BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 008514
         (563 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2VHA|A Chain A, Debp
 pdb|2VHA|B Chain B, Debp
          Length = 287

 Score = 28.9 bits (63), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 24/51 (47%)

Query: 36  GSISPVIKSSLNYNQKQIARLGVAKDLGDSVGFLAGSLCEVLPIWGALLVG 86
           G+ S V+ + LN  QK   R+  AKD GDS   L         +  ALL G
Sbjct: 138 GTTSEVLLNKLNEEQKMNMRIISAKDHGDSFRTLESGRAVAFMMDDALLAG 188


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.326    0.141    0.434 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 15,181,936
Number of Sequences: 62578
Number of extensions: 587223
Number of successful extensions: 1545
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 1543
Number of HSP's gapped (non-prelim): 3
length of query: 563
length of database: 14,973,337
effective HSP length: 104
effective length of query: 459
effective length of database: 8,465,225
effective search space: 3885538275
effective search space used: 3885538275
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 54 (25.4 bits)