Query         008521
Match_columns 563
No_of_seqs    101 out of 113
Neff          2.9 
Searched_HMMs 46136
Date          Thu Mar 28 13:12:41 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/008521.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/008521hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF10453 NUFIP1:  Nuclear fragi  99.1 7.9E-11 1.7E-15   94.2   5.0   31  293-323    16-46  (56)
  2 PF00642 zf-CCCH:  Zinc finger   87.3     0.2 4.2E-06   34.7   0.2   26  381-407     2-27  (27)
  3 KOG4031 Vesicle coat protein c  59.5      29 0.00062   35.4   6.7   19  293-311   101-119 (216)
  4 smart00356 ZnF_C3H1 zinc finge  59.2     7.7 0.00017   25.5   1.9   24  381-406     3-26  (27)
  5 KOG1677 CCCH-type Zn-finger pr  50.2      10 0.00022   38.5   1.9   30  379-409   174-203 (332)
  6 KOG4264 Nucleo-cytoplasmic pro  49.8      12 0.00026   42.5   2.6   28  535-562   132-159 (694)
  7 KOG2185 Predicted RNA-processi  41.6      11 0.00024   41.6   0.8   27  381-409   139-165 (486)
  8 KOG0943 Predicted ubiquitin-pr  34.5      23 0.00049   44.2   1.9   14  548-561  1781-1794(3015)
  9 PTZ00415 transmission-blocking  34.3      23 0.00051   45.2   2.0   16  378-393    59-74  (2849)
 10 PF10446 DUF2457:  Protein of u  33.6      20 0.00044   39.8   1.2    7  446-452    37-43  (458)
 11 KOG3671 Actin regulatory prote  31.5      42 0.00091   38.1   3.2   10  439-448   494-503 (569)
 12 KOG1492 C3H1-type Zn-finger pr  29.3      24 0.00052   36.7   0.9   27  380-409   204-232 (377)
 13 PF01086 Clathrin_lg_ch:  Clath  29.1      64  0.0014   32.2   3.8   27  297-323   111-137 (225)
 14 PRK10947 global DNA-binding tr  27.6   2E+02  0.0043   27.3   6.4   22  338-359    54-75  (135)
 15 KOG2002 TPR-containing nuclear  27.3 2.1E+02  0.0046   35.0   8.0   16  544-559  1001-1016(1018)
 16 PF05178 Kri1:  KRI1-like famil  25.7   1E+02  0.0022   27.8   4.0   46  319-364     3-49  (101)
 17 KOG3241 Uncharacterized conser  23.1 1.8E+02  0.0038   29.7   5.5   36  286-321    33-73  (227)
 18 PF12728 HTH_17:  Helix-turn-he  22.7      41  0.0009   25.2   0.9   16  293-308    36-51  (51)
 19 PRK10328 DNA binding protein,   22.0 2.8E+02   0.006   26.3   6.3   23  337-359    53-75  (134)
 20 COG0620 MetE Methionine syntha  21.9 1.7E+02  0.0037   31.1   5.4   46  311-356    13-58  (330)
 21 PF10471 APC_CDC26:  Anaphase-p  20.2      23 0.00051   29.8  -1.0   23  287-309     3-25  (79)

No 1  
>PF10453 NUFIP1:  Nuclear fragile X mental retardation-interacting protein 1 (NUFIP1);  InterPro: IPR019496 Nuclear fragile X mental retardation-interacting protein 1 (Nufip1) has been implicated in the assembly of the large subunit of the ribosome [] and in telomere maintenance []. It is known to bind RNA [] and is phosphorylated upon DNA damage []. This entry represents a conserved domain found within Nufip1. Some proteins containing this region also contain a CCCH zinc finger.
Probab=99.11  E-value=7.9e-11  Score=94.23  Aligned_cols=31  Identities=61%  Similarity=0.901  Sum_probs=28.2

