Query         008523
Match_columns 563
No_of_seqs    234 out of 727
Neff          4.8 
Searched_HMMs 46136
Date          Thu Mar 28 13:14:12 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/008523.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/008523hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PLN02597 phosphoenolpyruvate c 100.0  2E-155  4E-160 1244.9  42.0  440  102-549     1-461 (555)
  2 cd00484 PEPCK_ATP Phosphoenolp 100.0  4E-151  8E-156 1212.4  38.9  405  143-549     2-424 (508)
  3 PTZ00311 phosphoenolpyruvate c 100.0  3E-150  6E-155 1211.9  40.8  416  132-549    32-472 (561)
  4 COG1866 PckA Phosphoenolpyruva 100.0  3E-149  5E-154 1169.6  31.9  414  133-549     9-441 (529)
  5 TIGR00224 pckA phosphoenolpyru 100.0  2E-147  5E-152 1181.6  38.9  410  133-549     9-444 (532)
  6 PF01293 PEPCK_ATP:  Phosphoeno 100.0  1E-138  3E-143 1115.5  34.4  408  142-551     2-427 (466)
  7 PRK09344 phosphoenolpyruvate c 100.0  3E-137  6E-142 1112.7  39.3  413  134-549     8-439 (526)
  8 cd01919 PEPCK Phosphoenolpyruv 100.0  3E-118  6E-123  966.7  38.4  406  143-551     2-433 (515)
  9 cd00819 PEPCK_GTP Phosphoenolp 100.0 2.3E-27   5E-32  257.6  26.1  376  141-533    14-479 (579)
 10 PRK04210 phosphoenolpyruvate c 100.0 3.7E-27   8E-32  256.5  26.4  401  141-554    26-520 (601)
 11 PF00821 PEPCK:  Phosphoenolpyr  99.9 6.8E-26 1.5E-30  247.2  23.2  400  141-554    12-506 (586)
 12 COG1274 PckA Phosphoenolpyruva  99.9 7.3E-21 1.6E-25  202.9  23.5  315  209-533   124-501 (608)
 13 KOG3749 Phosphoenolpyruvate ca  99.2 4.7E-11   1E-15  128.0  11.8  306  209-533   155-533 (640)
 14 cd00820 PEPCK_HprK Phosphoenol  97.7 1.1E-05 2.5E-10   72.4   0.4   49  320-368     1-52  (107)
 15 cd01918 HprK_C HprK/P, the bif  97.5 4.6E-05   1E-09   72.2   2.6   45  322-367     3-50  (149)
 16 PF07475 Hpr_kinase_C:  HPr Ser  97.1 0.00029 6.3E-09   68.3   2.7   46  321-367     6-54  (171)
 17 TIGR00679 hpr-ser Hpr(Ser) kin  96.8 0.00071 1.5E-08   71.0   2.5   71  292-365   106-180 (304)
 18 COG1493 HprK Serine kinase of   96.6  0.0016 3.4E-08   68.2   3.3   73  293-368   106-182 (308)
 19 PRK05428 HPr kinase/phosphoryl  96.3  0.0023 4.9E-08   67.4   2.8   72  292-367   106-182 (308)
 20 COG0529 CysC Adenylylsulfate k  95.2  0.0079 1.7E-07   59.2   1.2   21  332-352    21-41  (197)
 21 PRK06217 hypothetical protein;  95.0   0.014   3E-07   55.9   2.2   35  336-370     3-41  (183)
 22 PF13207 AAA_17:  AAA domain; P  94.5   0.017 3.7E-07   50.6   1.3   17  336-352     1-17  (121)
 23 COG3839 MalK ABC-type sugar tr  94.4   0.022 4.8E-07   60.8   2.3   21  332-352    27-47  (338)
 24 PF13555 AAA_29:  P-loop contai  94.3   0.023 4.9E-07   46.7   1.6   21  331-351    20-40  (62)
