25%)
Query: 57 DTKVAERNWGVNGLIVTVASVVEPFLLPQYRDKDTSEGQPELITGSQIDFLVEGK----- 111
D + E + ++ SV E + + KD + +++ +ID ++ K
Sbjct: 8 DFETGEHQYQYKDIL----SVFEDAFVDNFDCKDVQDMPKSILSKEEIDHIIMSKDAVSG 63
Query: 112 -------LRSEKEH------EDVDKGSPEWVTAQLMMLVDIPVSSLALQSLMEASSGLPE 158
L S++E E+V + + +++ + + P S+ + +E L
Sbjct: 64 TLRLFWTLLSKQEEMVQKFVEEVLRINYKFLMSPIKTEQRQP--SMMTRMYIEQRDRL-- 119
Query: 159 HEWEVGWSLAPYNNSSQPLMGVVKTSIE---------------SNKISLMESHRPFAMEE 203
+ A YN S ++ ++ S K + A++
Sbjct: 120 --YNDNQVFAKYNVSRLQPYLKLRQALLELRPAKNVLIDGVLGSGKTWV-------ALDV 170
Query: 204 SSNLSLMSKSTSRVAILGVSSYLKDLPNIALTPLNKRGDLLLAVGSPFGVL-----SPMH 258
+ + K ++ L + + P L L K LL + + +
Sbjct: 171 CLSYKVQCKMDFKIFWLNLKNCNS--PETVLEMLQK---LLYQIDPNWTSRSDHSSNIKL 225
Query: 259 FFNSVSMGSVANCYPPRSTTRSLLMAD------------IRC--------------LPGM 292
+S+ + + LL+ + C L
Sbjct: 226 RIHSIQ-AELRRLLKSKPYENCLLVLLNVQNAKAWNAFNLSCKILLTTRFKQVTDFLSAA 284
Query: 293 EGGPVFGEH--------------AHFVGILIRPLRQKSGAEIQLVIPWEAIATACSDLLL 338
+ +H ++ + L + E+ P ++ ++ +
Sbjct: 285 TTTHISLDHHSMTLTPDEVKSLLLKYLDCRPQDLPR----EVLTTNPR-RLSI-IAESIR 338
Query: 339 KEPQNAEKEIHINKGNLN-AVGNSL-LFNSHILNGACCYKY-----EHVDSRCRSPLPIQ 391
+ H+N L + +SL + + +P
Sbjct: 339 DGLATWDNWKHVNCDKLTTIIESSLNVLEPAEYRK--MFDRLSVFPPSA------HIPTI 390
Query: 392 KALASVCLITIDDGVWASGVLLNDQGLILTNAH---LLEPWRFGKTTVSGWRNGVSF--- 445
L+++ +W + +D +++ H L+E ++T+S +
Sbjct: 391 -------LLSL---IWFDVIK-SDVMVVVNKLHKYSLVEKQPK-ESTIS--IPSIYLELK 436
Query: 446 QPEDSASSGH-TGVDQYQKSQTLPP--KMPKIVDSSVDEHRAYKLSSFSRGHRKIRVRLD 502
++ + H + VD Y +T +P +D H + L + R R+
Sbjct: 437 VKLENEYALHRSIVDHYNIPKTFDSDDLIPPYLDQYFYSHIGHHLKNIEHPERMTLFRMV 496
Query: 503 HLDPWIWCDAKIVYV-----CKGPLDVSLLQLGYIPDQLCPIDADFGQPSLGSAAYVIGH 557
LD + + + KI + G + +L QL + +C D + + V
Sbjct: 497 FLD-FRFLEQKIRHDSTAWNASGSILNTLQQLKFYKPYICDNDPKYER-------LVNAI 548
Query: 558 GLFGPRCG 565
F P+
Sbjct: 549 LDFLPKIE 556
|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 566 | |||
| 4fln_A | 539 | Protease DO-like 2, chloroplastic; protease, DEG, | 99.82 | |
| 3sti_A | 245 | Protease DEGQ; serine protease, PDZ domain, chaper | 99.79 | |
| 3lgi_A | 237 | Protease DEGS; stress-sensor, HTRA, PDZ OMP, hydro | 99.78 | |
| 1ky9_A | 448 | Protease DO, DEGP, HTRA; protein quality control, | 99.77 | |
| 3pv2_A | 451 | DEGQ; trypsin fold, PDZ domain, chaperone protease | 99.77 | |
| 4a8c_A | 436 | Periplasmic PH-dependent serine endoprotease DEGQ; | 99.76 | |
| 3stj_A | 345 | Protease DEGQ; serine protease, PDZ domain, protea | 99.75 | |
| 1l1j_A | 239 | Heat shock protease HTRA; hydrolase, serine protei | 99.75 | |
| 1te0_A | 318 | Protease DEGS; two domains, serine protease, PDZ, | 99.66 | |
| 3qo6_A | 348 | Protease DO-like 1, chloroplastic; protease, HTRA, | 99.65 | |
| 3tjo_A | 231 | Serine protease HTRA1; peptidase, hydrolase; HET: | 99.65 | |
| 1y8t_A | 324 | Hypothetical protein RV0983; serine protease, stru | 99.62 | |
| 3num_A | 332 | Serine protease HTRA1; DEGP, hydrolase; 2.75A {Hom | 99.61 | |
| 1lcy_A | 325 | HTRA2 serine protease; apoptosis, PDZ domain, casp | 99.6 | |
| 3sti_A | 245 | Protease DEGQ; serine protease, PDZ domain, chaper | 99.54 | |
| 3tjo_A | 231 | Serine protease HTRA1; peptidase, hydrolase; HET: | 99.52 | |
| 4a8c_A | 436 | Periplasmic PH-dependent serine endoprotease DEGQ; | 99.5 | |
| 3lgi_A | 237 | Protease DEGS; stress-sensor, HTRA, PDZ OMP, hydro | 99.49 | |
| 3k6y_A | 237 | Serine protease, possible membrane-associated seri | 99.47 | |
| 3stj_A | 345 | Protease DEGQ; serine protease, PDZ domain, protea | 99.47 | |
| 2h5c_A | 198 | Alpha-lytic protease; serine protease, acylation t | 99.46 | |
| 3num_A | 332 | Serine protease HTRA1; DEGP, hydrolase; 2.75A {Hom | 99.46 | |
| 3qo6_A | 348 | Protease DO-like 1, chloroplastic; protease, HTRA, | 99.43 | |
| 3k6y_A | 237 | Serine protease, possible membrane-associated seri | 99.41 | |
| 1l1j_A | 239 | Heat shock protease HTRA; hydrolase, serine protei | 99.4 | |
| 1te0_A | 318 | Protease DEGS; two domains, serine protease, PDZ, | 99.39 | |
| 1lcy_A | 325 | HTRA2 serine protease; apoptosis, PDZ domain, casp | 99.39 | |
| 1y8t_A | 324 | Hypothetical protein RV0983; serine protease, stru | 99.39 | |
| 1ky9_A | 448 | Protease DO, DEGP, HTRA; protein quality control, | 99.38 | |
| 3pv2_A | 451 | DEGQ; trypsin fold, PDZ domain, chaperone protease | 99.36 | |
| 4fln_A | 539 | Protease DO-like 2, chloroplastic; protease, DEG, | 99.34 | |
| 2as9_A | 210 | Serine protease; trypsin-like fold, hydrolase; 1.7 | 99.27 | |
| 2w5e_A | 163 | Putative serine protease; coiled coil, transmembra | 99.22 | |
| 1hpg_A | 187 | Glutamic acid specific protease; serine protease, | 99.21 | |
| 2w5e_A | 163 | Putative serine protease; coiled coil, transmembra | 99.16 | |
| 2oua_A | 188 | Serine protease, protein NAPA; kinetic stability, | 99.15 | |
| 2ea3_A | 189 | Chymotrypsin; celloulomonas, protease, hydrolase; | 99.08 | |
| 2pfe_A | 186 | Protease A, alkaline serine protease, TFPA; beta-b | 98.98 | |
| 2w7s_A | 200 | Serine protease SPLA; hydrolase, family S1; 1.80A | 98.83 | |
| 1agj_A | 242 | Epidermolytic toxin A; hydrolase, serine protease; | 98.83 | |
| 2sga_A | 181 | Proteinase A; hydrolase (serine proteinase); 1.50A | 98.76 | |
| 1qtf_A | 246 | Exfoliative toxin B; serine protease, superantigen | 98.73 | |
| 1agj_A | 242 | Epidermolytic toxin A; hydrolase, serine protease; | 98.7 | |
| 2vid_A | 204 | Serine protease SPLB; hydrolase; 1.80A {Staphyloco | 98.67 | |
| 2o8l_A | 274 | V8 protease, taphylococcal serine; serine protease | 98.59 | |
| 2as9_A | 210 | Serine protease; trypsin-like fold, hydrolase; 1.7 | 98.58 | |
| 2w7s_A | 200 | Serine protease SPLA; hydrolase, family S1; 1.80A | 98.54 | |
| 1wcz_A | 268 | Glutamyl endopeptidase; virulence factor, hydrolas | 98.51 | |
| 2qa9_E | 185 | Streptogrisin-B; chymotrypsin-type serine peptidas | 98.49 | |
| 1qtf_A | 246 | Exfoliative toxin B; serine protease, superantigen | 98.49 | |
| 2vid_A | 204 | Serine protease SPLB; hydrolase; 1.80A {Staphyloco | 98.47 | |
| 2o8l_A | 274 | V8 protease, taphylococcal serine; serine protease | 98.44 | |
| 1wcz_A | 268 | Glutamyl endopeptidase; virulence factor, hydrolas | 98.43 | |
| 1mbm_A | 198 | NSP4 proteinase, chymotrypsin-like serine protease | 98.12 | |
| 2oua_A | 188 | Serine protease, protein NAPA; kinetic stability, | 98.11 | |
| 2qa9_E | 185 | Streptogrisin-B; chymotrypsin-type serine peptidas | 97.98 | |
| 1hpg_A | 187 | Glutamic acid specific protease; serine protease, | 97.95 | |
| 2h5c_A | 198 | Alpha-lytic protease; serine protease, acylation t | 97.88 | |
| 2pfe_A | 186 | Protease A, alkaline serine protease, TFPA; beta-b | 97.7 | |
| 1mbm_A | 198 | NSP4 proteinase, chymotrypsin-like serine protease | 97.68 | |
| 2ea3_A | 189 | Chymotrypsin; celloulomonas, protease, hydrolase; | 97.66 | |
| 3fan_A | 213 | Non-structural protein; chymotrypsin-like, N-termi | 97.59 | |
| 1pq7_A | 224 | Trypsin; ultra-high resolution, catalysis, hydrola | 97.55 | |
| 2bdg_A | 223 | Kallikrein-4; serine proteinase, S1 subsite, 70-80 | 97.42 | |
| 1gvz_A | 237 | Kallikrein-1E2; antigen, prostate specific antigen | 97.41 | |
| 1p3c_A | 215 | Glutamyl-endopeptidase; serine protease, hydrolase | 97.4 | |
| 2psx_A | 227 | Kallikrein-5; zinc inhibition, stratum corneum, gl | 97.38 | |
| 1hj8_A | 222 | Trypsin I; hydrolase, radiation damage, disulphide | 97.38 | |
| 1si5_H | 240 | Scatter factor, hepatocyte growth factor, SF, hepa | 97.38 | |
| 4e7n_A | 238 | Snake-venom thrombin-like enzyme; beta-barrel, hyd | 97.38 | |
| 1ao5_A | 237 | Glandular kallikrein-13; serine protease, protein | 97.36 | |
| 2xw9_A | 228 | Complement factor D; immune system, hydrolase, ser | 97.36 | |
| 3s69_A | 234 | Thrombin-like enzyme defibrase; beta-barrel, serin | 97.35 | |
| 1npm_A | 225 | Neuropsin; serine proteinase, glycoprotein; HET: N | 97.35 | |
| 4i8h_A | 223 | Cationic trypsin, beta-trypsin; serine protease, h | 97.35 | |
| 1mza_A | 240 | Pro-granzyme K; apoptosis, serine protease, S1 fam | 97.35 | |
| 1spj_A | 238 | Kallikrein 1; serine protease, KLK1, HK1, hydrolas | 97.33 | |
| 1a7s_A | 225 | Heparin binding protein; serine protease homolog, | 97.33 | |
| 2sga_A | 181 | Proteinase A; hydrolase (serine proteinase); 1.50A | 97.29 | |
| 3s9c_A | 234 | Vipera russelli proteinase RVV-V gamma; serine pro | 97.28 | |
| 1fxy_A | 228 | Coagulation factor XA-trypsin chimera; protease, c | 97.28 | |
| 3h7t_A | 235 | Group 3 allergen smipp-S YVT004A06; hydrolase; 2.0 | 97.27 | |
| 2asu_B | 234 | Hepatocyte growth factor-like protein; serine prot | 97.27 | |
| 3mfj_A | 223 | Cationic trypsin; serine proteinase, hydrolase; 0. | 97.27 | |
| 1lo6_A | 223 | Kallikrein 6, HK6; serine protease, human kallikre | 97.26 | |
| 2qxi_A | 224 | Kallikrein-7; S1 pocket, chloromethyl ketone, alte | 97.25 | |
| 2z7f_E | 218 | Leukocyte elastase; serine protease, serine protea | 97.25 | |
| 1azz_A | 226 | Collagenase; complex (serine protease/inhibitor), | 97.22 | |
| 1ton_A | 235 | Tonin; hydrolase(serine proteinase); 1.80A {Rattus | 97.21 | |
| 2zch_P | 237 | Prostate-specific antigen; human PSA, kallikrein r | 97.2 | |
| 3gov_B | 251 | MAsp-1; complement, serine protease, beta barrel, | 97.19 | |
| 2r0l_A | 248 | Hepatocyte growth factor activator; serine proteas | 97.19 | |
| 2aiq_A | 231 | Protein C activator; snake venom serine proteinase | 97.17 | |
| 1yph_C | 131 | Chymotrypsin A, chain B; serine protease, hydrolas | 97.13 | |
| 3beu_A | 224 | Trypsin, SGT; beta sheets, serine protease, hydrol | 97.13 | |
| 2oq5_A | 232 | Transmembrane protease, serine 11E; type II trans- | 97.12 | |
| 1fuj_A | 221 | PR3, myeloblastin; hydrolase, serine protease, gly | 97.11 | |
| 1eq9_A | 222 | Chymotrypsin; FIRE ANT, serine proteinase, hydrola | 97.1 | |