Q ss_pred             cccCHHHHHHHHHHHHhcCCChHHHHHHHHH
Q 008521          293 LTYTEQEVKQWCEERRKNYPTKANINKKLTE  323 (563)
Q Consensus       293 l~~t~eeI~~WreERrKNyPT~anIe~K~~e  323 (563)
                      .++|++||++|||||||||||+++|++|+++
T Consensus        16 ~L~t~eeI~~W~eERrk~~PT~~~i~~k~~~   46 (56)
T PF10453_consen   16 KLQTPEEIAKWIEERRKNYPTKANIEKKKAE   46 (56)
T ss_pred             ecCCHHHHHHHHHHHHHcCCcHHHHHHHHHH
Confidence            3479999999999999999999999998765


No 2  
>PF00642 zf-CCCH:  Zinc finger C-x8-C-x5-C-x3-H type (and similar);  InterPro: IPR000571 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents C-x8-C-x5-C-x3-H (CCCH) type Zinc finger (Znf) domains. Proteins containing CCCH Znf domains include Znf proteins from eukaryotes involved in cell cycle or growth phase-related regulation, e.g. human TIS11B (butyrate response factor 1), a probable regulatory protein involved in regulating the response to growth factors, and the mouse TTP growth factor-inducible nuclear protein, which has the same function. The mouse TTP protein is induced by growth factors. Another protein containing this domain is the human splicing factor U2AF 35kDa subunit, which plays a critical role in both constitutive and enhancer-dependent splicing by mediating essential protein-protein interactions and protein-RNA interactions required for 3' splice site selection. It has been shown that different CCCH-type Znf proteins interact with the 3'-untranslated region of various mRNA [, ]. This type of Znf is very often present in two copies. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003676 nucleic acid binding, 0008270 zinc ion binding; PDB: 1M9O_A 1RGO_A 2CQE_A 2FC6_A 2D9M_A 2E5S_A 2RHK_C 2D9N_A 3D2S_A 3D2Q_C ....
Probab=87.32  E-value=0.2  Score=34.69  Aligned_cols=26  Identities=19%  Similarity=0.188  Sum_probs=19.3

Q ss_pred             CCCCcceeccCCCCcccCCCCccchhh
Q 008521          381 LNKRGRFQNNYDKRGRYKRKDQFSKEQ  407 (563)
Q Consensus       381 ~~K~CKF~nrGg~RgRcgRKcRFsh~~  407 (563)
                      .++.|+||.+.| .|++|.+|+|+|.+
T Consensus         2 k~~~C~~f~~~g-~C~~G~~C~f~H~~   27 (27)
T PF00642_consen    2 KTKLCRFFMRTG-TCPFGDKCRFAHGE   27 (27)
T ss_dssp             TSSB-HHHHHTS---TTGGGSSSBSSG
T ss_pred             ccccChhhccCC-ccCCCCCcCccCCC
Confidence            467899999977 67899999999963


No 3  
>KOG4031 consensus Vesicle coat protein clathrin, light chain [Intracellular trafficking, secretion, and vesicular transport]
Probab=59.51  E-value=29  Score=35.41  Aligned_cols=19  Identities=26%  Similarity=0.571  Sum_probs=16.0

Q ss_pred             cccCHHHHHHHHHHHHhcC
Q 008521          293 LTYTEQEVKQWCEERRKNY  311 (563)
Q Consensus       293 l~~t~eeI~~WreERrKNy  311 (563)
                      +...||-|++|+|++++.-
T Consensus       101 ~~~epE~IRkWkeeQ~~rl  119 (216)
T KOG4031|consen  101 LRDEPEKIRKWKEEQMKRL  119 (216)
T ss_pred             cccChHHHHHHHHHHHHHH
Confidence            5678999999999998753


No 4  
>smart00356 ZnF_C3H1 zinc finger.
Probab=59.23  E-value=7.7  Score=25.50  Aligned_cols=24  Identities=13%  Similarity=0.134  Sum_probs=17.6