 25 PF01583 APS_kinase:  Adenylyls  94.0    0.02 4.4E-07   54.8   0.9   19  334-352     2-20  (156)
 26 PRK07261 topology modulation p  93.9   0.033 7.2E-07   53.2   2.1   32  336-367     2-37  (171)
 27 smart00382 AAA ATPases associa  93.8   0.027 5.9E-07   47.9   1.3   19  334-352     2-20  (148)
 28 COG4148 ModC ABC-type molybdat  93.7   0.056 1.2E-06   56.8   3.5   25  328-352    17-42  (352)
 29 COG1136 SalX ABC-type antimicr  93.6   0.033 7.2E-07   56.4   1.6   21  332-352    29-49  (226)
 30 COG1126 GlnQ ABC-type polar am  93.6   0.034 7.3E-07   56.4   1.7   21  332-352    26-46  (240)
 31 COG1117 PstB ABC-type phosphat  93.6   0.033 7.2E-07   56.5   1.5   21  332-352    31-51  (253)
 32 PF13671 AAA_33:  AAA domain; P  93.6   0.032 6.9E-07   50.1   1.3   28  336-363     1-32  (143)
 33 PRK08118 topology modulation p  93.4   0.034 7.4E-07   53.0   1.3   33  336-368     3-39  (167)
 34 COG1116 TauB ABC-type nitrate/  93.4   0.039 8.4E-07   56.6   1.6   21  332-352    27-47  (248)
 35 cd03220 ABC_KpsT_Wzt ABC_KpsT_  93.3   0.078 1.7E-06   52.4   3.5   47  303-352    19-66  (224)
 36 KOG0058 Peptide exporter, ABC   93.0    0.02 4.2E-07   66.0  -1.2   66  334-410   494-566 (716)
 37 COG1125 OpuBA ABC-type proline  93.0   0.028   6E-07   58.4   0.0   56  332-387    25-88  (309)
 38 COG4136 ABC-type uncharacteriz  93.0   0.048   1E-06   53.0   1.6   21  332-352    26-46  (213)
 39 TIGR02868 CydC thiol reductant  93.0   0.016 3.4E-07   64.1  -2.0   21  332-352   359-379 (529)
 40 COG0542 clpA ATP-binding subun  92.9    0.03 6.5E-07   65.4   0.1   82  336-419   523-634 (786)
 41 TIGR01313 therm_gnt_kin carboh  92.9   0.041 8.8E-07   51.1   0.9   27  337-363     1-31  (163)
 42 PRK09825 idnK D-gluconate kina  92.8   0.046   1E-06   52.6   1.2   20  333-352     2-21  (176)
 43 PRK00300 gmk guanylate kinase;  92.8   0.053 1.1E-06   52.2   1.5   21  332-352     3-23  (205)
 44 KOG0055 Multidrug/pheromone ex  92.8   0.038 8.3E-07   67.0   0.7   19  333-351  1015-1033(1228)
 45 COG4175 ProV ABC-type proline/  92.8   0.049 1.1E-06   58.0   1.4   21  332-352    52-72  (386)
 46 COG4181 Predicted ABC-type tra  92.7   0.041 8.9E-07   54.4   0.7   41  332-372    34-83  (228)
 47 TIGR00235 udk uridine kinase.   92.7   0.046 9.9E-07   53.3   1.0   21  332-352     4-24  (207)
 48 COG3840 ThiQ ABC-type thiamine  92.6   0.072 1.6E-06   53.2   2.2   32  320-352    12-43  (231)
 49 PRK05541 adenylylsulfate kinas  92.5   0.059 1.3E-06   50.9   1.5   21  332-352     5-25  (176)
 50 TIGR03263 guanyl_kin guanylate  92.5   0.054 1.2E-06   50.9   1.2   19  334-352     1-19  (180)
 51 COG0396 sufC Cysteine desulfur  92.5    0.11 2.3E-06   53.3   3.3   21  332-352    28-48  (251)
 52 PRK08233 hypothetical protein;  92.4   0.059 1.3E-06   50.3   1.4   19  334-352     3-21  (182)