| 3h7o_A | 228 | Group 3 allergen smipp-S YV6023A04; hydrolase; 1.8 | 97.09 | |
| 1ddj_A | 247 | Plasminogen; catalytic domain, blood clotting; 2.0 | 97.09 | |
| 3gyl_B | 261 | Prostasin; ENAC, zymogen, divalent cation, channel | 97.08 | |
| 2f91_A | 237 | Hepatopancreas trypsin; trypsin, canonical inhibit | 97.05 | |
| 1cgh_A | 224 | Cathepsin G; inflammation, specificity, serine pro | 97.05 | |
| 1sgf_A | 240 | 7S NGF, nerve growth factor; growth factor (beta-N | 97.05 | |
| 1orf_A | 234 | Granzyme A; hydrolase-hydrolase inhibitor complex; | 97.0 | |
| 1yc0_A | 283 | Hepatocyte growth factor activator; hydrolase/inhi | 96.98 | |
| 1iau_A | 227 | Granzyme B; hydrolase-hydrolase inhibitor complex; | 96.97 | |
| 2zgc_A | 240 | Granzyme M; serine protease, cytolysis, glycoprote | 96.91 | |
| 4ag1_A | 226 | Chymase; hydrolase-de novo protein complex, inhibi | 96.89 | |
| 3ncl_A | 241 | Suppressor of tumorigenicity 14 protein; proteinas | 96.88 | |
| 3mhw_U | 247 | Urokinase-type plasminogen activator; hydrolase, b | 96.86 | |
| 3fan_A | 213 | Non-structural protein; chymotrypsin-like, N-termi | 96.85 | |
| 3fzz_A | 227 | Granzyme C; hydrolase, cytolysis, protease, serine | 96.85 | |
| 1ym0_A | 238 | Fibrinotic enzyme component B; two chains, glycosy | 96.85 | |
| 1m9u_A | 241 | Earthworm fibrinolytic enzyme; hydrolase, serine p | 96.81 | |
| 1elt_A | 236 | Elastase; serine proteinase; 1.61A {Salmo salar} S | 96.79 | |
| 1euf_A | 227 | Duodenase; serine protease, dual specificity, hydr | 96.73 | |
| 4dgj_A | 235 | Enteropeptidase catalytic light chain; serine prot | 96.67 | |
| 2any_A | 241 | Kininogenin, plasma kallikrein, light chain, fletc | 96.65 | |
| 3bg8_A | 238 | Coagulation factor XIA light chain; protease inhib | 96.65 | |
| 1gvk_B | 240 | Elastase 1, peptide inhibitor; hydrolase, serine p | 96.65 | |
| 2f9n_A | 245 | Alpha I tryptase; serine proteinase, trypsin-like, | 96.62 | |
| 2jde_A | 276 | Urokinase-type plasminogen activator; plasminogen | 96.61 | |
| 2hlc_A | 230 | Collagenase; serine protease, hydrolase, collagen | 96.59 | |
| 3tvj_B | 242 | Mannan-binding lectin serine protease 2 B chain; i | 96.58 | |
| 2bz6_H | 254 | Blood coagulation factor VIIA; serine protease, en | 96.58 | |
| 3rp2_A | 224 | RAT MAST cell protease II; serine proteinase; 1.90 | 96.58 | |
| 1t8o_A | 245 | Chymotrypsin A; chymotrypsin, serine proteinase, B | 96.56 | |
| 2jkh_A | 241 | Activated factor XA heavy chain; plasma, calcium, | 96.47 | |
| 3h5c_B | 317 | Vitamin K-dependent protein Z; protein Z-protein Z | 96.47 | |
| 3f1s_B | 283 | Vitamin K-dependent protein Z; PZ, ZPI, complex, s | 96.46 | |
| 1arb_A | 268 | Achromobacter protease I; hydrolase(serine proteas | 96.44 | |
| 1bru_P | 241 | Elastase, PPE; serine protease, hydrolase; HET: 1N | 96.42 | |
| 1pyt_D | 251 | TC, PCPA-TC, chymotrypsinogen C; ternary complex ( | 96.37 | |
| 1aut_C | 250 | Activated protein C; serine proteinase, plasma cal | 96.34 | |
| 1z8g_A | 372 | Serine protease hepsin; serine protease hepsin, pr | 96.34 | |
| 1rtf_B | 252 | (TC)-T-PA, two chain tissue plasminogen activator; | 96.31 | |
| 2wph_S | 235 | Coagulation factor IXA heavy chain; serine proteas | 96.17 | |
| 1fiw_A | 290 | Beta-acrosin heavy chain; anti-parallel beta-barre | 96.07 | |
| 2qy0_B | 242 | Complement C1R subcomponent; serine protease, beta | 96.0 | |
| 1zyo_A | 191 | Serine protease; beta-barrel, glutamyl endopeptida | 95.97 | |
| 1fon_A | 240 | Procarboxypeptidase A-S6; truncated zymogen E, ser | 95.86 | |
| 4dur_A | 791 | Plasminogen, serine protease; fibrinolysis, hydrol | 95.78 | |
| 2olg_A | 278 | Pro-phenoloxidase activating enzyme-I; prophenolox | 95.74 | |
| 1zjk_A | 403 | Mannan-binding lectin serine protease 2; beta barr | 95.65 | |
| 3cp7_A | 218 | Alkaline serine protease Al20; trypsin-like, hydro | 95.51 | |
| 4f4o_C | 347 | Haptoglobin; globin fold, serine protease fold, co | 95.42 | |
| 1md8_A | 329 | C1R complement serine protease; innate immunity, a | 95.23 | |
| 2xrc_A | 565 | Human complement factor I; immune system, hydrolas | 95.18 | |
| 2vnt_A | 276 | Urokinase-type plasminogen activator; UPA, inhibit | 95.13 | |
| 1gpz_A | 399 | Complement C1R component; hydrolase, activation, i | 95.11 | |
| 2b9l_A | 394 | Prophenoloxidase activating factor; CLIP domain, e | 95.05 | |
| 2xxl_A | 408 | GRAM-positive specific serine protease, isoform B; | 95.0 | |
| 1p3c_A | 215 | Glutamyl-endopeptidase; serine protease, hydrolase | 94.96 | |
| 3rm2_H | 259 | Thrombin heavy chain; serine protease, kringle, hy | 94.76 | |
| 3mmg_A | 241 | Nuclear inclusion protein A; 3C-type protease, TEV | 94.75 | |
| 2f83_A | 625 | Coagulation factor XI; protease, apple domain, hyd | 94.68 | |
| 2bdy_A | 289 | Thrombin; thrombin, complex structure, hydrolase, | 94.64 | |
| 1lvm_A | 229 | Catalytic domain of the nuclear inclusion protein | 94.55 | |
| 1elv_A | 333 | Complement C1S component; trypsin-like serin prote | 94.47 | |
| 1pq7_A | 224 | Trypsin; ultra-high resolution, catalysis, hydrola | 93.0 | |
| 3mmg_A | 241 | Nuclear inclusion protein A; 3C-type protease, TEV | 92.98 | |
| 1rrk_A | 497 | Complement factor B; BB, hydrolase; 2.00A {Homo sa | 92.72 | |
| 1mza_A | 240 | Pro-granzyme K; apoptosis, serine protease, S1 fam | 91.77 | |
| 3nxp_A | 424 | Prethrombin-1; allostery, blood coagulation, hydro | 91.4 | |
| 3s9c_A | 234 | Vipera russelli proteinase RVV-V gamma; serine pro | 91.38 | |
| 2pka_B | 152 | Kallikrein A; serine proteinase; 2.05A {Sus scrofa | 91.13 | |
| 1fuj_A | 221 | PR3, myeloblastin; hydrolase, serine protease, gly | 91.12 | |
| 3hrz_D | 741 | Complement factor B; serine protease, glycosilated | 91.03 | |
| 1zyo_A | 191 | Serine protease; beta-barrel, glutamyl endopeptida | 90.82 | |
| 2odp_A | 509 | Complement C2; C3/C5 convertase, complement serin | 90.8 | |
| 1ao5_A | 237 | Glandular kallikrein-13; serine protease, protein | 90.01 | |
| 3su6_A | 203 | NS3 protease, NS4A protein; drug resistance, drug | 89.18 | |
| 1cgh_A | 224 | Cathepsin G; inflammation, specificity, serine pro | 89.07 | |
| 3h7t_A | 235 | Group 3 allergen smipp-S YVT004A06; hydrolase; 2.0 | 88.73 | |
| 1lo6_A | 223 | Kallikrein 6, HK6; serine protease, human kallikre | 88.69 | |
| 1si5_H | 240 | Scatter factor, hepatocyte growth factor, SF, hepa | 88.69 | |
| 1spj_A | 238 | Kallikrein 1; serine protease, KLK1, HK1, hydrolas | 88.53 | |
| 4e7n_A | 238 | Snake-venom thrombin-like enzyme; beta-barrel, hyd | 88.3 | |
| 2bdg_A | 223 | Kallikrein-4; serine proteinase, S1 subsite, 70-80 | 88.19 | |
| 3s69_A | 234 | Thrombin-like enzyme defibrase; beta-barrel, serin | 87.97 | |
| 2zgc_A | 240 | Granzyme M; serine protease, cytolysis, glycoprote | 87.58 | |
| 1ton_A | 235 | Tonin; hydrolase(serine proteinase); 1.80A {Rattus | 87.42 | |
| 1hj8_A | 222 | Trypsin I; hydrolase, radiation damage, disulphide | 87.36 | |
| 2zch_P | 237 | Prostate-specific antigen; human PSA, kallikrein r | 87.23 | |
| 1iau_A | 227 | Granzyme B; hydrolase-hydrolase inhibitor complex; | 87.17 | |
| 4i8h_A | 223 | Cationic trypsin, beta-trypsin; serine protease, h | 86.94 | |
| 1npm_A | 225 | Neuropsin; serine proteinase, glycoprotein; HET: N | 86.93 | |
| 3gyl_B | 261 | Prostasin; ENAC, zymogen, divalent cation, channel | 86.59 | |
| 2z7f_E | 218 | Leukocyte elastase; serine protease, serine protea | 86.2 | |
| 1euf_A | 227 | Duodenase; serine protease, dual specificity, hydr | 86.18 | |
| 3mfj_A | 223 | Cationic trypsin; serine proteinase, hydrolase; 0. | 86.07 | |
| 1a7s_A | 225 | Heparin binding protein; serine protease homolog, | 85.6 | |
| 2asu_B | 234 | Hepatocyte growth factor-like protein; serine prot | 85.29 | |
| 2pka_B | 152 | Kallikrein A; serine proteinase; 2.05A {Sus scrofa | 85.28 | |
| 3rp2_A | 224 | RAT MAST cell protease II; serine proteinase; 1.90 | 85.2 | |
| 1fxy_A | 228 | Coagulation factor XA-trypsin chimera; protease, c | 84.7 | |
| 3fzz_A | 227 | Granzyme C; hydrolase, cytolysis, protease, serine | 84.6 | |
| 1lvm_A | 229 | Catalytic domain of the nuclear inclusion protein | 84.48 | |
| 4ag1_A | 226 | Chymase; hydrolase-de novo protein complex, inhibi | 84.11 | |
| 2aiq_A | 231 | Protein C activator; snake venom serine proteinase | 83.76 | |
| 2jde_A | 276 | Urokinase-type plasminogen activator; plasminogen | 83.7 | |
| 2oq5_A | 232 | Transmembrane protease, serine 11E; type II trans- | 83.48 | |
| 3h7o_A | 228 | Group 3 allergen smipp-S YV6023A04; hydrolase; 1.8 | 83.38 | |
| 2psx_A | 227 | Kallikrein-5; zinc inhibition, stratum corneum, gl | 82.9 | |
| 1ym0_A | 238 | Fibrinotic enzyme component B; two chains, glycosy | 82.87 | |
| 3ncl_A | 241 | Suppressor of tumorigenicity 14 protein; proteinas | 82.78 | |
| 4dgj_A | 235 | Enteropeptidase catalytic light chain; serine prot | 82.75 | |
| 2f91_A | 237 | Hepatopancreas trypsin; trypsin, canonical inhibit | 82.31 | |
| 3tvj_B | 242 | Mannan-binding lectin serine protease 2 B chain; i | 82.12 | |
| 2bhg_A | 209 | Foot-and-mouth disease virus 3C protease; chymotry | 81.55 | |
| 3gov_B | 251 | MAsp-1; complement, serine protease, beta barrel, | 81.55 |
| >4fln_A Protease DO-like 2, chloroplastic; protease, DEG, PDZ, hydrolase; 2.80A {Arabidopsis thaliana} | Back alignment and structure |
|---|
Probab=99.82 E-value=2.4e-20 Score=203.57 Aligned_cols=127 Identities=24% Similarity=0.312 Sum_probs=99.4
Q ss_pred ccccC-CCcceEEEEEEccCC--CCCCcccCCCCCCCCCeEEEEeCCCCCCCCCccCCceEEEEEecccCCC----CCCC
Q 008412 207 LSLMS-KSTSRVAILGVSSYL--KDLPNIALTPLNKRGDLLLAVGSPFGVLSPMHFFNSVSMGSVANCYPPR----STTR 279 (566)
Q Consensus 207 ~~~l~-~~~tdlAvLki~~~~--~~~~~~~~S~~~~~Gd~V~aiGSPFG~lsP~~F~nsvS~GiISn~~~~~----~~~~ 279 (566)
+++++ +..+|||||||+... ..++++..+...+.||+|+|||+|||. -..|+|.||||++.+.. ....