Q ss_pred             CCCCcceeccCCCCcccCCCCccchh
Q 008521          381 LNKRGRFQNNYDKRGRYKRKDQFSKE  406 (563)
Q Consensus       381 ~~K~CKF~nrGg~RgRcgRKcRFsh~  406 (563)
                      ....|++|.+|.  |+.|..|+|.|.
T Consensus         3 k~~~C~~~~~g~--C~~g~~C~~~H~   26 (27)
T smart00356        3 KTELCKFFKRGY--CPYGDRCKFAHP   26 (27)
T ss_pred             CCCcCcCccCCC--CCCCCCcCCCCc
Confidence            345799995554  568888999885


No 5  
>KOG1677 consensus CCCH-type Zn-finger protein [General function prediction only]
Probab=50.21  E-value=10  Score=38.51  Aligned_cols=30  Identities=10%  Similarity=-0.052  Sum_probs=24.8

Q ss_pred             CCCCCCcceeccCCCCcccCCCCccchhhhc
Q 008521          379 MPLNKRGRFQNNYDKRGRYKRKDQFSKEQKL  409 (563)
Q Consensus       379 ~~~~K~CKF~nrGg~RgRcgRKcRFsh~~k~  409 (563)
                      +-+++-|.+|.+.| .|.||.+|+|.|....
T Consensus       174 ~~kt~lC~~f~~tG-~C~yG~rC~F~H~~~~  203 (332)
T KOG1677|consen  174 KYKTKLCPKFQKTG-LCKYGSRCRFIHGEPE  203 (332)
T ss_pred             CCCCcCCCccccCC-CCCCCCcCeecCCCcc
Confidence            44889999999974 5779999999998753


No 6  
>KOG4264 consensus Nucleo-cytoplasmic protein MLN51 [General function prediction only]
Probab=49.82  E-value=12  Score=42.53  Aligned_cols=28  Identities=21%  Similarity=0.275  Sum_probs=24.1

Q ss_pred             cccceeeeccCCCccccccccccccccC
Q 008521          535 EQMKVYIAGKGNTNDEHVRLEEEEGEII  562 (563)
Q Consensus       535 ~~~~~~~~~~~~~~d~~~~~~~eegeii  562 (563)
                      -....||-+.+...+.-+++|+-||+|.
T Consensus       132 ~~np~yIpk~g~fy~hddsTe~~eg~v~  159 (694)
T KOG4264|consen  132 VENPAYIPKTGRFYMHDDSTENREGDVN  159 (694)
T ss_pred             ccCccccccccccccccccccccccccc
Confidence            3467899999999998899999999984


No 7  
>KOG2185 consensus Predicted RNA-processing protein, contains G-patch domain [RNA processing and modification]
Probab=41.55  E-value=11  Score=41.61  Aligned_cols=27  Identities=19%  Similarity=0.158  Sum_probs=21.4

Q ss_pred             CCCCcceeccCCCCcccCCCCccchhhhc
Q 008521          381 LNKRGRFQNNYDKRGRYKRKDQFSKEQKL  409 (563)
Q Consensus       381 ~~K~CKF~nrGg~RgRcgRKcRFsh~~k~  409 (563)
                      .-++|+||..+-  ||++-.|||+|-.-+
T Consensus       139 sMkpC~ffLeg~--CRF~enCRfSHG~~V  165 (486)
T KOG2185|consen  139 SMKPCKFFLEGR--CRFGENCRFSHGLDV  165 (486)
T ss_pred             hhccchHhhccc--cccCcccccccCccc
Confidence            346899998875  569999999997654


No 8  
>KOG0943 consensus Predicted ubiquitin-protein ligase/hyperplastic discs protein, HECT superfamily [Posttranslational modification, protein turnover, chaperones]
Probab=34.50  E-value=23  Score=44.17  Aligned_cols=14  Identities=57%  Similarity=0.750  Sum_probs=9.3

Q ss_pred             cccccccccccccc
Q 008521          548 NDEHVRLEEEEGEI  561 (563)
Q Consensus       548 ~d~~~~~~~eegei  561 (563)
                      +|+++.-|.-||||
T Consensus      1781 gdeheQDeqvegei 1794 (3015)
T KOG0943|consen 1781 GDEHEQDEQVEGEI 1794 (3015)
T ss_pred             cccccccccccccc
Confidence            45666666667887