 53 cd00227 CPT Chloramphenicol (C  92.3    0.06 1.3E-06   51.0   1.3   19  334-352     2-20  (175)
 54 PRK11174 cysteine/glutathione   92.2   0.023   5E-07   63.6  -1.9   21  332-352   374-394 (588)
 55 COG3842 PotA ABC-type spermidi  92.2   0.067 1.5E-06   57.5   1.6   21  332-352    29-49  (352)
 56 TIGR02322 phosphon_PhnN phosph  92.1   0.064 1.4E-06   50.5   1.2   19  334-352     1-19  (179)
 57 PRK00131 aroK shikimate kinase  91.9    0.08 1.7E-06   48.8   1.5   20  333-352     3-22  (175)
 58 PRK00889 adenylylsulfate kinas  91.8   0.075 1.6E-06   50.1   1.3   21  332-352     2-22  (175)
 59 PF13238 AAA_18:  AAA domain; P  91.8   0.073 1.6E-06   46.3   1.1   16  337-352     1-16  (129)
 60 cd03238 ABC_UvrA The excision   91.7    0.09 1.9E-06   50.9   1.7   21  332-352    19-39  (176)
 61 COG4525 TauB ABC-type taurine   91.7     0.1 2.2E-06   52.7   2.0   21  332-352    29-49  (259)
 62 KOG0635 Adenosine 5'-phosphosu  91.7   0.086 1.9E-06   51.1   1.5   23  331-353    28-50  (207)
 63 COG1118 CysA ABC-type sulfate/  91.4    0.13 2.7E-06   54.8   2.5   36  332-367    26-68  (345)
 64 PRK10078 ribose 1,5-bisphospho  91.4   0.093   2E-06   50.3   1.4   19  334-352     2-20  (186)
 65 PF00005 ABC_tran:  ABC transpo  91.3    0.11 2.3E-06   46.6   1.6   21  332-352     9-29  (137)
 66 TIGR03797 NHPM_micro_ABC2 NHPM  91.3   0.035 7.6E-07   63.5  -1.9   21  332-352   477-497 (686)
 67 PRK05480 uridine/cytidine kina  91.2   0.096 2.1E-06   50.9   1.4   21  332-352     4-24  (209)
 68 cd03270 ABC_UvrA_I The excisio  91.2    0.11 2.3E-06   51.8   1.7   20  332-351    19-38  (226)
 69 cd03225 ABC_cobalt_CbiO_domain  91.2    0.11 2.3E-06   50.4   1.6   21  332-352    25-45  (211)
 70 PF03193 DUF258:  Protein of un  91.1    0.11 2.5E-06   50.0   1.7   19  334-352    35-53  (161)
 71 cd03255 ABC_MJ0796_Lo1CDE_FtsE  91.0    0.12 2.5E-06   50.4   1.7   21  332-352    28-48  (218)
 72 COG4619 ABC-type uncharacteriz  91.0     0.1 2.2E-06   51.5   1.3   21  332-352    27-47  (223)
 73 TIGR03375 type_I_sec_LssB type  91.0   0.041   9E-07   63.1  -1.7   21  332-352   489-509 (694)
 74 TIGR01166 cbiO cobalt transpor  91.0    0.12 2.5E-06   49.4   1.7   21  332-352    16-36  (190)
 75 PRK06762 hypothetical protein;  90.9   0.098 2.1E-06   48.7   1.0   18  335-352     3-20  (166)
 76 TIGR00960 3a0501s02 Type II (G  90.9    0.12 2.6E-06   50.3   1.7   21  332-352    27-47  (216)
 77 TIGR02673 FtsE cell division A  90.9    0.12 2.6E-06   50.1   1.6   21  332-352    26-46  (214)
 78 COG1124 DppF ABC-type dipeptid  90.8    0.11 2.4E-06   53.4   1.3   21  332-352    31-51  (252)
 79 TIGR02315 ABC_phnC phosphonate  90.8    0.12 2.7E-06   51.0   1.7   21  332-352    26-46  (243)