T Consensus 112 A~vv~~D~~~DLAvLkv~~~~~~~~~~pl~~g~~~~vGd~V~aiG~P~g~-----~~~tvT~GIVSa~~r~~~~~~~~~~ 186 (539)
T 4fln_A 112 AKVLVRGVDCDIALLSVESEDFWKGAEPLRLGHLPRLQDSVTVVGYPLGG-----DTISVTKGVVSRIEVTSYAHGSSDL 186 (539)
T ss_dssp EEEEEEETTTTEEEEEECCSSSSTTCCCCCBCCCCCTTCEEEEEECCSSS-----CCCEEEEEEEEEEEEEECTTSCCEE
T ss_pred EEEEEECCCCCEEEEEEeCCcCCcCCceeecCCcCcCCCeEEEEEcCCCC-----CCCcEEeEEECcccccccCCCCcce
Confidence 56777 445899999998532 234456666778899999999999995 23599999999885422 1223
Q ss_pred ceEEEecCCCCCCCCcceeccCCcEEEEEeeeccCCCCcceEEEeeHHHHHHHHHhhhc
Q 008412 280 SLLMADIRCLPGMEGGPVFGEHAHFVGILIRPLRQKSGAEIQLVIPWEAIATACSDLLL 338 (566)
Q Consensus 280 ~liqTDA~ilPGnsGGpVfn~~G~lIGIv~~~l~~~~g~gl~faIP~~~i~~~~~~lll 338 (566)
.+|||||+|+||||||||||.+|+||||+++.++..++.|++||||++.++.++.+++.
T Consensus 187 ~~IQtDAaInpGnSGGPLvn~~GeVIGIntai~~~~~~~gigfAIP~~~v~~vl~~l~~ 245 (539)
T 4fln_A 187 LGIQIDAAINPGNSGGPAFNDQGECIGVAFQVYRSEETENIGYVIPTTVVSHFLTDYER 245 (539)
T ss_dssp EEEEESSCCCTTTTTSEEECSSSCEEEEECCCC-----CCCEEEEEHHHHHHHHHHHHT
T ss_pred eEEEEEeEecCCCccchhccCCCcEEEEEEEEecCCCCCcceecccHHHHHHHHHHHHH
Confidence 46999999999999999999999999999999876667799999999999999988763
|
| >3sti_A Protease DEGQ; serine protease, PDZ domain, chaperone, hydrolase; 2.60A {Escherichia coli} | Back alignment and structure |
|---|
| >3lgi_A Protease DEGS; stress-sensor, HTRA, PDZ OMP, hydrolase, serine PR; 1.65A {Escherichia coli} PDB: 2qf3_A 2qf0_A 2rce_A* 3lh3_A* 3b8j_A 2qgr_A 3lh1_A 3lgy_A 3lgu_A 3lgv_A 3lgw_A 3lgt_A 2r3u_A | Back alignment and structure |
|---|
| >1ky9_A Protease DO, DEGP, HTRA; protein quality control, serine protease, trypsin, chaperone, PDZ, ATP-independent, temperature-regulated, periplasm; 2.80A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3ou0_A 4a8d_A 3otp_A 3mh7_A 3mh4_A 3mh5_A* 3mh6_A* 3cs0_A 2zle_A | Back alignment and structure |
|---|
| >3pv2_A DEGQ; trypsin fold, PDZ domain, chaperone protease, hydrolase; 2.15A {Legionella fallonii} PDB: 3pv3_A 3pv5_A 3pv4_A | Back alignment and structure |
|---|
| >4a8c_A Periplasmic PH-dependent serine endoprotease DEGQ; chaperone, hydrolase; 7.50A {Escherichia coli} PDB: 4a8a_A 4a8b_A 4a9g_A | Back alignment and structure |
|---|
| >3stj_A Protease DEGQ; serine protease, PDZ domain, protease, chaperone, DEGP, DEGQ hydrolase; 2.60A {Escherichia coli} | Back alignment and structure |
|---|
| >1l1j_A Heat shock protease HTRA; hydrolase, serine proteinase; 2.80A {Thermotoga maritima} SCOP: b.47.1.1 | Back alignment and structure |
|---|
| >1te0_A Protease DEGS; two domains, serine protease, PDZ, alpha-beta protein, hydro; 2.20A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3gdv_A* 3gcn_A* 3gds_A* 3gdu_A* 3gco_A* 1sot_A 1soz_A 1vcw_A 2r3y_A | Back alignment and structure |
|---|
| >3qo6_A Protease DO-like 1, chloroplastic; protease, HTRA, PH-sensor, hydrolase, photosynthesis; 2.50A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3tjo_A Serine protease HTRA1; peptidase, hydrolase; HET: BOG; 2.30A {Homo sapiens} PDB: 3tjn_A 3nwu_A | Back alignment and structure |
|---|
| >1y8t_A Hypothetical protein RV0983; serine protease, structural genomics, PSI, protein structure initiative; 2.00A {Mycobacterium tuberculosis} SCOP: b.36.1.4 b.47.1.1 PDB: 2z9i_A | Back alignment and structure |
|---|
| >3num_A Serine protease HTRA1; DEGP, hydrolase; 2.75A {Homo sapiens} PDB: 3nzi_A 2ytw_A 2joa_A | Back alignment and structure |
|---|
| >1lcy_A HTRA2 serine protease; apoptosis, PDZ domain, caspase activation, binding, hydrolase; 2.00A {Homo sapiens} SCOP: b.36.1.4 b.47.1.1 | Back alignment and structure |
|---|
| >3sti_A Protease DEGQ; serine protease, PDZ domain, chaperone, hydrolase; 2.60A {Escherichia coli} | Back alignment and structure |
|---|
| >3tjo_A Serine protease HTRA1; peptidase, hydrolase; HET: BOG; 2.30A {Homo sapiens} PDB: 3tjn_A 3nwu_A | Back alignment and structure |
|---|
| >4a8c_A Periplasmic PH-dependent serine endoprotease DEGQ; chaperone, hydrolase; 7.50A {Escherichia coli} PDB: 4a8a_A 4a8b_A 4a9g_A | Back alignment and structure |
|---|
| >3lgi_A Protease DEGS; stress-sensor, HTRA, PDZ OMP, hydrolase, serine PR; 1.65A {Escherichia coli} PDB: 2qf3_A 2qf0_A 2rce_A* 3lh3_A* 3b8j_A 2qgr_A 3lh1_A 3lgy_A 3lgu_A 3lgv_A 3lgw_A 3lgt_A 2r3u_A | Back alignment and structure |
|---|
| >3k6y_A Serine protease, possible membrane-associated serine protease; oxidative stress, disulfide, BENT helix, HY protease; 1.30A {Mycobacterium tuberculosis} PDB: 3k6z_A 3lt3_A | Back alignment and structure |
|---|
| >3stj_A Protease DEGQ; serine protease, PDZ domain, protease, chaperone, DEGP, DEGQ hydrolase; 2.60A {Escherichia coli} | Back alignment and structure |
|---|
| >2h5c_A Alpha-lytic protease; serine protease, acylation transition STAT catalysis, protein folding, protein stability, packing DIST hydrolase; HET: SO4; 0.82A {Lysobacter enzymogenes} SCOP: b.47.1.1 PDB: 1p02_A 1p03_A 1p04_A 1p05_A 1p06_A* 1p01_A 1p11_E 1p12_E 1qrx_A* 1tal_A 2alp_A 1ssx_A* 2h5d_A* 2ull_A 3qgj_A* 9lpr_A 1boq_A 1gbj_A 1gbk_A 1gbl_A ... | Back alignment and structure |
|---|
| >3num_A Serine protease HTRA1; DEGP, hydrolase; 2.75A {Homo sapiens} PDB: 3nzi_A 2ytw_A 2joa_A | Back alignment and structure |
|---|
| >3qo6_A Protease DO-like 1, chloroplastic; protease, HTRA, PH-sensor, hydrolase, photosynthesis; 2.50A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3k6y_A Serine protease, possible membrane-associated serine protease; oxidative stress, disulfide, BENT helix, HY protease; 1.30A {Mycobacterium tuberculosis} PDB: 3k6z_A 3lt3_A | Back alignment and structure |
|---|
| >1l1j_A Heat shock protease HTRA; hydrolase, serine proteinase; 2.80A {Thermotoga maritima} SCOP: b.47.1.1 | Back alignment and structure |
|---|
| >1te0_A Protease DEGS; two domains, serine protease, PDZ, alpha-beta protein, hydro; 2.20A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3gdv_A* 3gcn_A* 3gds_A* 3gdu_A* 3gco_A* 1sot_A 1soz_A 1vcw_A 2r3y_A | Back alignment and structure |
|---|
| >1lcy_A HTRA2 serine protease; apoptosis, PDZ domain, caspase activation, binding, hydrolase; 2.00A {Homo sapiens} SCOP: b.36.1.4 b.47.1.1 | Back alignment and structure |
|---|
| >1y8t_A Hypothetical protein RV0983; serine protease, structural genomics, PSI, protein structure initiative; 2.00A {Mycobacterium tuberculosis} SCOP: b.36.1.4 b.47.1.1 PDB: 2z9i_A | Back alignment and structure |
|---|
| >1ky9_A Protease DO, DEGP, HTRA; protein quality control, serine protease, trypsin, chaperone, PDZ, ATP-independent, temperature-regulated, periplasm; 2.80A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3ou0_A 4a8d_A 3otp_A 3mh7_A 3mh4_A 3mh5_A* 3mh6_A* 3cs0_A 2zle_A | Back alignment and structure |
|---|
| >3pv2_A DEGQ; trypsin fold, PDZ domain, chaperone protease, hydrolase; 2.15A {Legionella fallonii} PDB: 3pv3_A 3pv5_A 3pv4_A | Back alignment and structure |
|---|
| >4fln_A Protease DO-like 2, chloroplastic; protease, DEG, PDZ, hydrolase; 2.80A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2as9_A Serine protease; trypsin-like fold, hydrolase; 1.70A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >2w5e_A Putative serine protease; coiled coil, transmembrane, thiol protease, RNA replication, ribosomal frameshifting, catalytic triad, membrane; 2.00A {Human astrovirus 1} | Back alignment and structure |
|---|
| >1hpg_A Glutamic acid specific protease; serine protease, hydrolase-hydrolase inhibitor complex; 1.50A {Streptomyces griseus} SCOP: b.47.1.1 | Back alignment and structure |
|---|
| >2w5e_A Putative serine protease; coiled coil, transmembrane, thiol protease, RNA replication, ribosomal frameshifting, catalytic triad, membrane; 2.00A {Human astrovirus 1} | Back alignment and structure |
|---|
| >2oua_A Serine protease, protein NAPA; kinetic stability, acid stability, electros hydrolase; HET: 2AB; 1.85A {Nocardiopsis alba} | Back alignment and structure |
|---|
| >2ea3_A Chymotrypsin; celloulomonas, protease, hydrolase; 1.78A {Cellulomonas bogoriensis} | Back alignment and structure |
|---|
| >2pfe_A Protease A, alkaline serine protease, TFPA; beta-barrels, thermophIle, kinetic stabilit thermostability, protein folding; HET: 2AB; 1.44A {Thermobifida fusca} | Back alignment and structure |
|---|
| >2w7s_A Serine protease SPLA; hydrolase, family S1; 1.80A {Staphylococcus aureus} PDB: 2w7u_A | Back alignment and structure |
|---|
| >1agj_A Epidermolytic toxin A; hydrolase, serine protease; 1.70A {Staphylococcus aureus} SCOP: b.47.1.1 PDB: 1dua_A 1exf_A 1due_A | Back alignment and structure |
|---|
| >2sga_A Proteinase A; hydrolase (serine proteinase); 1.50A {Streptomyces griseus} SCOP: b.47.1.1 PDB: 1sgc_A 3sga_E* 4sga_E 5sga_E 2sfa_A | Back alignment and structure |
|---|
| >1qtf_A Exfoliative toxin B; serine protease, superantigen, hydrolase; 2.40A {Staphylococcus aureus} SCOP: b.47.1.1 PDB: 1dt2_A | Back alignment and structure |
|---|
| >1agj_A Epidermolytic toxin A; hydrolase, serine protease; 1.70A {Staphylococcus aureus} SCOP: b.47.1.1 PDB: 1dua_A 1exf_A 1due_A | Back alignment and structure |
|---|
| >2vid_A Serine protease SPLB; hydrolase; 1.80A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >2o8l_A V8 protease, taphylococcal serine; serine protease, enzyme, hydrolase; 1.50A {Staphylococcus aureus} SCOP: b.47.1.1 PDB: 1qy6_A | Back alignment and structure |
|---|
| >2as9_A Serine protease; trypsin-like fold, hydrolase; 1.70A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >2w7s_A Serine protease SPLA; hydrolase, family S1; 1.80A {Staphylococcus aureus} PDB: 2w7u_A | Back alignment and structure |
|---|
| >1wcz_A Glutamyl endopeptidase; virulence factor, hydrolase; 2.00A {Staphylococcus aureus} SCOP: b.47.1.1 | Back alignment and structure |
|---|
| >2qa9_E Streptogrisin-B; chymotrypsin-type serine peptidase, second tetrahedral inter tetrapeptide, beta barrels, alpha helix, hydrolase; HET: GOL; 1.18A {Streptomyces griseus} SCOP: b.47.1.1 PDB: 1sge_E 1sgn_E 1sgy_E 1sgd_E 2nu0_E 2nu1_E 2gkv_E 2nu3_E 2nu4_E 2nu2_E* 2qaa_A* 2sgd_E 2sge_E 2sgf_E 2sgp_E 2sgq_E 3sgq_E 1sgp_E 1cso_E 1ct0_E ... | Back alignment and structure |
|---|
| >1qtf_A Exfoliative toxin B; serine protease, superantigen, hydrolase; 2.40A {Staphylococcus aureus} SCOP: b.47.1.1 PDB: 1dt2_A | Back alignment and structure |
|---|
| >2vid_A Serine protease SPLB; hydrolase; 1.80A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >2o8l_A V8 protease, taphylococcal serine; serine protease, enzyme, hydrolase; 1.50A {Staphylococcus aureus} SCOP: b.47.1.1 PDB: 1qy6_A | Back alignment and structure |
|---|
| >1wcz_A Glutamyl endopeptidase; virulence factor, hydrolase; 2.00A {Staphylococcus aureus} SCOP: b.47.1.1 | Back alignment and structure |
|---|
