Citrus Sinensis ID: 008468


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560----
MALLPSLRSVITHQLHHRPPPPPPLLSIASFLFHKPKLRRTTCKNLSFSFSSSSKPITLNPLATPKDNTLVFKKDERLVADNGESEEKAGTFSTIAAIVTSIGGPPGAVGIVRLSGPMAVDIVGRVFKPVKKKKKKSSGSGSWRPTSHVVEYGVVLDRHGNVVDEVLAVPMLAPRSYTREDVVELQCHGSEVCLRRVLRACLEAGATLAQPGEFTLRAFLNGRLDLSQAENVEKLISAKSVAAADAALAGIQGGFSSLVTSVRAKCIELLTEIEARLDFDDEMPPLNLNLVMDKIHAMSQDVENALETANYDKLLQSGLQIAIVGRPNVGKSSLLNAWSKSERAIVTEIAGTTRDVIEASVTVCGVPVTLLDTAGIRETDDIVEKIGVERSEAVALGADVIIMTVSAVDGWTSEDSELLNRIQSNKKSTESSTPMILVINKIDCAPSASNEWNKVGNSFNDHVFTCAVTGQGIQDLETAIMKIVGLHQIPAGGRRWAVNQRQCEQLMRTKEALVRLKSSIEEELPLDFWTIDLRDAALALGQISGEDISEEVLSNIFGKFCIGK
ccccHHHHHHHHHHHccccccccccccHHHHHcccccccccccccccccccccccccccccccccccccEEEccccccccccccccccccccccEEEEcccccccccEEEEEEcccccHHHHHHHHccccccccccccccccccccccEEEEEEEEcccccEEcEEEEEEcccccccccccEEEEcccccHHHHHHHHHHHHHcccccccccccHHHHHHcccccHHHHHHHHHHHHcccHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHccccHHHHccccEEEEccccccHHHHHHHHHcccccEEcccccccccEEEEEEEEccEEEEEECcccccccccHHHHHHHHHHHHHHHHccEEEEEEEccccccHHHHHHHHHHHcccccccccccEEEEEEccccccccccHHHHcccccccEEEEcccccccHHHHHHHHHHHHccccccccccEEEEcHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHcccccccccHHHHHHHHHcccccc
*****SLRSVITHQLHHRPPPPPPLLSIASFLFHKPKLRRTTCKNL**********************TLVF******************TFSTIAAIVTSIGGPPGAVGIVRLSGPMAVDIVGRVFKPVKK*******S*SWRPTSHVVEYGVVLDRHGNVVDEVLAVPMLAPRSYTREDVVELQCHGSEVCLRRVLRACLEAGATLAQPGEFTLRAFLNGRLDLSQAENVEKLISAKSVAAADAALAGIQGGFSSLVTSVRAKCIELLTEIEARLDFDDEMPPLNLNLVMDKIHAMSQDVENALETANYDKLLQSGLQIAIVGRPNVGKSSLLNAWSKSERAIVTEIAGTTRDVIEASVTVCGVPVTLLDTAGIRETDDIVEKIGVERSEAVALGADVIIMTVSAVDGWTSEDSELLNRIQSNKKSTESSTPMILVINKIDCAPSASNEWNKVGNSFNDHVFTCAVTGQGIQDLETAIMKIVGLHQIPAGGRRWAVNQRQCEQLMRTKEALVRLKSSIEEELPLDFWTIDLRDAALALGQISGEDISEEVLSNIFGKFCIGK
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MALLPSLRSVITHQLHHRPPPPPPLLSIASFLFHKPKLRRTTCKNLSFSFSSSSKPITLNPLATPKDNTLVFKKDERLVADNGESEEKAGTFSTIAAIVTSIGGPPGAVGIVRLSGPMAVDIVGRVFKPVKKKKKKSSGSGSWRPTSHVVEYGVVLDRHGNVVDEVLAVPMLAPRSYTREDVVELQCHGSEVCLRRVLRACLEAGATLAQPGEFTLRAFLNGRLDLSQAENVEKLISAKSVAAADAALAGIQGGFSSLVTSVRAKCIELLTEIEARLDFDDEMPPLNLNLVMDKIHAMSQDVENALETANYDKLLQSGLQIAIVGRPNVGKSSLLNAWSKSERAIVTEIAGTTRDVIEASVTVCGVPVTLLDTAGIRETDDIVEKIGVERSEAVALGADVIIMTVSAVDGWTSEDSELLNRIQSNKKSTESSTPMILVINKIDCAPSASNEWNKVGNSFNDHVFTCAVTGQGIQDLETAIMKIVGLHQIPAGGRRWAVNQRQxxxxxxxxxxxxxxxxxxxxxLPLDFWTIDLRDAALALGQISGEDISEEVLSNIFGKFCIGK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
tRNA modification GTPase MnmE Exhibits a very high intrinsic GTPase hydrolysis rate. Involved in the addition of a carboxymethylaminomethyl (cmnm) group at the wobble position (U34) of certain tRNAs, forming tRNA-cmnm(5)s(2)U34.probableB8HSJ3
tRNA modification GTPase MnmE Exhibits a very high intrinsic GTPase hydrolysis rate. Involved in the addition of a carboxymethylaminomethyl (cmnm) group at the wobble position (U34) of certain tRNAs, forming tRNA-cmnm(5)s(2)U34.probableQ5N638
tRNA modification GTPase MnmE Exhibits a very high intrinsic GTPase hydrolysis rate. Involved in the addition of a carboxymethylaminomethyl (cmnm) group at the wobble position (U34) of certain tRNAs, forming tRNA-cmnm(5)s(2)U34.probableP25811

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3GEH, chain A
Confidence level:very confident
Coverage over the Query: 103-132,143-372,393-564
View the alignment between query and template
View the model in PyMOL