BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 008521
         (563 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2R84|A Chain A, Crystal Structure Of Purp From Pyrococcus Furiosus
           Complexed With Amp And Aicar
 pdb|2R84|B Chain B, Crystal Structure Of Purp From Pyrococcus Furiosus
           Complexed With Amp And Aicar
 pdb|2R85|A Chain A, Crystal Structure Of Purp From Pyrococcus Furiosus
           Complexed With Amp
 pdb|2R85|B Chain B, Crystal Structure Of Purp From Pyrococcus Furiosus
           Complexed With Amp
 pdb|2R86|A Chain A, Crystal Structure Of Purp From Pyrococcus Furiosus
           Complexed With Atp
 pdb|2R86|B Chain B, Crystal Structure Of Purp From Pyrococcus Furiosus
           Complexed With Atp
 pdb|2R87|A Chain A, Crystal Structure Of Purp From Pyrococcus Furiosus
           Complexed With Adp
 pdb|2R87|B Chain B, Crystal Structure Of Purp From Pyrococcus Furiosus
           Complexed With Adp
 pdb|2R87|C Chain C, Crystal Structure Of Purp From Pyrococcus Furiosus
           Complexed With Adp
 pdb|2R87|D Chain D, Crystal Structure Of Purp From Pyrococcus Furiosus
           Complexed With Adp
 pdb|2R87|E Chain E, Crystal Structure Of Purp From Pyrococcus Furiosus
           Complexed With Adp
 pdb|2R87|F Chain F, Crystal Structure Of Purp From Pyrococcus Furiosus
           Complexed With Adp
          Length = 334

 Score = 31.2 bits (69), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 32/99 (32%), Positives = 48/99 (48%), Gaps = 16/99 (16%)

Query: 338 RREQLKEILAKQAELGVEVAEIPSYYLLDSKKQVRARVENTMPLNKRGRFQNNYDKRGRY 397
           R+E LK I  ++  LGV V   P Y+      +VR  +E  M +++R  +++N D  GR 
Sbjct: 163 RKEDLKNIQIQEYVLGVPVY--PHYFY----SKVREELE-LMSIDRR--YESNVDAIGRI 213

Query: 398 KRKDQFSKEQKLADKDSSNTSSFNKKKPTLLQKLLSADV 436
             KDQ        D D + T   N   P +L++ L  DV
Sbjct: 214 PAKDQLE-----FDMDITYTVIGN--IPIVLRESLLMDV 245


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.315    0.131    0.378 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 15,811,197
Number of Sequences: 62578
Number of extensions: 640678
Number of successful extensions: 1457
Number of sequences better than 100.0: 13
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 12
Number of HSP's that attempted gapping in prelim test: 1456
Number of HSP's gapped (non-prelim): 13
length of query: 563
length of database: 14,973,337
effective HSP length: 104
effective length of query: 459
effective length of database: 8,465,225
effective search space: 3885538275
effective search space used: 3885538275
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 54 (25.4 bits)