| >1mbm_A NSP4 proteinase, chymotrypsin-like serine protease; serine proteinase, chymotrypsin-like proteinase, collapsed O HOLE, transferase; 2.00A {Equine arteritis virus} SCOP: b.47.1.3 | Back alignment and structure |
|---|
| >2oua_A Serine protease, protein NAPA; kinetic stability, acid stability, electros hydrolase; HET: 2AB; 1.85A {Nocardiopsis alba} | Back alignment and structure |
|---|
| >2qa9_E Streptogrisin-B; chymotrypsin-type serine peptidase, second tetrahedral inter tetrapeptide, beta barrels, alpha helix, hydrolase; HET: GOL; 1.18A {Streptomyces griseus} SCOP: b.47.1.1 PDB: 1sge_E 1sgn_E 1sgy_E 1sgd_E 2nu0_E 2nu1_E 2gkv_E 2nu3_E 2nu4_E 2nu2_E* 2qaa_A* 2sgd_E 2sge_E 2sgf_E 2sgp_E 2sgq_E 3sgq_E 1sgp_E 1cso_E 1ct0_E ... | Back alignment and structure |
|---|
| >1hpg_A Glutamic acid specific protease; serine protease, hydrolase-hydrolase inhibitor complex; 1.50A {Streptomyces griseus} SCOP: b.47.1.1 | Back alignment and structure |
|---|
| >2h5c_A Alpha-lytic protease; serine protease, acylation transition STAT catalysis, protein folding, protein stability, packing DIST hydrolase; HET: SO4; 0.82A {Lysobacter enzymogenes} SCOP: b.47.1.1 PDB: 1p02_A 1p03_A 1p04_A 1p05_A 1p06_A* 1p01_A 1p11_E 1p12_E 1qrx_A* 1tal_A 2alp_A 1ssx_A* 2h5d_A* 2ull_A 3qgj_A* 9lpr_A 1boq_A 1gbj_A 1gbk_A 1gbl_A ... | Back alignment and structure |
|---|
| >2pfe_A Protease A, alkaline serine protease, TFPA; beta-barrels, thermophIle, kinetic stabilit thermostability, protein folding; HET: 2AB; 1.44A {Thermobifida fusca} | Back alignment and structure |
|---|
| >1mbm_A NSP4 proteinase, chymotrypsin-like serine protease; serine proteinase, chymotrypsin-like proteinase, collapsed O HOLE, transferase; 2.00A {Equine arteritis virus} SCOP: b.47.1.3 | Back alignment and structure |
|---|
| >2ea3_A Chymotrypsin; celloulomonas, protease, hydrolase; 1.78A {Cellulomonas bogoriensis} | Back alignment and structure |
|---|
| >3fan_A Non-structural protein; chymotrypsin-like, N-terminal beta-barrels, C-terminal alpha-beta extra domain; 1.90A {Porcine respiratory and reproductivesyndrome virus} PDB: 3fao_A | Back alignment and structure |
|---|
| >1pq7_A Trypsin; ultra-high resolution, catalysis, hydrolase; HET: ARG; 0.80A {Fusarium oxysporum} SCOP: b.47.1.2 PDB: 1fy4_A 1fy5_A 1gdn_A 1gdq_A 1gdu_A 1ppz_A* 1pq5_A* 1fn8_A* 1pq8_A* 1try_A 1xvm_A 1xvo_A* 2g51_A 2g52_A 2vu8_E 1pqa_A* | Back alignment and structure |
|---|
| >2bdg_A Kallikrein-4; serine proteinase, S1 subsite, 70-80 loop, structural proteo europe, spine, structural genomics, hydrolase; HET: PBZ; 1.95A {Homo sapiens} PDB: 2bdh_A* 2bdi_A* | Back alignment and structure |
|---|
| >1gvz_A Kallikrein-1E2; antigen, prostate specific antigen, hydrolase; 1.42A {Equus caballus} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >1p3c_A Glutamyl-endopeptidase; serine protease, hydrolase; 1.50A {Bacillus intermedius} SCOP: b.47.1.1 PDB: 1p3e_A | Back alignment and structure |
|---|
| >2psx_A Kallikrein-5; zinc inhibition, stratum corneum, glcosylation, hydrolase, H hydrolase inhibitor complex; HET: AR7 NAG; 2.30A {Homo sapiens} PDB: 2psy_A* | Back alignment and structure |
|---|
| >1hj8_A Trypsin I; hydrolase, radiation damage, disulphide bond breakage, salmon, atomic resolution; HET: BAM; 1.00A {Salmo salar} SCOP: b.47.1.2 PDB: 1utm_A 1utj_A 1utl_M* 1utk_A 1bit_A 2sta_E 1bzx_E 2stb_E 2zpq_A 2zps_A 2tbs_A 2zpr_A 1mbq_A 2eek_A | Back alignment and structure |
|---|
| >1si5_H Scatter factor, hepatocyte growth factor, SF, hepatopoeitin A, LUNG; chymotrypsin homology, hormone/growth factor complex; 2.53A {Homo sapiens} SCOP: b.47.1.2 PDB: 1shy_A | Back alignment and structure |
|---|
| >4e7n_A Snake-venom thrombin-like enzyme; beta-barrel, hydrolase, arginine esterase, glycosylation, extracellular; HET: NAG; 1.75A {Agkistrodon halys} | Back alignment and structure |
|---|
| >1ao5_A Glandular kallikrein-13; serine protease, protein maturation; HET: NAG; 2.60A {Mus musculus} SCOP: b.47.1.2 PDB: 1sgf_G* | Back alignment and structure |
|---|
| >2xw9_A Complement factor D; immune system, hydrolase, serine protease, alternative pathw; HET: GOL; 1.20A {Homo sapiens} PDB: 2xwb_I* 1bio_A 1dfp_A* 1dic_A* 1dsu_A 1hfd_A 4d9r_A 1fdp_A 2xwa_A 1dst_A 4d9q_A | Back alignment and structure |
|---|
| >3s69_A Thrombin-like enzyme defibrase; beta-barrel, serine enzymes, fibrinogen binding, glycosylati hydrolase; 1.43A {Gloydius saxatilis} PDB: 1op2_A* 1op0_A* 4gso_A 1bqy_A* | Back alignment and structure |
|---|
| >1npm_A Neuropsin; serine proteinase, glycoprotein; HET: NAG; 2.10A {Mus musculus} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >4i8h_A Cationic trypsin, beta-trypsin; serine protease, hydrolase; HET: BEN; 0.75A {Bos taurus} PDB: 1aq7_A* 1auj_A* 1bju_A* 1bjv_A* 1az8_A* 1c1o_A 1c1n_A* 1c1q_A* 1c1r_A* 1c1s_A* 1c1t_A* 1c2d_A* 1c2e_A* 1c2f_A* 1c2g_A* 1c2h_A* 1c2i_A* 1c2j_A* 1c2k_A* 1c2l_A ... | Back alignment and structure |
|---|
| >1mza_A Pro-granzyme K; apoptosis, serine protease, S1 family, hydrolase; 2.23A {Homo sapiens} SCOP: b.47.1.2 PDB: 1mzd_A | Back alignment and structure |
|---|
| >1spj_A Kallikrein 1; serine protease, KLK1, HK1, hydrolase; HET: NAG; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1a7s_A Heparin binding protein; serine protease homolog, endotoxin binding; HET: NAG; 1.12A {Homo sapiens} SCOP: b.47.1.2 PDB: 1ae5_A* 1fy3_A* 1fy1_A* | Back alignment and structure |
|---|
| >2sga_A Proteinase A; hydrolase (serine proteinase); 1.50A {Streptomyces griseus} SCOP: b.47.1.1 PDB: 1sgc_A 3sga_E* 4sga_E 5sga_E 2sfa_A | Back alignment and structure |
|---|
| >3s9c_A Vipera russelli proteinase RVV-V gamma; serine proteinase, double six-stranded beta-barrels, hydrola glycosylation; HET: NAG BMA BGC GLC; 1.80A {Daboia russellii siamensis} PDB: 3s9b_A* 3s9a_A* 3sbk_A* | Back alignment and structure |
|---|
| >1fxy_A Coagulation factor XA-trypsin chimera; protease, chloromethylketone, hydrolase-hydrolase I complex; HET: 0G6; 2.15A {Homo sapiens} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >3h7t_A Group 3 allergen smipp-S YVT004A06; hydrolase; 2.00A {Sarcoptes scabiei type hominis} | Back alignment and structure |
|---|
| >2asu_B Hepatocyte growth factor-like protein; serine proteinase, beta-chain, MSP, HGFL, hydrolase; 1.85A {Homo sapiens} | Back alignment and structure |
|---|
| >3mfj_A Cationic trypsin; serine proteinase, hydrolase; 0.80A {Bos taurus} PDB: 1aq7_A* 1auj_A* 1bju_A* 1bjv_A* 1az8_A* 1c1o_A 1c1n_A* 1c1q_A* 1c1r_A* 1c1s_A* 1c1t_A* 1c2d_A* 1c2e_A* 1c2f_A* 1c2g_A* 1c2h_A* 1c2i_A* 1c2j_A* 1c2k_A* 1c2l_A ... | Back alignment and structure |
|---|
| >1lo6_A Kallikrein 6, HK6; serine protease, human kallikrein 6, benzamidine, protease, brain serine protease, myelencephalon specific protease, MSP, ZYME; 1.56A {Homo sapiens} SCOP: b.47.1.2 PDB: 1l2e_A 1gvl_A 4d8n_A* | Back alignment and structure |
|---|
| >2qxi_A Kallikrein-7; S1 pocket, chloromethyl ketone, alternate conformations, alternative splicing, glycoprotein, hydrolase, protease, secreted; HET: K7J; 1.00A {Homo sapiens} PDB: 2qxg_A* 2qxh_A* 2qxj_A* 3bsq_A | Back alignment and structure |
|---|
| >2z7f_E Leukocyte elastase; serine protease, serine protease inhibitor, disease mutation glycoprotein, hydrolase, zymogen, secreted; HET: NAG FUC; 1.70A {Homo sapiens} SCOP: b.47.1.2 PDB: 1h1b_A* 1ppg_E* 1ppf_E* 3q76_A* 3q77_A* 1hne_E 2rg3_A* 1b0f_A* | Back alignment and structure |
|---|
| >1azz_A Collagenase; complex (serine protease/inhibitor), serine protease, inhibitor, complex, protease-substrate interactions, collagen; 2.30A {Celuca pugilator} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >1ton_A Tonin; hydrolase(serine proteinase); 1.80A {Rattus rattus} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >2zch_P Prostate-specific antigen; human PSA, kallikrein related peptidases, antibodies, prostate cancer, glycoprotein, hydrolase, polymorphism; HET: NDG; 2.83A {Homo sapiens} PDB: 2zck_P* 2zcl_P* 3qum_P* | Back alignment and structure |
|---|
| >3gov_B MAsp-1; complement, serine protease, beta barrel, hydrolase, hydroxy immune response, innate immunity, sushi, coagulation, compl pathway; 2.55A {Homo sapiens} SCOP: b.47.1.0 PDB: 4djz_B | Back alignment and structure |
|---|
| >2r0l_A Hepatocyte growth factor activator; serine protease, antibody, allosteric inhibitor, EGF-like DO glycoprotein, hydrolase, kringle, secreted; HET: NAG BMA; 2.20A {Homo sapiens} PDB: 3k2u_A* 2wub_A* 2wuc_A* | Back alignment and structure |
|---|
| >2aiq_A Protein C activator; snake venom serine proteinase, hydrolas; HET: NAG NDG; 1.54A {Agkistrodon contortrix contortrix} PDB: 2aip_A* | Back alignment and structure |
|---|
| >1yph_C Chymotrypsin A, chain B; serine protease, hydrolase; 1.34A {Bos taurus} PDB: 1afq_B* 1ca0_B 1cbw_B 1cho_F 1gct_B 1ab9_B* 1ggd_B* 1gha_F 1ghb_F* 1gmc_F 1gmd_F 1gmh_F 1hja_B 1mtn_B 1n8o_B 1vgc_B* 1gg6_B 2cha_B* 2gch_F 2gct_B ... | Back alignment and structure |
|---|
| >3beu_A Trypsin, SGT; beta sheets, serine protease, hydrolase, zymogen; HET: BEN; 1.05A {Streptomyces griseus} PDB: 3i78_A 3i77_A 2fmj_A 1os8_A 1oss_A 1sgt_A | Back alignment and structure |
|---|
| >2oq5_A Transmembrane protease, serine 11E; type II trans-membrane serine proteinases, trypsin-like serine protease, tumor marker, hydrolase; 1.61A {Homo sapiens} | Back alignment and structure |
|---|
| >1fuj_A PR3, myeloblastin; hydrolase, serine protease, glycoprotein, zymogen, hydrolase protease); HET: NAG FUC; 2.20A {Homo sapiens} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >1eq9_A Chymotrypsin; FIRE ANT, serine proteinase, hydrolase; HET: PMS; 1.70A {Solenopsis invicta} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >3h7o_A Group 3 allergen smipp-S YV6023A04; hydrolase; 1.85A {Sarcoptes scabiei type hominis} SCOP: b.47.1.0 | Back alignment and structure |
|---|
| >1ddj_A Plasminogen; catalytic domain, blood clotting; 2.00A {Homo sapiens} SCOP: b.47.1.2 PDB: 1bml_A 1l4d_A 1l4z_A 1bui_A* 1rjx_B 1qrz_A | Back alignment and structure |
|---|
| >3gyl_B Prostasin; ENAC, zymogen, divalent cation, channel activatin membrane, disulfide bond, glycoprotein, hydrolase, membrane protease, secreted; 1.30A {Homo sapiens} PDB: 3gym_A 3e16_B* 3e0p_B* 3e0n_B* 3e1x_B 3fvf_B* 3dfj_A 3dfl_A* | Back alignment and structure |
|---|
| >2f91_A Hepatopancreas trypsin; trypsin, canonical inhibitor, atomic resolution, hydrolase/hydrolase inhibitor complex; 1.20A {Pontastacus leptodactylus} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >1cgh_A Cathepsin G; inflammation, specificity, serine protease, hydrolase-hydrol inhibitor complex; HET: 1ZG; 1.80A {Homo sapiens} SCOP: b.47.1.2 PDB: 1au8_A* 1t32_A* 1kyn_A* | Back alignment and structure |
|---|