 80 cd03262 ABC_HisP_GlnQ_permease  90.7    0.13 2.8E-06   49.8   1.7   21  332-352    24-44  (213)
 81 TIGR00958 3a01208 Conjugate Tr  90.7   0.036 7.8E-07   64.0  -2.5   21  332-352   505-525 (711)
 82 TIGR03796 NHPM_micro_ABC1 NHPM  90.7   0.043 9.4E-07   63.0  -1.9   21  332-352   503-523 (710)
 83 cd03269 ABC_putative_ATPase Th  90.7    0.13 2.8E-06   49.9   1.6   21  332-352    24-44  (210)
 84 COG4988 CydD ABC-type transpor  90.6   0.062 1.4E-06   60.7  -0.6   72  332-408   345-417 (559)
 85 cd03260 ABC_PstB_phosphate_tra  90.6    0.13 2.8E-06   50.4   1.7   21  332-352    24-44  (227)
 86 cd03265 ABC_DrrA DrrA is the A  90.6    0.13 2.8E-06   50.2   1.7   21  332-352    24-44  (220)
 87 cd03292 ABC_FtsE_transporter F  90.6    0.13 2.8E-06   49.8   1.6   21  332-352    25-45  (214)
 88 cd00009 AAA The AAA+ (ATPases   90.6    0.13 2.8E-06   44.4   1.5   20  333-352    18-37  (151)
 89 cd02019 NK Nucleoside/nucleoti  90.5   0.095 2.1E-06   42.8   0.5   17  336-352     1-17  (69)
 90 cd03226 ABC_cobalt_CbiO_domain  90.5    0.13 2.9E-06   49.6   1.6   21  332-352    24-44  (205)
 91 cd03219 ABC_Mj1267_LivG_branch  90.5    0.13 2.9E-06   50.6   1.6   21  332-352    24-44  (236)
 92 cd03257 ABC_NikE_OppD_transpor  90.4    0.14   3E-06   50.0   1.6   21  332-352    29-49  (228)
 93 PRK03846 adenylylsulfate kinas  90.4    0.13 2.8E-06   49.9   1.4   21  332-352    22-42  (198)
 94 PF00004 AAA:  ATPase family as  90.4    0.11 2.3E-06   45.4   0.8   16  337-352     1-16  (132)
 95 cd03261 ABC_Org_Solvent_Resist  90.3    0.14 3.1E-06   50.5   1.7   21  332-352    24-44  (235)
 96 cd03259 ABC_Carb_Solutes_like   90.3    0.14 3.1E-06   49.7   1.6   21  332-352    24-44  (213)
 97 cd03235 ABC_Metallic_Cations A  90.3    0.14 3.1E-06   49.6   1.6   21  332-352    23-43  (213)
 98 KOG4238 Bifunctional ATP sulfu  90.3    0.11 2.4E-06   56.0   0.9   35  333-367    49-83  (627)
 99 cd03263 ABC_subfamily_A The AB  90.2    0.15 3.2E-06   49.7   1.6   21  332-352    26-46  (220)
100 TIGR02204 MsbA_rel ABC transpo  90.2   0.041 8.9E-07   61.3  -2.5   21  332-352   364-384 (576)
101 COG3638 ABC-type phosphate/pho  90.2    0.18 3.8E-06   51.9   2.2   37  332-368    28-71  (258)
102 COG0563 Adk Adenylate kinase a  90.1    0.12 2.6E-06   50.3   0.9   17  336-352     2-18  (178)
103 cd03224 ABC_TM1139_LivF_branch  90.1    0.14 3.1E-06   49.8   1.5   21  332-352    24-44  (222)
104 cd03216 ABC_Carb_Monos_I This   90.1    0.15 3.3E-06   48.0   1.6   21  332-352    24-44  (163)
105 TIGR02880 cbbX_cfxQ probable R  90.1    0.14   3E-06   53.0   1.4   48  303-352    29-76  (284)
106 TIGR01193 bacteriocin_ABC ABC-  90.1   0.044 9.5E-07   63.0  -2.5   21  332-352   498-518 (708)
107 cd03256 ABC_PhnC_transporter A  90.0    0.16 3.4E-06   50.2   1.7   21  332-352    25-45  (241)