No 9  
>PTZ00415 transmission-blocking target antigen s230; Provisional
Probab=34.31  E-value=23  Score=45.24  Aligned_cols=16  Identities=25%  Similarity=0.160  Sum_probs=8.3

Q ss_pred             CCCCCCCcceeccCCC
Q 008521          378 TMPLNKRGRFQNNYDK  393 (563)
Q Consensus       378 k~~~~K~CKF~nrGg~  393 (563)
                      +....++..|+..||.
T Consensus        59 ~~~~~~~~~~~~~g~~   74 (2849)
T PTZ00415         59 KEGKNKKECFDKNGGI   74 (2849)
T ss_pred             ccCCCcccccccCCCE
Confidence            3334455556655554


No 10 
>PF10446 DUF2457:  Protein of unknown function (DUF2457);  InterPro: IPR018853  This entry represents a family of uncharacterised proteins. 
Probab=33.64  E-value=20  Score=39.85  Aligned_cols=7  Identities=14%  Similarity=0.173  Sum_probs=3.3

Q ss_pred             HHHHHHH
Q 008521          446 TFRFMAI  452 (563)
Q Consensus       446 cIRFLVe  452 (563)
                      +||=|.+
T Consensus        37 ~IRkLge   43 (458)
T PF10446_consen   37 AIRKLGE   43 (458)
T ss_pred             HHhhhhH
Confidence            3555543


No 11 
>KOG3671 consensus Actin regulatory protein (Wiskott-Aldrich syndrome protein) [Signal transduction mechanisms; Cytoskeleton]
Probab=31.48  E-value=42  Score=38.13  Aligned_cols=10  Identities=20%  Similarity=0.494  Sum_probs=8.1

Q ss_pred             HHHHHHHHHH
Q 008521          439 DKSHLLQTFR  448 (563)
Q Consensus       439 Ern~LLQcIR  448 (563)
                      -|..||.-||
T Consensus       494 gR~~LmaqIR  503 (569)
T KOG3671|consen  494 GRDALMAQIR  503 (569)
T ss_pred             cHHHHHHHHH
Confidence            5677999998


No 12 
>KOG1492 consensus C3H1-type Zn-finger protein [General function prediction only]
Probab=29.26  E-value=24  Score=36.68  Aligned_cols=27  Identities=19%  Similarity=0.176  Sum_probs=20.5

Q ss_pred             CCCCCcceeccCCCCcccCCC--Cccchhhhc
Q 008521          380 PLNKRGRFQNNYDKRGRYKRK--DQFSKEQKL  409 (563)
Q Consensus       380 ~~~K~CKF~nrGg~RgRcgRK--cRFsh~~k~  409 (563)
                      +..--||||+..|-   ||++  |||+|++..
T Consensus       204 psavycryynangi---cgkgaacrfvheptr  232 (377)
T KOG1492|consen  204 PSAVYCRYYNANGI---CGKGAACRFVHEPTR  232 (377)
T ss_pred             CceeEEEEecCCCc---ccCCceeeeeccccc
Confidence            44457999998876   6666  999998753


