BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 008482
         (564 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1KO6|A Chain A, Crystal Structure Of C-Terminal Autoproteolytic Domain Of
           Nucleoporin Nup98
 pdb|1KO6|C Chain C, Crystal Structure Of C-Terminal Autoproteolytic Domain Of
           Nucleoporin Nup98
          Length = 187

 Score = 29.3 bits (64), Expect = 6.0,   Method: Composition-based stats.
 Identities = 18/53 (33%), Positives = 26/53 (49%), Gaps = 6/53 (11%)

Query: 284 TSETSFCEEDELTDDPHEMHAEKMHVRQ-----DPVGYHRLPSEPDVGTDTND 331
           + ETSF +E  L DD  E+     H+         VGY+ +PS  D+   TN+
Sbjct: 12  SEETSFHDE-SLQDDREEIENNSYHMHPAGIILTKVGYYTIPSMDDLAKITNE 63


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.325    0.138    0.431 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 15,306,839
Number of Sequences: 62578
Number of extensions: 586452
Number of successful extensions: 1403
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 1403
Number of HSP's gapped (non-prelim): 1
length of query: 564
length of database: 14,973,337
effective HSP length: 104
effective length of query: 460
effective length of database: 8,465,225
effective search space: 3894003500
effective search space used: 3894003500
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 54 (25.4 bits)