108 PRK14527 adenylate kinase; Pro  90.0    0.15 3.2E-06   49.0   1.5   20  333-352     5-24  (191)
109 cd03293 ABC_NrtD_SsuB_transpor  90.0    0.15 3.2E-06   49.9   1.5   21  332-352    28-48  (220)
110 cd03258 ABC_MetN_methionine_tr  90.0    0.16 3.4E-06   50.0   1.7   21  332-352    29-49  (233)
111 TIGR03410 urea_trans_UrtE urea  90.0    0.16 3.4E-06   49.9   1.7   21  332-352    24-44  (230)
112 TIGR03608 L_ocin_972_ABC putat  90.0    0.15 3.3E-06   49.0   1.5   21  332-352    22-42  (206)
113 cd03268 ABC_BcrA_bacitracin_re  89.9    0.16 3.4E-06   49.1   1.6   21  332-352    24-44  (208)
114 TIGR02857 CydD thiol reductant  89.9   0.059 1.3E-06   59.6  -1.5   21  332-352   346-366 (529)
115 PRK11124 artP arginine transpo  89.9    0.16 3.5E-06   50.4   1.6   21  332-352    26-46  (242)
116 cd03264 ABC_drug_resistance_li  89.9    0.16 3.4E-06   49.3   1.5   19  333-352    25-43  (211)
117 TIGR02211 LolD_lipo_ex lipopro  89.9    0.16 3.5E-06   49.4   1.7   21  332-352    29-49  (221)
118 cd03266 ABC_NatA_sodium_export  89.9    0.17 3.6E-06   49.3   1.7   21  332-352    29-49  (218)
119 PRK10790 putative multidrug tr  89.8   0.051 1.1E-06   61.0  -2.2   21  332-352   365-385 (592)
120 COG1132 MdlB ABC-type multidru  89.8   0.051 1.1E-06   60.7  -2.2   21  332-352   353-373 (567)
121 TIGR01978 sufC FeS assembly AT  89.8    0.17 3.7E-06   50.0   1.7   21  332-352    24-44  (243)
122 TIGR01360 aden_kin_iso1 adenyl  89.7    0.16 3.4E-06   47.7   1.3   19  334-352     3-21  (188)
123 PF13479 AAA_24:  AAA domain     89.7    0.19   4E-06   49.6   1.9   33  333-365     2-34  (213)
124 cd03214 ABC_Iron-Siderophores_  89.7    0.18 3.8E-06   48.1   1.7   21  332-352    23-43  (180)
125 cd03246 ABCC_Protease_Secretio  89.7    0.18 3.8E-06   47.7   1.7   21  332-352    26-46  (173)
126 PRK10070 glycine betaine trans  89.7    0.14   3E-06   55.8   1.1   21  332-352    52-72  (400)
127 TIGR02881 spore_V_K stage V sp  89.7    0.17 3.7E-06   51.3   1.6   43  303-352    13-60  (261)
128 COG1341 Predicted GTPase or GT  89.7    0.24 5.2E-06   54.0   2.9   17  336-352    75-91  (398)
129 PF00485 PRK:  Phosphoribulokin  89.6    0.16 3.4E-06   49.1   1.3   17  336-352     1-17  (194)
130 PF05496 RuvB_N:  Holliday junc  89.6    0.14 3.1E-06   52.1   1.0   18  335-352    51-68  (233)
131 cd03230 ABC_DR_subfamily_A Thi  89.6    0.18 3.8E-06   47.8   1.6   21  332-352    24-44  (173)
132 TIGR00150 HI0065_YjeE ATPase,   89.5    0.18 3.9E-06   47.2   1.5   21  332-352    20-40  (133)
133 PRK10908 cell division protein  89.5    0.18   4E-06   49.3   1.7   21  332-352    26-46  (222)
134 cd03301 ABC_MalK_N The N-termi  89.5    0.18   4E-06   48.8   1.7   21  332-352    24-44  (213)