| >1sgf_A 7S NGF, nerve growth factor; growth factor (beta-NGF), hydrolase - serine proteinase (GAM inactive serine proteinase (alpha-NGF); HET: NAG NDG; 3.15A {Mus musculus} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >1orf_A Granzyme A; hydrolase-hydrolase inhibitor complex; HET: 0G6; 2.40A {Homo sapiens} SCOP: b.47.1.2 PDB: 1op8_A | Back alignment and structure |
|---|
| >1yc0_A Hepatocyte growth factor activator; hydrolase/inhibitor, hydrolase-inhibitor complex; 2.60A {Homo sapiens} PDB: 1ybw_A 2r0k_A | Back alignment and structure |
|---|
| >1iau_A Granzyme B; hydrolase-hydrolase inhibitor complex; HET: ASJ NAG FUC MAN BMA; 2.00A {Homo sapiens} SCOP: b.47.1.2 PDB: 1fq3_A* 1fi8_A 3tk9_A 3tju_A 3tjv_A | Back alignment and structure |
|---|
| >2zgc_A Granzyme M; serine protease, cytolysis, glycoprotein, hydrolase, secrete zymogen; 1.96A {Homo sapiens} PDB: 2zgh_A 2zks_A 2zgj_A | Back alignment and structure |
|---|
| >4ag1_A Chymase; hydrolase-de novo protein complex, inhibitor, serine proteas; 1.40A {Homo sapiens} PDB: 4afs_A 4afu_A 4afz_A* 4afq_A 4ag2_A* 1nn6_A* 1klt_A* 3n7o_A* 1t31_A* 1pjp_A* 2hvx_A* 3s0n_A* 2rdl_A | Back alignment and structure |
|---|
| >3ncl_A Suppressor of tumorigenicity 14 protein; proteinase-inhibitor complex, serine proteinase, benzamidine phosphonate, serine endopeptidases; HET: CCZ; 1.19A {Homo sapiens} SCOP: b.47.1.2 PDB: 3bn9_B* 3nps_A 3so3_A* 1eax_A 1eaw_A 2gv6_A* 2gv7_A* 3p8g_A* 3p8f_A* | Back alignment and structure |
|---|
| >3mhw_U Urokinase-type plasminogen activator; hydrolase, blood coagulation, fibrinolysis, plasminogen activation; HET: ABV; 1.45A {Homo sapiens} SCOP: b.47.1.2 PDB: 1w10_U* 1w11_U* 1w12_U* 1w13_U* 1w14_U* 1w0z_U* 2vip_A* 1f5k_U 1f5l_A* 1f92_A* 2r2w_U* 2vin_A* 2vio_A* 1ejn_A* 2viq_A* 2viv_A* 2viw_A* 1vja_U* 1vj9_U* 1sc8_U* ... | Back alignment and structure |
|---|
| >3fan_A Non-structural protein; chymotrypsin-like, N-terminal beta-barrels, C-terminal alpha-beta extra domain; 1.90A {Porcine respiratory and reproductivesyndrome virus} PDB: 3fao_A | Back alignment and structure |
|---|
| >3fzz_A Granzyme C; hydrolase, cytolysis, protease, serine protease, zymogen; 2.50A {Mus musculus} SCOP: b.47.1.2 PDB: 3g01_A | Back alignment and structure |
|---|
| >1ym0_A Fibrinotic enzyme component B; two chains, glycosylation, pyroglutamation, eight-membered R peptide bond, hydrolase; HET: NAG MAN FUC; 2.06A {Eisenia fetida} | Back alignment and structure |
|---|
| >1m9u_A Earthworm fibrinolytic enzyme; hydrolase, serine protease (elastase-like); 2.30A {Eisenia fetida} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >1elt_A Elastase; serine proteinase; 1.61A {Salmo salar} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >1euf_A Duodenase; serine protease, dual specificity, hydrola; HET: NAG; 2.40A {Bos taurus} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >4dgj_A Enteropeptidase catalytic light chain; serine protease, hydrolase; 1.90A {Homo sapiens} PDB: 1ekb_B | Back alignment and structure |
|---|
| >2any_A Kininogenin, plasma kallikrein, light chain, fletcher factor; mutagenically deglycosyalted human plasma kallikrein protease domain; HET: BAM; 1.40A {Homo sapiens} PDB: 2anw_A* | Back alignment and structure |
|---|
| >3bg8_A Coagulation factor XIA light chain; protease inhibitor, factor XIA inhibitor complex, covalent inhibitor, alternative splicing, blood coagulation; HET: INH; 1.60A {Homo sapiens} PDB: 3sor_A* 3sos_A* 1zsl_A* 1zpz_A* 1zrk_A* 1xx9_A* 1zjd_A 1zhr_A 1zmj_A* 1zml_A* 1zmn_A* 1zom_A* 1zpb_A* 1zpc_A* 1zsj_A* 1zsk_A* 1ztj_A* 1ztk_A* 1ztl_A* 2fda_A* ... | Back alignment and structure |
|---|
| >1gvk_B Elastase 1, peptide inhibitor; hydrolase, serine protease, catalytic intermediate, atomic resolution, hydrolase-hydrolase inhibitor complex; 0.94A {Sus scrofa} SCOP: b.47.1.2 PDB: 1bma_A* 1b0e_A* 1e34_B* 1e35_B* 1e36_B* 1e37_B* 1e38_B* 1eas_A* 1eat_A* 1eau_A* 1ela_A* 1elb_A* 1elc_A* 1eld_E* 1ele_E* 1elf_A* 1elg_A* 1esa_A 1esb_A* 1est_A* ... | Back alignment and structure |
|---|
| >2f9n_A Alpha I tryptase; serine proteinase, trypsin-like, difucosylation, hydrolase-hydrolase inhibitor complex; HET: AR7 NAG FUC; 1.60A {Homo sapiens} PDB: 2f9o_A* 2f9p_A* 1lto_A 2fpz_A* 2bm2_A* 2fs8_A* 2fs9_A* 2fww_A* 2fxr_A* 2gdd_A* 2za5_A* 3v7t_A* 4a6l_A* 1a0l_A* 2zec_A* 2zeb_A* | Back alignment and structure |
|---|
| >2hlc_A Collagenase; serine protease, hydrolase, collagen degradation; 1.70A {Hypoderma lineatum} SCOP: b.47.1.2 PDB: 1hyl_A | Back alignment and structure |
|---|
| >3tvj_B Mannan-binding lectin serine protease 2 B chain; in vitro evolution, specific inhibitor, allostery, hydrolase; 1.28A {Homo sapiens} PDB: 4fxg_H* | Back alignment and structure |
|---|
| >2bz6_H Blood coagulation factor VIIA; serine protease, enzyme complex, hydrolase; HET: 346; 1.6A {Homo sapiens} SCOP: b.47.1.2 PDB: 1cvw_H* 1dva_H* 1fak_H* 1j9c_H* 1jbu_H 1dan_H 1klj_H 1o5d_H* 1qfk_H* 1w0y_H* 1w2k_H* 1w7x_H* 1w8b_H* 1wqv_H* 1wss_H* 1wtg_H* 1wun_H* 1wv7_H* 1ygc_H* 1z6j_H* ... | Back alignment and structure |
|---|
| >3rp2_A RAT MAST cell protease II; serine proteinase; 1.90A {Rattus rattus} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >1t8o_A Chymotrypsin A; chymotrypsin, serine proteinase, BPTI, protein-protein interaction, non-cognate binding, S1 pocket, primary specificity; 1.70A {Bos taurus} SCOP: b.47.1.2 PDB: 1cgi_E 1cgj_E 1chg_A 1ex3_A 1acb_E 1gl0_E 1gl1_A 1gcd_A* 1oxg_A 1k2i_1 1p2n_A 1p2o_A 1p2q_A 1t7c_A 1t8l_A 1t8m_A 1t8n_A 1p2m_A 2cga_A 2y6t_A ... | Back alignment and structure |
|---|
| >2jkh_A Activated factor XA heavy chain; plasma, calcium, zymogen, secreted, protease, hydrolase, polymorphism, glycoprotein, gamma-carboxyglutamic acid; HET: BI7; 1.25A {Homo sapiens} PDB: 2bok_A* 2vvc_A* 2vvu_A* 2vvv_A* 2vwl_A* 2vwm_A* 2vwn_A* 2vwo_A* 2xbv_A* 1c5m_D 2vh0_A* 1ezq_A* 1f0s_A* 1ksn_A* 1f0r_A* 1lpk_B* 1lpz_B* 1lqd_B* 1nfu_A* 1nfw_A* ... | Back alignment and structure |
|---|
| >3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} | Back alignment and structure |
|---|
| >3f1s_B Vitamin K-dependent protein Z; PZ, ZPI, complex, serpin, protease inhibitor, protease, GLYC secreted, serine protease inhibitor, blood coagulation; HET: FLC NAG; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >1arb_A Achromobacter protease I; hydrolase(serine protease); 1.20A {Achromobacter lyticus} SCOP: b.47.1.1 PDB: 1arc_A* | Back alignment and structure |
|---|
| >1bru_P Elastase, PPE; serine protease, hydrolase; HET: 1NB; 2.30A {Sus scrofa} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >1pyt_D TC, PCPA-TC, chymotrypsinogen C; ternary complex (zymogen), serine proteinase, C-terminal peptidase; 2.35A {Bos taurus} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >1aut_C Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: b.47.1.2 PDB: 3f6u_H* | Back alignment and structure |
|---|
| >1z8g_A Serine protease hepsin; serine protease hepsin, protease, hydrolase-hydrolase inhibi complex; HET: AR7; 1.55A {Homo sapiens} SCOP: b.47.1.2 d.170.1.2 PDB: 3t2n_A 1o5e_H* 1o5f_H* 1p57_B* 1o5e_L* 1o5f_L* 1p57_A* | Back alignment and structure |
|---|
| >1rtf_B (TC)-T-PA, two chain tissue plasminogen activator; serine protease, fibrinolytic enzymes; HET: BEN; 2.30A {Homo sapiens} SCOP: b.47.1.2 PDB: 1a5h_A* 1bda_A* 1a5i_A* | Back alignment and structure |
|---|
| >2wph_S Coagulation factor IXA heavy chain; serine protease, zymogen, hydrolase, glycoprotein, hydroxylation, phosphoprotein, sulfation, hemostasis; HET: DPN 1PE; 1.50A {Homo sapiens} PDB: 2wpj_S* 2wpk_S* 2wpl_S* 2wpi_S* 2wpm_S 3lc3_A* 1rfn_A* 3lc5_A* 3kcg_H* 1x7a_C* 1pfx_C* | Back alignment and structure |
|---|
| >1fiw_A Beta-acrosin heavy chain; anti-parallel beta-barrel, hydrolase; HET: NAG FUL BMA MAN PBZ; 2.10A {Ovis aries} SCOP: b.47.1.2 PDB: 1fiz_A* | Back alignment and structure |
|---|
| >2qy0_B Complement C1R subcomponent; serine protease, beta barrel, complement pathway like domain, glycoprotein, hydrolase, hydroxylation, immune response; 2.60A {Homo sapiens} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >1zyo_A Serine protease; beta-barrel, glutamyl endopeptidase, hydrolase; 2.40A {Sesbania mosaic virus} | Back alignment and structure |
|---|
| >1fon_A Procarboxypeptidase A-S6; truncated zymogen E, serine protease; 1.70A {Bos taurus} SCOP: b.47.1.2 PDB: 1pyt_C | Back alignment and structure |
|---|
| >4dur_A Plasminogen, serine protease; fibrinolysis, hydrolase; HET: NAG GAL SIA; 2.45A {Homo sapiens} PDB: 4a5t_S* 4duu_A 2feb_A | Back alignment and structure |
|---|
| >2olg_A Pro-phenoloxidase activating enzyme-I; prophenoloxidase activating factor-I, PPAF-I, serine proteas hydrolase; HET: NAG; 1.70A {Holotrichia diomphalia} | Back alignment and structure |
|---|
| >1zjk_A Mannan-binding lectin serine protease 2; beta barrel, modular protein, hydrolase; 2.18A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 g.18.1.1 PDB: 1q3x_A | Back alignment and structure |
|---|
| >3cp7_A Alkaline serine protease Al20; trypsin-like, hydrolase; 1.39A {Nesterenkonia abyssinica} | Back alignment and structure |
|---|
| >4f4o_C Haptoglobin; globin fold, serine protease fold, complement control protei haemoglobin scavenging, oxygen storage-transport complex; HET: HEM NAG FUC; 2.90A {Sus scrofa} | Back alignment and structure |
|---|
| >1md8_A C1R complement serine protease; innate immunity, activation, substrate specificity, hydrolase; 2.80A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 PDB: 1md7_A* | Back alignment and structure |
|---|
| >2xrc_A Human complement factor I; immune system, hydrolase, conglutinogen activating factor, S protease, complement system; HET: NAG; 2.69A {Homo sapiens} | Back alignment and structure |
|---|
| >2vnt_A Urokinase-type plasminogen activator; UPA, inhibitor complex, hydrolase; HET: QGG; 2.2A {Homo sapiens} | Back alignment and structure |
|---|
| >1gpz_A Complement C1R component; hydrolase, activation, innate immunity, modular structure, serine protease; HET: NAG FUC MAN; 2.9A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 g.18.1.1 | Back alignment and structure |
|---|
| >2b9l_A Prophenoloxidase activating factor; CLIP domain, easter, innate immunity, melanin, immune system binding complex; HET: NAG FUC; 2.00A {Holotrichia diomphalia} | Back alignment and structure |
|---|
| >2xxl_A GRAM-positive specific serine protease, isoform B; hydrolase, innate immunity; HET: NAG FUC BMA; 1.80A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1p3c_A Glutamyl-endopeptidase; serine protease, hydrolase; 1.50A {Bacillus intermedius} SCOP: b.47.1.1 PDB: 1p3e_A | Back alignment and structure |
|---|
| >3rm2_H Thrombin heavy chain; serine protease, kringle, hydrolase, blood coagulation, BLOO clotting, convertion of fibrinogen to fibrin; HET: TYS NAG S00; 1.23A {Homo sapiens} PDB: 1a2c_H* 1a3e_H* 1a46_H* 1a4w_H* 1a5g_H* 1a61_H* 1abi_H* 1abj_H* 1ad8_H* 1ae8_H* 1afe_H* 1a3b_H* 1ai8_H* 1aix_H* 1awf_H* 1awh_B* 1ay6_H* 1b5g_H* 1ba8_B* 1bb0_B* ... | Back alignment and structure |