No 13 
>PF01086 Clathrin_lg_ch:  Clathrin light chain;  InterPro: IPR000996 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment. These vesicles have specific coat proteins (such as clathrin or coatomer) that are important for cargo selection and direction of transport []. Clathrin coats contain both clathrin (acts as a scaffold) and adaptor complexes that link clathrin to receptors in coated vesicles. Clathrin-associated protein complexes are believed to interact with the cytoplasmic tails of membrane proteins, leading to their selection and concentration. The two major types of clathrin adaptor complexes are the heterotetrameric adaptor protein (AP) complexes, and the monomeric GGA (Golgi-localising, Gamma-adaptin ear domain homology, ARF-binding proteins) adaptors [, ].  Clathrin is a trimer composed of three heavy chains and three light chains, each monomer projecting outwards like a leg; this three-legged structure is known as a triskelion [, ]. The heavy chains form the legs, their N-terminal beta-propeller regions extending outwards, while their C-terminal alpha-alpha-superhelical regions form the central hub of the triskelion. Peptide motifs can bind between the beta-propeller blades. The light chains appear to have a regulatory role, and may help orient the assembly and disassembly of clathrin coats as they interact with hsc70 uncoating ATPase []. Clathrin triskelia self-polymerise into a curved lattice by twisting individual legs together. The clathrin lattice forms around a vesicle as it buds from the TGN, plasma membrane or endosomes, acting to stabilise the vesicle and facilitate the budding process []. The multiple blades created when the triskelia polymerise are involved in multiple protein interactions, enabling the recruitment of different cargo adaptors and membrane attachment proteins [].  This entry represents clathrin light chains, which are more divergent in sequence than the heavy chains []. In higher eukaryotes, two genes encode distinct but related light chains, each of which can yield two separate forms via alternative splicing. In yeast there is a single light chain whose sequence is only distantly related to that of higher eukaryotes. Clathrin light chains have a conserved acidic N-terminal domain, a central coiled-coil domain and a conserved C-terminal domain.  More information about these proteins can be found at Protein of the Month: Clathrin [].; GO: 0005198 structural molecule activity, 0006886 intracellular protein transport, 0016192 vesicle-mediated transport, 0030130 clathrin coat of trans-Golgi network vesicle, 0030132 clathrin coat of coated pit; PDB: 3LVG_E 3LVH_D.
Probab=29.08  E-value=64  Score=32.23  Aligned_cols=27  Identities=26%  Similarity=0.486  Sum_probs=19.4

Q ss_pred             HHHHHHHHHHHHhcCCChHHHHHHHHH
Q 008521          297 EQEVKQWCEERRKNYPTKANINKKLTE  323 (563)
Q Consensus       297 ~eeI~~WreERrKNyPT~anIe~K~~e  323 (563)
                      ++-|+.|||+|.+.-=-+...++++++
T Consensus       111 ~e~ireWre~~~~~i~ekD~~e~~kk~  137 (225)
T PF01086_consen  111 PEAIREWREERDKRIEEKDAEEEEKKE  137 (225)
T ss_dssp             TTHHHHHHHHHTTTSTHHHHHHHHHHH
T ss_pred             hHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            788999999999876555555554433


No 14 
>PRK10947 global DNA-binding transcriptional dual regulator H-NS; Provisional
Probab=27.64  E-value=2e+02  Score=27.32  Aligned_cols=22  Identities=18%  Similarity=0.298  Sum_probs=16.3

Q ss_pred             HHHHHHHHHHHHHhhCCccccC
Q 008521          338 RREQLKEILAKQAELGVEVAEI  359 (563)
Q Consensus       338 RRqqLKEVLAKQaELG~e~aEi  359 (563)
                      |...|.++.+.-.+.|+.+.|+
T Consensus        54 r~~kl~~~r~~m~~~Gis~~eL   75 (135)
T PRK10947         54 RTRKLQQYREMLIADGIDPNEL   75 (135)
T ss_pred             HHHHHHHHHHHHHHcCCCHHHH
Confidence            3345777777788899888876


No 15 
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism]
Probab=27.25  E-value=2.1e+02  Score=35.01  Aligned_cols=16  Identities=31%  Similarity=0.310  Sum_probs=10.0

Q ss_pred             cCCCcccccccccccc
Q 008521          544 KGNTNDEHVRLEEEEG  559 (563)
Q Consensus       544 ~~~~~d~~~~~~~eeg  559 (563)
                      +-+..++.+.++||.+
T Consensus      1001 ~~~~~k~~~~sde~~~ 1016 (1018)
T KOG2002|consen 1001 KKDRNKELNDSDEESE 1016 (1018)
T ss_pred             ccccchhhcccccccc
Confidence            4455777788875443