135 TIGR03265 PhnT2 putative 2-ami  89.5    0.18 3.8E-06   53.9   1.6   21  332-352    28-48  (353)
136 PRK13540 cytochrome c biogenes  89.4    0.19 4.1E-06   48.6   1.7   21  332-352    25-45  (200)
137 cd03229 ABC_Class3 This class   89.4    0.19 4.1E-06   47.8   1.7   21  332-352    24-44  (178)
138 cd03218 ABC_YhbG The ABC trans  89.4    0.18 3.9E-06   49.5   1.6   21  332-352    24-44  (232)
139 PRK11629 lolD lipoprotein tran  89.3    0.19 4.1E-06   49.7   1.6   21  332-352    33-53  (233)
140 cd03222 ABC_RNaseL_inhibitor T  89.3    0.18 3.9E-06   48.8   1.5   21  332-352    23-43  (177)
141 cd03254 ABCC_Glucan_exporter_l  89.2     0.2 4.2E-06   49.2   1.7   21  332-352    27-47  (229)
142 PRK13539 cytochrome c biogenes  89.2     0.2 4.3E-06   48.8   1.7   21  332-352    26-46  (207)
143 PRK15177 Vi polysaccharide exp  89.2     0.2 4.3E-06   49.3   1.6   21  332-352    11-31  (213)
144 PRK10584 putative ABC transpor  89.1     0.2 4.3E-06   49.2   1.7   21  332-352    34-54  (228)
145 cd03295 ABC_OpuCA_Osmoprotecti  89.1     0.2 4.4E-06   49.7   1.7   21  332-352    25-45  (242)
146 TIGR03864 PQQ_ABC_ATP ABC tran  89.1     0.2 4.4E-06   49.6   1.7   21  332-352    25-45  (236)
147 PRK10895 lipopolysaccharide AB  89.1     0.2 4.3E-06   49.7   1.6   21  332-352    27-47  (241)
148 COG0194 Gmk Guanylate kinase [  89.1    0.18 3.9E-06   50.0   1.3   20  333-352     3-22  (191)
149 cd03223 ABCD_peroxisomal_ALDP   89.1    0.21 4.5E-06   47.2   1.7   21  332-352    25-45  (166)
150 PRK13538 cytochrome c biogenes  89.1     0.2 4.4E-06   48.5   1.6   21  332-352    25-45  (204)
151 cd02027 APSK Adenosine 5'-phos  89.0    0.14 3.1E-06   47.7   0.5   17  336-352     1-17  (149)
152 TIGR01359 UMP_CMP_kin_fam UMP-  89.0    0.14 3.1E-06   48.2   0.5   17  336-352     1-17  (183)
153 TIGR02323 CP_lyasePhnK phospho  89.0    0.19 4.2E-06   50.1   1.5   21  332-352    27-47  (253)
154 cd03296 ABC_CysA_sulfate_impor  89.0    0.21 4.5E-06   49.6   1.7   21  332-352    26-46  (239)
155 PRK14267 phosphate ABC transpo  89.0    0.21 4.5E-06   49.9   1.7   21  332-352    28-48  (253)
156 cd03247 ABCC_cytochrome_bd The  88.9    0.22 4.7E-06   47.3   1.7   21  332-352    26-46  (178)
157 PRK14247 phosphate ABC transpo  88.9    0.21 4.5E-06   49.8   1.7   21  332-352    27-47  (250)
158 TIGR00972 3a0107s01c2 phosphat  88.9    0.21 4.6E-06   49.8   1.7   21  332-352    25-45  (247)
159 cd02024 NRK1 Nicotinamide ribo  88.9    0.23 4.9E-06   48.8   1.8   16  337-352     2-17  (187)
160 cd03221 ABCF_EF-3 ABCF_EF-3  E  88.9    0.22 4.8E-06   46.0   1.7   21  332-352    24-44  (144)
161 PRK11248 tauB taurine transpor  88.8    0.21 4.6E-06   50.4   1.7   21  332-352    25-45  (255)
162 PRK14738 gmk guanylate kinase;  88.8    0.21 4.5E-06   49.0   1.5   20  333-352    12-31  (206)