|---|
| >3mmg_A Nuclear inclusion protein A; 3C-type protease, TEV, TVMV, viral protein, hydrolase; 1.70A {Tobacco vein mottling virus} SCOP: b.47.1.0 | Back alignment and structure |
|---|
| >2f83_A Coagulation factor XI; protease, apple domain, hydrolase; HET: NAG; 2.87A {Homo sapiens} PDB: 2j8j_A 2j8l_A | Back alignment and structure |
|---|
| >2bdy_A Thrombin; thrombin, complex structure, hydrolase, hydrolase-hydrolase complex; HET: TYS UNB; 1.61A {Homo sapiens} SCOP: b.47.1.2 PDB: 3k65_B 1doj_A* 1hag_E* 1xm1_A* 1nu9_A* 3sqe_E 3sqh_E 1jwt_A* 1d9i_A* 1d6w_A* 1g37_A* 1nm6_A* 1nt1_A* 1sl3_A* 1ta2_A* 1ta6_A* 1z71_A* 1zgi_A* 1zgv_A* 1zrb_A* ... | Back alignment and structure |
|---|
| >1lvm_A Catalytic domain of the nuclear inclusion protein A (NIA); beta barrel, chymotrypsin-type cystein protease, enzyme- peptide complex; 1.80A {Tobacco etch virus} SCOP: b.47.1.3 PDB: 1lvb_A 1q31_A | Back alignment and structure |
|---|
| >1elv_A Complement C1S component; trypsin-like serin protease, CCP (OR sushi or SCR)module, HY; HET: NAG FUC NES; 1.70A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 | Back alignment and structure |
|---|
| >1pq7_A Trypsin; ultra-high resolution, catalysis, hydrolase; HET: ARG; 0.80A {Fusarium oxysporum} SCOP: b.47.1.2 PDB: 1fy4_A 1fy5_A 1gdn_A 1gdq_A 1gdu_A 1ppz_A* 1pq5_A* 1fn8_A* 1pq8_A* 1try_A 1xvm_A 1xvo_A* 2g51_A 2g52_A 2vu8_E 1pqa_A* | Back alignment and structure |
|---|
| >3mmg_A Nuclear inclusion protein A; 3C-type protease, TEV, TVMV, viral protein, hydrolase; 1.70A {Tobacco vein mottling virus} SCOP: b.47.1.0 | Back alignment and structure |
|---|
| >1rrk_A Complement factor B; BB, hydrolase; 2.00A {Homo sapiens} SCOP: b.47.1.2 c.62.1.1 PDB: 1rs0_A* 1rtk_A* 2win_I* 1dle_A | Back alignment and structure |
|---|
| >1mza_A Pro-granzyme K; apoptosis, serine protease, S1 family, hydrolase; 2.23A {Homo sapiens} SCOP: b.47.1.2 PDB: 1mzd_A | Back alignment and structure |
|---|
| >3nxp_A Prethrombin-1; allostery, blood coagulation, hydro kringle, serine protease, zymogen; HET: NAG; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >3s9c_A Vipera russelli proteinase RVV-V gamma; serine proteinase, double six-stranded beta-barrels, hydrola glycosylation; HET: NAG BMA BGC GLC; 1.80A {Daboia russellii siamensis} PDB: 3s9b_A* 3s9a_A* 3sbk_A* | Back alignment and structure |
|---|
| >2pka_B Kallikrein A; serine proteinase; 2.05A {Sus scrofa} SCOP: b.47.1.2 PDB: 2kai_B 1hia_B | Back alignment and structure |
|---|
| >1fuj_A PR3, myeloblastin; hydrolase, serine protease, glycoprotein, zymogen, hydrolase protease); HET: NAG FUC; 2.20A {Homo sapiens} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >3hrz_D Complement factor B; serine protease, glycosilated, multi-domain, complement SYST convertase, complement alternate pathway; HET: NAG P6G; 2.20A {Homo sapiens} PDB: 2xwj_I* 3hs0_D* 2ok5_A* 2xwb_F* | Back alignment and structure |
|---|
| >1zyo_A Serine protease; beta-barrel, glutamyl endopeptidase, hydrolase; 2.40A {Sesbania mosaic virus} | Back alignment and structure |
|---|
| >2odp_A Complement C2; C3/C5 convertase, complement serin protease, human complement system, glycoprotein, SP, VWFA,; HET: NAG; 1.90A {Homo sapiens} PDB: 2odq_A* 2i6q_A* 2i6s_A* | Back alignment and structure |
|---|
| >1ao5_A Glandular kallikrein-13; serine protease, protein maturation; HET: NAG; 2.60A {Mus musculus} SCOP: b.47.1.2 PDB: 1sgf_G* | Back alignment and structure |
|---|
| >3su6_A NS3 protease, NS4A protein; drug resistance, drug design, protease inhibitors, serine PR viral protein, hydrolase-inhibitor complex; HET: SU3; 1.10A {Hepatitis c virus} PDB: 3su2_A* 3sv9_A* 3m5l_A* 3m5m_A* 3m5n_A 3m5o_A 3rc4_A 3rc5_A 3rc6_A 3su3_A* 3su4_A* 3sv6_A* 3sv7_A* 3su1_A* 3su5_A* 3sv8_A* 3su0_A* 2p59_A* 2qv1_A 1a1q_A ... | Back alignment and structure |
|---|
| >1cgh_A Cathepsin G; inflammation, specificity, serine protease, hydrolase-hydrol inhibitor complex; HET: 1ZG; 1.80A {Homo sapiens} SCOP: b.47.1.2 PDB: 1au8_A* 1t32_A* 1kyn_A* | Back alignment and structure |
|---|
| >3h7t_A Group 3 allergen smipp-S YVT004A06; hydrolase; 2.00A {Sarcoptes scabiei type hominis} | Back alignment and structure |
|---|
| >1lo6_A Kallikrein 6, HK6; serine protease, human kallikrein 6, benzamidine, protease, brain serine protease, myelencephalon specific protease, MSP, ZYME; 1.56A {Homo sapiens} SCOP: b.47.1.2 PDB: 1l2e_A 1gvl_A 4d8n_A* | Back alignment and structure |
|---|
| >1si5_H Scatter factor, hepatocyte growth factor, SF, hepatopoeitin A, LUNG; chymotrypsin homology, hormone/growth factor complex; 2.53A {Homo sapiens} SCOP: b.47.1.2 PDB: 1shy_A | Back alignment and structure |
|---|
| >1spj_A Kallikrein 1; serine protease, KLK1, HK1, hydrolase; HET: NAG; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >4e7n_A Snake-venom thrombin-like enzyme; beta-barrel, hydrolase, arginine esterase, glycosylation, extracellular; HET: NAG; 1.75A {Agkistrodon halys} | Back alignment and structure |
|---|
| >2bdg_A Kallikrein-4; serine proteinase, S1 subsite, 70-80 loop, structural proteo europe, spine, structural genomics, hydrolase; HET: PBZ; 1.95A {Homo sapiens} PDB: 2bdh_A* 2bdi_A* | Back alignment and structure |
|---|
| >3s69_A Thrombin-like enzyme defibrase; beta-barrel, serine enzymes, fibrinogen binding, glycosylati hydrolase; 1.43A {Gloydius saxatilis} PDB: 1op2_A* 1op0_A* 4gso_A 1bqy_A* | Back alignment and structure |
|---|
| >2zgc_A Granzyme M; serine protease, cytolysis, glycoprotein, hydrolase, secrete zymogen; 1.96A {Homo sapiens} PDB: 2zgh_A 2zks_A 2zgj_A | Back alignment and structure |
|---|
| >1ton_A Tonin; hydrolase(serine proteinase); 1.80A {Rattus rattus} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >1hj8_A Trypsin I; hydrolase, radiation damage, disulphide bond breakage, salmon, atomic resolution; HET: BAM; 1.00A {Salmo salar} SCOP: b.47.1.2 PDB: 1utm_A 1utj_A 1utl_M* 1utk_A 1bit_A 2sta_E 1bzx_E 2stb_E 2zpq_A 2zps_A 2tbs_A 2zpr_A 1mbq_A 2eek_A | Back alignment and structure |
|---|
| >2zch_P Prostate-specific antigen; human PSA, kallikrein related peptidases, antibodies, prostate cancer, glycoprotein, hydrolase, polymorphism; HET: NDG; 2.83A {Homo sapiens} PDB: 2zck_P* 2zcl_P* 3qum_P* | Back alignment and structure |
|---|
| >1iau_A Granzyme B; hydrolase-hydrolase inhibitor complex; HET: ASJ NAG FUC MAN BMA; 2.00A {Homo sapiens} SCOP: b.47.1.2 PDB: 1fq3_A* 1fi8_A 3tk9_A 3tju_A 3tjv_A | Back alignment and structure |
|---|
| >4i8h_A Cationic trypsin, beta-trypsin; serine protease, hydrolase; HET: BEN; 0.75A {Bos taurus} PDB: 1aq7_A* 1auj_A* 1bju_A* 1bjv_A* 1az8_A* 1c1o_A 1c1n_A* 1c1q_A* 1c1r_A* 1c1s_A* 1c1t_A* 1c2d_A* 1c2e_A* 1c2f_A* 1c2g_A* 1c2h_A* 1c2i_A* 1c2j_A* 1c2k_A* 1c2l_A ... | Back alignment and structure |
|---|
| >1npm_A Neuropsin; serine proteinase, glycoprotein; HET: NAG; 2.10A {Mus musculus} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >3gyl_B Prostasin; ENAC, zymogen, divalent cation, channel activatin membrane, disulfide bond, glycoprotein, hydrolase, membrane protease, secreted; 1.30A {Homo sapiens} PDB: 3gym_A 3e16_B* 3e0p_B* 3e0n_B* 3e1x_B 3fvf_B* 3dfj_A 3dfl_A* | Back alignment and structure |
|---|
| >2z7f_E Leukocyte elastase; serine protease, serine protease inhibitor, disease mutation glycoprotein, hydrolase, zymogen, secreted; HET: NAG FUC; 1.70A {Homo sapiens} SCOP: b.47.1.2 PDB: 1h1b_A* 1ppg_E* 1ppf_E* 3q76_A* 3q77_A* 1hne_E 2rg3_A* 1b0f_A* | Back alignment and structure |
|---|
| >1euf_A Duodenase; serine protease, dual specificity, hydrola; HET: NAG; 2.40A {Bos taurus} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >3mfj_A Cationic trypsin; serine proteinase, hydrolase; 0.80A {Bos taurus} PDB: 1aq7_A* 1auj_A* 1bju_A* 1bjv_A* 1az8_A* 1c1o_A 1c1n_A* 1c1q_A* 1c1r_A* 1c1s_A* 1c1t_A* 1c2d_A* 1c2e_A* 1c2f_A* 1c2g_A* 1c2h_A* 1c2i_A* 1c2j_A* 1c2k_A* 1c2l_A ... | Back alignment and structure |
|---|
| >1a7s_A Heparin binding protein; serine protease homolog, endotoxin binding; HET: NAG; 1.12A {Homo sapiens} SCOP: b.47.1.2 PDB: 1ae5_A* 1fy3_A* 1fy1_A* | Back alignment and structure |
|---|
| >2asu_B Hepatocyte growth factor-like protein; serine proteinase, beta-chain, MSP, HGFL, hydrolase; 1.85A {Homo sapiens} | Back alignment and structure |
|---|
| >2pka_B Kallikrein A; serine proteinase; 2.05A {Sus scrofa} SCOP: b.47.1.2 PDB: 2kai_B 1hia_B | Back alignment and structure |
|---|
| >3rp2_A RAT MAST cell protease II; serine proteinase; 1.90A {Rattus rattus} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >1fxy_A Coagulation factor XA-trypsin chimera; protease, chloromethylketone, hydrolase-hydrolase I complex; HET: 0G6; 2.15A {Homo sapiens} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >3fzz_A Granzyme C; hydrolase, cytolysis, protease, serine protease, zymogen; 2.50A {Mus musculus} SCOP: b.47.1.2 PDB: 3g01_A | Back alignment and structure |
|---|
| >1lvm_A Catalytic domain of the nuclear inclusion protein A (NIA); beta barrel, chymotrypsin-type cystein protease, enzyme- peptide complex; 1.80A {Tobacco etch virus} SCOP: b.47.1.3 PDB: 1lvb_A 1q31_A | Back alignment and structure |
|---|
| >4ag1_A Chymase; hydrolase-de novo protein complex, inhibitor, serine proteas; 1.40A {Homo sapiens} PDB: 4afs_A 4afu_A 4afz_A* 4afq_A 4ag2_A* 1nn6_A* 1klt_A* 3n7o_A* 1t31_A* 1pjp_A* 2hvx_A* 3s0n_A* 2rdl_A | Back alignment and structure |
|---|
| >2aiq_A Protein C activator; snake venom serine proteinase, hydrolas; HET: NAG NDG; 1.54A {Agkistrodon contortrix contortrix} PDB: 2aip_A* | Back alignment and structure |
|---|
| >2oq5_A Transmembrane protease, serine 11E; type II trans-membrane serine proteinases, trypsin-like serine protease, tumor marker, hydrolase; 1.61A {Homo sapiens} | Back alignment and structure |
|---|
| >3h7o_A Group 3 allergen smipp-S YV6023A04; hydrolase; 1.85A {Sarcoptes scabiei type hominis} SCOP: b.47.1.0 | Back alignment and structure |
|---|
| >2psx_A Kallikrein-5; zinc inhibition, stratum corneum, glcosylation, hydrolase, H hydrolase inhibitor complex; HET: AR7 NAG; 2.30A {Homo sapiens} PDB: 2psy_A* | Back alignment and structure |
|---|
| >1ym0_A Fibrinotic enzyme component B; two chains, glycosylation, pyroglutamation, eight-membered R peptide bond, hydrolase; HET: NAG MAN FUC; 2.06A {Eisenia fetida} | Back alignment and structure |
|---|
| >3ncl_A Suppressor of tumorigenicity 14 protein; proteinase-inhibitor complex, serine proteinase, benzamidine phosphonate, serine endopeptidases; HET: CCZ; 1.19A {Homo sapiens} SCOP: b.47.1.2 PDB: 3bn9_B* 3nps_A 3so3_A* 1eax_A 1eaw_A 2gv6_A* 2gv7_A* 3p8g_A* 3p8f_A* | Back alignment and structure |
|---|