No 16 
>PF05178 Kri1:  KRI1-like family;  InterPro: IPR018034 The Kri1 protein is also known as KRR1-interacting protein 1. The Saccharomyces cerevisiae member of this family is found to be required for the assembly of preribosomal 40S subunits in the nucleolus []. KRR1 is highly expressed in dividing cells and its expression ceases almost completely when cells enter the stationary phase.
Probab=25.68  E-value=1e+02  Score=27.84  Aligned_cols=46  Identities=24%  Similarity=0.393  Sum_probs=27.6

Q ss_pred             HHHHHhhcCchhhhHHHHHHHHHHHHHHHH-HHhhCCccccCCcccc
Q 008521          319 KKLTEKQSNSDVIDKEAKMRREQLKEILAK-QAELGVEVAEIPSYYL  364 (563)
Q Consensus       319 ~K~~ek~sqs~~~D~EAk~RRqqLKEVLAK-QaELG~e~aEiPs~yL  364 (563)
                      +|.+++....+.+.+-...+|+++.+.|.+ +...|..-..+....|
T Consensus         3 RK~~Ek~~k~eElkrlK~lK~~Ei~~kl~kik~~~G~~~~~~~~~dl   49 (101)
T PF05178_consen    3 RKEEEKQEKEEELKRLKNLKRKEIEEKLEKIKEVAGLEDIDLDEEDL   49 (101)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhCCCccCCCHHHh
Confidence            344444444445566666777778777887 6677765445544444


No 17 
>KOG3241 consensus Uncharacterized conserved protein [Function unknown]
Probab=23.05  E-value=1.8e+02  Score=29.71  Aligned_cols=36  Identities=22%  Similarity=0.174  Sum_probs=21.0

Q ss_pred             ccccccccccCH----HHHHHHHHHHHhcCC-ChHHHHHHH
Q 008521          286 KKRKSLALTYTE----QEVKQWCEERRKNYP-TKANINKKL  321 (563)
Q Consensus       286 ~krks~~l~~t~----eeI~~WreERrKNyP-T~anIe~K~  321 (563)
                      |.|.....++++    .|.-.|+-.=.|.-| |.+.+=.|+
T Consensus        33 ~~r~na~~itgVCqRCkEqieWk~KY~KYKpLt~akkC~kC   73 (227)
T KOG3241|consen   33 GGRFNASEITGVCQRCKEQIEWKRKYGKYKPLTEAKKCQKC   73 (227)
T ss_pred             hceehhhHhhhHHHHHHHHHHHHHHhccccccchhHHHHHH
Confidence            455556666665    577788776666666 333333333


No 18 
>PF12728 HTH_17:  Helix-turn-helix domain
Probab=22.74  E-value=41  Score=25.19  Aligned_cols=16  Identities=25%  Similarity=0.677  Sum_probs=14.3

Q ss_pred             cccCHHHHHHHHHHHH
Q 008521          293 LTYTEQEVKQWCEERR  308 (563)
Q Consensus       293 l~~t~eeI~~WreERr  308 (563)
                      +.++.+||.+|+++||
T Consensus        36 ~~~~~~~l~~~~~~~~   51 (51)
T PF12728_consen   36 WRIPKSDLDRWLERRR   51 (51)
T ss_pred             EEEeHHHHHHHHHhCc
Confidence            6789999999999875


No 19 
>PRK10328 DNA binding protein, nucleoid-associated; Provisional
Probab=21.97  E-value=2.8e+02  Score=26.31  Aligned_cols=23  Identities=22%  Similarity=0.330  Sum_probs=16.0

Q ss_pred             HHHHHHHHHHHHHHhhCCccccC
Q 008521          337 MRREQLKEILAKQAELGVEVAEI  359 (563)
Q Consensus       337 ~RRqqLKEVLAKQaELG~e~aEi  359 (563)
                      .|...|.++.+.-++.|+.+.|+
T Consensus        53 er~~~l~~i~~~~~~~Git~eeL   75 (134)
T PRK10328         53 ERQEKINTWLELMKADGINPEEL   75 (134)
T ss_pred             HHHHHHHHHHHHHHHhCCCHHHH
Confidence            34445666666678899888876


No 20 
>COG0620 MetE Methionine synthase II (cobalamin-independent) [Amino acid transport and metabolism]
Probab=21.93  E-value=1.7e+02  Score=31.08  Aligned_cols=46  Identities=17%  Similarity=0.344  Sum_probs=30.1

Q ss_pred             CCChHHHHHHHHHhhcCchhhhHHHHHHHHHHHHHHHHHHhhCCcc
Q 008521          311 YPTKANINKKLTEKQSNSDVIDKEAKMRREQLKEILAKQAELGVEV  356 (563)
Q Consensus       311 yPT~anIe~K~~ek~sqs~~~D~EAk~RRqqLKEVLAKQaELG~e~  356 (563)
                      ||...-|.+..++-.+-.-..++-.+..+..+++++++|.+.|+++
T Consensus        13 fPr~~~l~~a~~~~~~G~i~~ee~~~~~~~~i~~~i~~q~~~Gldv   58 (330)
T COG0620          13 FPRPEELRKAREKWKKGEISEEEYEEILREAIRRAIKDQEEAGLDV   58 (330)
T ss_pred             CCCChhHHHHHHHHHhCCCCHHHHHHHHHHHHHHHHHHHHhcCCcE
Confidence            6666666654443322222234456677788999999999999884


No 21 
>PF10471 APC_CDC26:  Anaphase-promoting complex APC subunit 1;  InterPro: IPR018860  The anaphase-promoting complex (APC) or cyclosome is a multi-subunit E3 protein ubiquitin ligase that regulates important events in mitosis such as the initiation of anaphase and exit from telophase. The APC, in conjunction with other enzymes, assembles multi-ubiquitin chains on a variety of regulatory proteins, thereby targeting them for proteolysis by the 26S proteasome. Anaphase is initiated when the APC triggers the destruction of securin, thereby allowing the protease, separase, to disrupt sister-chromatid cohesion. Securin ubiquitination by the APC is inhibited by cyclin-dependent kinase 1 (Cdk1)-dependent phosphorylation []. Forkhead Box M1 (FoxM1), which is a transcription factor that is over-expressed in many cancers, is degraded in late mitosis and early G1 phase by the APC/cyclosome (APC/C) E3 ubiquitin ligase []. The APC/C targets mitotic cyclins for destruction in mitosis and G1 phase and is then inactivated at S phase. It thereby generates alternating states of high and low cyclin-Cdk activity, which is required for the alternation of mitosis and DNA replication []. The APC/C is composed of at least 13 subunits that stay tightly associated throughout the cell cycle: APC1, APC2, APC4, APC5, APC9, APC11, CDC16, CDC23, CDC26, CDC27, DOC1, MND2 and SWM1[], []. In fission yeast the 13 subunits are known as: Apc1, Apc2, Nuc2, Apc4, Apc5, Cut9, Apc8, Apc10, Apc11, Hcn1, Apc13, Apc14 and Apc15 []. This entry represents subunit CDC26, whose exact function is not known [].; GO: 0030071 regulation of mitotic metaphase/anaphase transition, 0031145 anaphase-promoting complex-dependent proteasomal ubiquitin-dependent protein catabolic process, 0005680 anaphase-promoting complex; PDB: 2XPI_E 3HYM_A.
Probab=20.16  E-value=23  Score=29.80  Aligned_cols=23  Identities=17%  Similarity=0.498  Sum_probs=11.1

Q ss_pred             cccccccccCHHHHHHHHHHHHh
Q 008521          287 KRKSLALTYTEQEVKQWCEERRK  309 (563)
Q Consensus       287 krks~~l~~t~eeI~~WreERrK  309 (563)
                      ||++..|.-|++||+.|.++|++
T Consensus         3 RR~pT~I~Lt~eDi~eye~~~~~   25 (79)
T PF10471_consen    3 RRKPTTIELTLEDIAEYEDRRKE   25 (79)
T ss_dssp             ----------CHHHHHHCCCHHH
T ss_pred             CCCCcEEEecHHHHHHHHHHHHH
Confidence            67888899999999999887764


Done!