| >4dgj_A Enteropeptidase catalytic light chain; serine protease, hydrolase; 1.90A {Homo sapiens} PDB: 1ekb_B | Back alignment and structure |
|---|
| >2f91_A Hepatopancreas trypsin; trypsin, canonical inhibitor, atomic resolution, hydrolase/hydrolase inhibitor complex; 1.20A {Pontastacus leptodactylus} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >3tvj_B Mannan-binding lectin serine protease 2 B chain; in vitro evolution, specific inhibitor, allostery, hydrolase; 1.28A {Homo sapiens} PDB: 4fxg_H* | Back alignment and structure |
|---|
| >2bhg_A Foot-and-mouth disease virus 3C protease; chymotrypsin-like cysteine protease, capsid protein, core protein; 1.9A {Foot-and-mouth disease virus} SCOP: b.47.1.4 PDB: 2j92_A 2wv4_A 2wv5_A | Back alignment and structure |
|---|
| >3gov_B MAsp-1; complement, serine protease, beta barrel, hydrolase, hydroxy immune response, innate immunity, sushi, coagulation, compl pathway; 2.55A {Homo sapiens} SCOP: b.47.1.0 PDB: 4djz_B | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 566 | ||||
| d1l1ja_ | 228 | b.47.1.1 (A:) Protease Do (DegP, HtrA), catalytic | 4e-06 | |
| d2z9ia2 | 221 | b.47.1.1 (A:6-226) Protease PepD {Mycobacterium tu | 3e-04 | |
| d1ky9a2 | 249 | b.47.1.1 (A:11-259) Protease Do (DegP, HtrA), cata | 0.002 |
| >d1l1ja_ b.47.1.1 (A:) Protease Do (DegP, HtrA), catalytic domain {Thermotoga maritima [TaxId: 2336]} Length = 228 | Back information, alignment and structure |
|---|
class: All beta proteins fold: Trypsin-like serine proteases superfamily: Trypsin-like serine proteases family: Prokaryotic proteases domain: Protease Do (DegP, HtrA), catalytic domain species: Thermotoga maritima [TaxId: 2336]
Score = 45.7 bits (107), Expect = 4e-06
Identities = 21/113 (18%), Positives = 37/113 (32%), Gaps = 2/113 (1%)
Query: 227 KDLPNIALTPLN--KRGDLLLAVGSPFGVLSPMHFFNSVSMGSVANCYPPRSTTRSLLMA 284
K P + + K G+ +A+G+P G + + L+
Sbjct: 115 KKFPYLEFGDSDKVKIGEWAIAIGNPLGFQHTVTVGVVSATNRRIPKPDGSGYYVGLIQT 174
Query: 285 DIRCLPGMEGGPVFGEHAHFVGILIRPLRQKSGAEIQLVIPWEAIATACSDLL 337
D PG GGP+ H +GI + + + IP + +L
Sbjct: 175 DAAINPGNSGGPLLNIHGEVIGINTAIVNPQEAVNLGFAIPINTVKKFLDTIL 227
|
| >d2z9ia2 b.47.1.1 (A:6-226) Protease PepD {Mycobacterium tuberculosis [TaxId: 1773]} Length = 221 | Back information, alignment and structure |
|---|
| >d1ky9a2 b.47.1.1 (A:11-259) Protease Do (DegP, HtrA), catalytic domain {Escherichia coli [TaxId: 562]} Length = 249 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 566 | |||
| d1ky9a2 | 249 | Protease Do (DegP, HtrA), catalytic domain {Escher | 99.84 | |
| d1l1ja_ | 228 | Protease Do (DegP, HtrA), catalytic domain {Thermo | 99.76 | |
| d2qf3a1 | 210 | Stress sensor protease DegS, catalytic domain {Esc | 99.63 | |
| d2z9ia2 | 221 | Protease PepD {Mycobacterium tuberculosis [TaxId: | 99.6 | |
| d1l1ja_ | 228 | Protease Do (DegP, HtrA), catalytic domain {Thermo | 99.56 | |
| d1ky9a2 | 249 | Protease Do (DegP, HtrA), catalytic domain {Escher | 99.56 | |
| d1lcya2 | 205 | Mitochondrial serine protease HtrA2, catalytic dom | 99.56 | |
| d2z9ia2 | 221 | Protease PepD {Mycobacterium tuberculosis [TaxId: | 99.54 | |
| d1lcya2 | 205 | Mitochondrial serine protease HtrA2, catalytic dom | 99.52 | |
| d2qf3a1 | 210 | Stress sensor protease DegS, catalytic domain {Esc | 99.5 | |
| d1lvmb_ | 219 | TEV protease (nucleat inclusion protein A, NIA) {T | 99.39 | |
| d1agja_ | 242 | Epidermolytic (exfoliative) toxin A {Staphylococcu | 99.29 | |
| d2qaaa1 | 185 | Protease B {Streptomyces griseus, strain k1 [TaxId | 99.25 | |
| d2bhga1 | 199 | 3C cysteine protease (picornain 3C) {Foot-and-mout | 99.21 | |
| d1lvmb_ | 219 | TEV protease (nucleat inclusion protein A, NIA) {T | 99.04 | |
| d1agja_ | 242 | Epidermolytic (exfoliative) toxin A {Staphylococcu | 98.87 | |
| d2sgaa_ | 181 | Protease A {Streptomyces griseus, strain k1 [TaxId | 98.79 | |
| d1qtfa_ | 246 | Exfoliative toxin B {Staphylococcus aureus [TaxId: | 98.76 | |
| d2h5ca1 | 198 | alpha-Lytic protease {Lysobacter enzymogenes, 495 | 98.74 | |
| d1qtfa_ | 246 | Exfoliative toxin B {Staphylococcus aureus [TaxId: | 98.57 | |
| d2o8la1 | 216 | V8 protease {Staphylococcus aureus [TaxId: 1280]} | 98.33 | |
| d1p3ca_ | 215 | Glutamyl endopeptidase {Bacillus intermedius [TaxI | 98.18 | |
| d2o8la1 | 216 | V8 protease {Staphylococcus aureus [TaxId: 1280]} | 98.09 | |
| d1hpga_ | 187 | Glutamic acid-specific protease {Streptomyces gris | 97.83 | |
| d2qaaa1 | 185 | Protease B {Streptomyces griseus, strain k1 [TaxId | 97.48 | |
| d1p3ca_ | 215 | Glutamyl endopeptidase {Bacillus intermedius [TaxI | 97.48 | |
| d2bhga1 | 199 | 3C cysteine protease (picornain 3C) {Foot-and-mout | 97.36 | |
| d1j16a_ | 223 | Trypsin(ogen) {Rat (Rattus norvegicus) [TaxId: 101 | 97.08 | |
| d2h5ca1 | 198 | alpha-Lytic protease {Lysobacter enzymogenes, 495 | 97.01 | |
| d1lo6a_ | 221 | Kallikrein 6 {Human (Homo sapiens) [TaxId: 9606]} | 96.97 | |
| d1op0a_ | 234 | Venom serine protease {Hundred-pace snake (Agkistr | 96.93 | |
| d1cqqa_ | 180 | 3C cysteine protease (picornain 3C) {Human rhinovi | 96.88 | |
| d1hj8a_ | 222 | Trypsin(ogen) {North atlantic salmon (Salmo salar) | 96.73 | |
| d1npma_ | 225 | Neuropsin {Mouse (Mus musculus) [TaxId: 10090]} | 96.64 | |
| g2pka.1 | 232 | Kallikrein A {Pig (Sus scrofa) [TaxId: 9823]} | 96.63 | |
| d1azza_ | 226 | Crab collagenase {Atlantic sand fiddler crab (Uca | 96.57 | |
| d1gdna_ | 224 | Trypsin(ogen) {Mold (Fusarium oxysporum) [TaxId: 5 | 96.5 | |
| d1bioa_ | 228 | Factor D {Human (Homo sapiens) [TaxId: 9606]} | 96.5 | |
| d1a7sa_ | 225 | Heparin binding protein, HBP {Human (Homo sapiens) | 96.42 | |
| d1si5h_ | 234 | Hepatocyte growth factor, HGF {Human (Homo sapiens | 96.37 | |
| d1orfa_ | 232 | Granzyme A {Human (Homo sapiens) [TaxId: 9606]} | 96.32 | |
| d1hj9a_ | 223 | Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]} | 96.31 | |
| d2sgaa_ | 181 | Protease A {Streptomyces griseus, strain k1 [TaxId | 96.3 | |
| d1fuja_ | 221 | Myeloblastin, PR3 {Human (Homo sapiens) [TaxId: 96 | 96.3 | |
| d1gvza_ | 237 | Prostate specific antigen (PSA kallikrein) {Horse | 96.29 | |
| d1os8a_ | 223 | Trypsin {Streptomyces griseus, strain k1 [TaxId: 1 | 96.28 | |
| d2z7fe1 | 218 | Elastase {Human (Homo sapiens) [TaxId: 9606]} | 96.26 | |
| d1ao5a_ | 237 | Kallikrein-13 {Mouse (Mus musculus) [TaxId: 10090] | 96.24 | |
| d1cqqa_ | 180 | 3C cysteine protease (picornain 3C) {Human rhinovi | 96.15 | |
| d1mzaa_ | 240 | Granzyme K {Human (Homo sapiens) [TaxId: 9606]} | 96.11 | |
| d1ekbb_ | 235 | Enteropeptidase (enterokinase light chain) {Cow (B | 96.05 | |
| d1fxya_ | 228 | Coagulation factor Xa-trypsin chimera {Synthetic, | 95.99 | |
| d1eq9a_ | 222 | (alpha,gamma)-chymotrypsin(ogen) {Red fire ant (So | 95.97 | |
| d1xx9a_ | 237 | Coagulation factor XI {Human (Homo sapiens) [TaxId | 95.82 | |
| d2f91a1 | 237 | Trypsin(ogen) {Narrow-clawed crayfish (Pontastacus | 95.76 | |
| d1rjxb_ | 247 | Plasmin(ogen), catalytic domain {Human (Homo sapie | 95.73 | |
| d1elta_ | 236 | Elastase {Salmon (Salmo salar) [TaxId: 8030]} | 95.67 | |
| d1autc_ | 240 | Activated protein c (autoprothrombin IIa) {Human ( | 95.62 | |
| g1fiw.1 | 274 | Beta-acrosin {Sheep (Ovis aries) [TaxId: 9940]} | 95.59 | |
| d1eufa_ | 224 | Duodenase {Cow (Bos taurus) [TaxId: 9913]} | 95.45 | |
| g1gg6.1 | 238 | (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus) | 95.27 | |
| d1fi8a_ | 227 | Granzyme B {Rat (Rattus norvegicus) [TaxId: 10116] | 95.2 | |
| d1fq3a_ | 227 | Granzyme B {Human (Homo sapiens) [TaxId: 9606]} | 94.95 | |
| d1tona_ | 235 | Tonin {Rat (Rattus rattus) [TaxId: 10117]} | 94.95 | |
| d1brup_ | 241 | Elastase {Pig (Sus scrofa) [TaxId: 9823]} | 94.92 | |
| d1elva1 | 259 | Complement C1S protease, catalytic domain {Human ( | 94.8 | |
| d1sgfa_ | 228 | 7S NGF protease subunits {Mouse (Mus musculus) [Ta | 94.78 | |
| d1m9ua_ | 241 | Elastase {Worm (Eisenia fetida) [TaxId: 6396]} | 94.73 | |
| d2hlca_ | 230 | HL collagenase {Common cattle grub (Hypoderma line | 94.68 | |
| d1rrka1 | 287 | Factor B {Human (Homo sapiens) [TaxId: 9606]} | 94.64 | |
| d1nn6a_ | 224 | Chymase (mast cell protease I) {Human (Homo sapien | 94.62 | |
| d2fpza1 | 243 | beta-Tryptase {Human (Homo sapiens) [TaxId: 9606]} | 94.49 | |
| d1arba_ | 263 | Achromobacter protease {Achromobacter lyticus, str | 94.48 | |
| d1t32a1 | 224 | Cathepsin G {Human (Homo sapiens) [TaxId: 9606]} | 94.18 | |
| d1z8ga1 | 255 | Hepsin, catalytic domain {Human (Homo sapiens) [Ta | 93.73 | |
| d2bz6h1 | 254 | Coagulation factor VIIa {Human (Homo sapiens) [Tax | 93.57 | |
| d1rfna_ | 235 | Coagulation factor IXa, protease domain {Human (Ho | 93.34 | |
| d1eaxa_ | 241 | Matriptase MTSP1 {Human (Homo sapiens) [TaxId: 960 | 93.32 | |
| d1hpga_ | 187 | Glutamic acid-specific protease {Streptomyces gris | 93.02 | |
| g1gj7.1 | 256 | Urokinase-type plasminogen activator (LMW U-PA), c | 92.75 | |
| d2qy0b1 | 240 | Complement C1R protease, catalytic domain {Human ( | 92.67 | |
| d1pytd_ | 251 | (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus) | 92.42 | |
| g1h8d.1 | 289 | Thrombin {Human (Homo sapiens) [TaxId: 9606]} | 92.42 | |
| d1gvkb_ | 240 | Elastase {Pig (Sus scrofa) [TaxId: 9823]} | 92.34 | |
| g1rtf.1 | 260 | Two-chain tissue plasminogen activator (TC)-T-PA { | 91.98 | |
| d1q3xa1 | 242 | Mannan-binding lectin serine protease 2 (MASP-2), | 91.9 | |
| d3rp2a_ | 224 | Chymase II (mast cell proteinase II) {Rat (Rattus | 90.94 | |
| d1fona_ | 232 | Procarboxypeptidase A-S6 subunit III (zymogen E) { | 90.68 | |
| d1gdna_ | 224 | Trypsin(ogen) {Mold (Fusarium oxysporum) [TaxId: 5 | 90.39 | |
| d2p3ub1 | 233 | Coagulation factor Xa, protease domain {Human (Hom | 88.55 | |
| g1dy9.1 | 187 | NS3 protease {Human hepatitis C virus (HCV), diffe | 83.99 | |
| d1arba_ | 263 | Achromobacter protease {Achromobacter lyticus, str | 81.3 |
| >d1ky9a2 b.47.1.1 (A:11-259) Protease Do (DegP, HtrA), catalytic domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: Trypsin-like serine proteases superfamily: Trypsin-like serine proteases family: Prokaryotic proteases domain: Protease Do (DegP, HtrA), catalytic domain species: Escherichia coli [TaxId: 562]
Probab=99.84 E-value=3.9e-21 Score=187.60 Aligned_cols=125 Identities=19% Similarity=0.308 Sum_probs=102.7
Q ss_pred ccccC-CCcceEEEEEEccC-CCCCCcccCCCCCCCCCeEEEEeCCCCCCCCCccCCceEEEEEecccCCC---CCCCce
Q 008412 207 LSLMS-KSTSRVAILGVSSY-LKDLPNIALTPLNKRGDLLLAVGSPFGVLSPMHFFNSVSMGSVANCYPPR---STTRSL 281 (566)
Q Consensus 207 ~~~l~-~~~tdlAvLki~~~-~~~~~~~~~S~~~~~Gd~V~aiGSPFG~lsP~~F~nsvS~GiISn~~~~~---~~~~~l 281 (566)
+++++ +..+|+|+||++.. ......++++..+++||+|+|||+|||+ ..++|.|+++...+.. .....+
T Consensus 115 a~~~~~d~~~dlavl~i~~~~~~~~~~l~~~~~~~~G~~v~aiG~P~g~------~~tvt~~~~~~~~~~~~~~~~~~~~ 188 (249)
T d1ky9a2 115 AKMVGKDPRSDIALIQIQNPKNLTAIKMADSDALRVGDYTVAIGNPFGL------GETVTSGIVSALGRSGLNAENYENF 188 (249)
T ss_dssp EEEEEEETTTTEEEEEESSCCSCCCCCBCCGGGCCTTCEEEEEECTTSS------SCEEEEEEEEEESSCC-----CCCC
T ss_pred ceeeEeccchhhceeeecccccceEEEcCCcCcCCcCCEEEEEeccccc------CCceeecceeecccccccCccccce
Confidence 45566 45589999999842 2233346678899999999999999995 7899999999886543 234568
Q ss_pred EEEecCCCCCCCCcceeccCCcEEEEEeeeccCCC-CcceEEEeeHHHHHHHHHhhh
Q 008412 282 LMADIRCLPGMEGGPVFGEHAHFVGILIRPLRQKS-GAEIQLVIPWEAIATACSDLL 337 (566)
Q Consensus 282 iqTDA~ilPGnsGGpVfn~~G~lIGIv~~~l~~~~-g~gl~faIP~~~i~~~~~~ll 337 (566)
|||||+++||||||||||.+|+||||+++.+...+ ..|++||||++.+++++.+++
T Consensus 189 iqtda~i~~GnSGGPl~n~~G~vIGI~t~~~~~~~~~~gi~faIP~~~~~~~~~~l~ 245 (249)
T d1ky9a2 189 IQTDAAINRGNAGGALVNLNGELIGINTAILAPDGGNIGIGFAIPSNMVKNLTSQMV 245 (249)
T ss_dssp EEESCCCTTSCCCSEEECTTSCEEEEEECSSTTSCCCSSSEEEEEHHHHHHHHHHHH
T ss_pred EEEeeeecCCCCCceEECCCCEEEEEEEEEeccCCCcccEEEEEEHHHHHHHHHHHH
Confidence 99999999999999999999999999999887664 459999999999999888764
|
| >d1l1ja_ b.47.1.1 (A:) Protease Do (DegP, HtrA), catalytic domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2qf3a1 b.47.1.1 (A:43-252) Stress sensor protease DegS, catalytic domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2z9ia2 b.47.1.1 (A:6-226) Protease PepD {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1l1ja_ b.47.1.1 (A:) Protease Do (DegP, HtrA), catalytic domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1ky9a2 b.47.1.1 (A:11-259) Protease Do (DegP, HtrA), catalytic domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1lcya2 b.47.1.1 (A:6-210) Mitochondrial serine protease HtrA2, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2z9ia2 b.47.1.1 (A:6-226) Protease PepD {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1lcya2 b.47.1.1 (A:6-210) Mitochondrial serine protease HtrA2, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2qf3a1 b.47.1.1 (A:43-252) Stress sensor protease DegS, catalytic domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1lvmb_ b.47.1.3 (B:) TEV protease (nucleat inclusion protein A, NIA) {Tobacco etch virus, TEV [TaxId: 12227]} | Back information, alignment and structure |
|---|
| >d1agja_ b.47.1.1 (A:) Epidermolytic (exfoliative) toxin A {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d2qaaa1 b.47.1.1 (A:16-242) Protease B {Streptomyces griseus, strain k1 [TaxId: 1911]} | Back information, alignment and structure |
|---|
| >d2bhga1 b.47.1.4 (A:7-205) 3C cysteine protease (picornain 3C) {Foot-and-mouth disease virus FMDV [TaxId: 12110]} | Back information, alignment and structure |
|---|
| >d1lvmb_ b.47.1.3 (B:) TEV protease (nucleat inclusion protein A, NIA) {Tobacco etch virus, TEV [TaxId: 12227]} | Back information, alignment and structure |
|---|
| >d1agja_ b.47.1.1 (A:) Epidermolytic (exfoliative) toxin A {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d2sgaa_ b.47.1.1 (A:) Protease A {Streptomyces griseus, strain k1 [TaxId: 1911]} | Back information, alignment and structure |
|---|
| >d1qtfa_ b.47.1.1 (A:) Exfoliative toxin B {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d2h5ca1 b.47.1.1 (A:15A-245) alpha-Lytic protease {Lysobacter enzymogenes, 495 [TaxId: 69]} | Back information, alignment and structure |
|---|
| >d1qtfa_ b.47.1.1 (A:) Exfoliative toxin B {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d2o8la1 b.47.1.1 (A:1-216) V8 protease {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1p3ca_ b.47.1.1 (A:) Glutamyl endopeptidase {Bacillus intermedius [TaxId: 1400]} | Back information, alignment and structure |
|---|
| >d2o8la1 b.47.1.1 (A:1-216) V8 protease {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1hpga_ b.47.1.1 (A:) Glutamic acid-specific protease {Streptomyces griseus [TaxId: 1911]} | Back information, alignment and structure |
|---|
| >d2qaaa1 b.47.1.1 (A:16-242) Protease B {Streptomyces griseus, strain k1 [TaxId: 1911]} | Back information, alignment and structure |
|---|
| >d1p3ca_ b.47.1.1 (A:) Glutamyl endopeptidase {Bacillus intermedius [TaxId: 1400]} | Back information, alignment and structure |
|---|
| >d2bhga1 b.47.1.4 (A:7-205) 3C cysteine protease (picornain 3C) {Foot-and-mouth disease virus FMDV [TaxId: 12110]} | Back information, alignment and structure |
|---|
| >d1j16a_ b.47.1.2 (A:) Trypsin(ogen) {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2h5ca1 b.47.1.1 (A:15A-245) alpha-Lytic protease {Lysobacter enzymogenes, 495 [TaxId: 69]} | Back information, alignment and structure |
|---|
| >d1lo6a_ b.47.1.2 (A:) Kallikrein 6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1op0a_ b.47.1.2 (A:) Venom serine protease {Hundred-pace snake (Agkistrodon acutus) [TaxId: 36307]} | Back information, alignment and structure |
|---|
| >d1cqqa_ b.47.1.4 (A:) 3C cysteine protease (picornain 3C) {Human rhinovirus 2 [TaxId: 12130]} | Back information, alignment and structure |
|---|
| >d1hj8a_ b.47.1.2 (A:) Trypsin(ogen) {North atlantic salmon (Salmo salar) [TaxId: 8030]} | Back information, alignment and structure |
|---|
| >d1npma_ b.47.1.2 (A:) Neuropsin {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1azza_ b.47.1.2 (A:) Crab collagenase {Atlantic sand fiddler crab (Uca pugilator) [TaxId: 6772]} | Back information, alignment and structure |
|---|
| >d1gdna_ b.47.1.2 (A:) Trypsin(ogen) {Mold (Fusarium oxysporum) [TaxId: 5507]} | Back information, alignment and structure |
|---|
| >d1bioa_ b.47.1.2 (A:) Factor D {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a7sa_ b.47.1.2 (A:) Heparin binding protein, HBP {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1si5h_ b.47.1.2 (H:) Hepatocyte growth factor, HGF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1orfa_ b.47.1.2 (A:) Granzyme A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hj9a_ b.47.1.2 (A:) Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2sgaa_ b.47.1.1 (A:) Protease A {Streptomyces griseus, strain k1 [TaxId: 1911]} | Back information, alignment and structure |
|---|
| >d1fuja_ b.47.1.2 (A:) Myeloblastin, PR3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gvza_ b.47.1.2 (A:) Prostate specific antigen (PSA kallikrein) {Horse (Equus caballus) [TaxId: 9796]} | Back information, alignment and structure |
|---|
| >d1os8a_ b.47.1.1 (A:) Trypsin {Streptomyces griseus, strain k1 [TaxId: 1911]} | Back information, alignment and structure |
|---|
| >d2z7fe1 b.47.1.2 (E:16-243) Elastase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ao5a_ b.47.1.2 (A:) Kallikrein-13 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1cqqa_ b.47.1.4 (A:) 3C cysteine protease (picornain 3C) {Human rhinovirus 2 [TaxId: 12130]} | Back information, alignment and structure |
|---|
| >d1mzaa_ b.47.1.2 (A:) Granzyme K {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ekbb_ b.47.1.2 (B:) Enteropeptidase (enterokinase light chain) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1fxya_ b.47.1.2 (A:) Coagulation factor Xa-trypsin chimera {Synthetic, based on Homo sapiens sequence} | Back information, alignment and structure |
|---|
| >d1eq9a_ b.47.1.2 (A:) (alpha,gamma)-chymotrypsin(ogen) {Red fire ant (Solenopsis invicta) [TaxId: 13686]} | Back information, alignment and structure |
|---|
| >d1xx9a_ b.47.1.2 (A:) Coagulation factor XI {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2f91a1 b.47.1.2 (A:16-244) Trypsin(ogen) {Narrow-clawed crayfish (Pontastacus leptodactylus) [TaxId: 6717]} | Back information, alignment and structure |
|---|
| >d1rjxb_ b.47.1.2 (B:) Plasmin(ogen), catalytic domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1elta_ b.47.1.2 (A:) Elastase {Salmon (Salmo salar) [TaxId: 8030]} | Back information, alignment and structure |
|---|
| >d1autc_ b.47.1.2 (C:) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1eufa_ b.47.1.2 (A:) Duodenase {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1fi8a_ b.47.1.2 (A:) Granzyme B {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1fq3a_ b.47.1.2 (A:) Granzyme B {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tona_ b.47.1.2 (A:) Tonin {Rat (Rattus rattus) [TaxId: 10117]} | Back information, alignment and structure |
|---|
| >d1brup_ b.47.1.2 (P:) Elastase {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1elva1 b.47.1.2 (A:410-668) Complement C1S protease, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sgfa_ b.47.1.2 (A:) 7S NGF protease subunits {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1m9ua_ b.47.1.2 (A:) Elastase {Worm (Eisenia fetida) [TaxId: 6396]} | Back information, alignment and structure |
|---|
| >d2hlca_ b.47.1.2 (A:) HL collagenase {Common cattle grub (Hypoderma lineatum) [TaxId: 7389]} | Back information, alignment and structure |
|---|
| >d1rrka1 b.47.1.2 (A:453-739) Factor B {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nn6a_ b.47.1.2 (A:) Chymase (mast cell protease I) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fpza1 b.47.1.2 (A:16-244) beta-Tryptase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1arba_ b.47.1.1 (A:) Achromobacter protease {Achromobacter lyticus, strain m497-1 [TaxId: 224]} | Back information, alignment and structure |
|---|
| >d1t32a1 b.47.1.2 (A:16-244) Cathepsin G {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z8ga1 b.47.1.2 (A:163-417) Hepsin, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bz6h1 b.47.1.2 (H:16-257) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rfna_ b.47.1.2 (A:) Coagulation factor IXa, protease domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1eaxa_ b.47.1.2 (A:) Matriptase MTSP1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hpga_ b.47.1.1 (A:) Glutamic acid-specific protease {Streptomyces griseus [TaxId: 1911]} | Back information, alignment and structure |
|---|
| >d2qy0b1 b.47.1.2 (B:447-686) Complement C1R protease, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pytd_ b.47.1.2 (D:) (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1gvkb_ b.47.1.2 (B:) Elastase {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1q3xa1 b.47.1.2 (A:445-686) Mannan-binding lectin serine protease 2 (MASP-2), catalytic domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3rp2a_ b.47.1.2 (A:) Chymase II (mast cell proteinase II) {Rat (Rattus rattus) [TaxId: 10117]} | Back information, alignment and structure |
|---|
| >d1fona_ b.47.1.2 (A:) Procarboxypeptidase A-S6 subunit III (zymogen E) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1gdna_ b.47.1.2 (A:) Trypsin(ogen) {Mold (Fusarium oxysporum) [TaxId: 5507]} | Back information, alignment and structure |
|---|
| >d2p3ub1 b.47.1.2 (B:16-243) Coagulation factor Xa, protease domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1arba_ b.47.1.1 (A:) Achromobacter protease {Achromobacter lyticus, strain m497-1 [TaxId: 224]} | Back information, alignment and structure |
|---|