163 cd03215 ABC_Carb_Monos_II This  88.8    0.22 4.7E-06   47.5   1.6   21  332-352    24-44  (182)
164 cd03245 ABCC_bacteriocin_expor  88.8    0.22 4.8E-06   48.5   1.7   21  332-352    28-48  (220)
165 PRK09452 potA putrescine/sperm  88.8     0.2 4.4E-06   54.0   1.6   21  332-352    38-58  (375)
166 PRK10744 pstB phosphate transp  88.8    0.21 4.7E-06   50.2   1.6   21  332-352    37-57  (260)
167 PRK11432 fbpC ferric transport  88.7    0.21 4.6E-06   53.3   1.6   21  332-352    30-50  (351)
168 TIGR03771 anch_rpt_ABC anchore  88.7    0.22 4.8E-06   49.1   1.6   21  332-352     4-24  (223)
169 PRK14241 phosphate transporter  88.7    0.22 4.7E-06   50.1   1.6   21  332-352    28-48  (258)
170 cd02023 UMPK Uridine monophosp  88.7    0.16 3.4E-06   48.9   0.5   16  337-352     2-17  (198)
171 PRK06547 hypothetical protein;  88.6    0.19 4.1E-06   48.5   1.0   18  335-352    16-33  (172)
172 PRK11264 putative amino-acid A  88.6    0.23 4.9E-06   49.4   1.7   21  332-352    27-47  (250)
173 PRK14255 phosphate ABC transpo  88.5    0.23   5E-06   49.6   1.7   21  332-352    29-49  (252)
174 PRK13543 cytochrome c biogenes  88.5    0.24 5.1E-06   48.5   1.7   21  332-352    35-55  (214)
175 cd02021 GntK Gluconate kinase   88.5    0.18 3.9E-06   46.0   0.8   16  337-352     2-17  (150)
176 TIGR03005 ectoine_ehuA ectoine  88.5    0.23   5E-06   49.6   1.7   21  332-352    24-44  (252)
177 PRK14242 phosphate transporter  88.5    0.23 4.9E-06   49.6   1.6   21  332-352    30-50  (253)
178 PRK11650 ugpC glycerol-3-phosp  88.5    0.22 4.8E-06   53.2   1.6   21  332-352    28-48  (356)
179 PRK11247 ssuB aliphatic sulfon  88.5    0.23   5E-06   50.5   1.6   21  332-352    36-56  (257)
180 cd03231 ABC_CcmA_heme_exporter  88.4    0.24 5.1E-06   48.0   1.6   21  332-352    24-44  (201)
181 cd03298 ABC_ThiQ_thiamine_tran  88.4    0.24 5.2E-06   48.0   1.7   21  332-352    22-42  (211)
182 TIGR01189 ccmA heme ABC export  88.4    0.24 5.2E-06   47.7   1.6   21  332-352    24-44  (198)
183 TIGR03415 ABC_choXWV_ATP choli  88.4    0.19 4.2E-06   54.4   1.1   21  332-352    48-68  (382)
184 PRK13648 cbiO cobalt transport  88.4    0.24 5.2E-06   50.2   1.7   21  332-352    33-53  (269)
185 TIGR02237 recomb_radB DNA repa  88.4    0.23 4.9E-06   48.0   1.4   21  332-352    10-30  (209)
186 PRK10247 putative ABC transpor  88.3    0.24 5.3E-06   48.8   1.7   21  332-352    31-51  (225)
187 TIGR01184 ntrCD nitrate transp  88.3    0.24 5.2E-06   49.0   1.6   21  332-352     9-29  (230)
188 PRK14273 phosphate ABC transpo  88.3    0.24 5.2E-06   49.5   1.6   21  332-352    31-51  (254)
189 PRK10771 thiQ thiamine transpo  88.3    0.25 5.4E-06   48.8   1.7   21  332-352    23-43  (232)
190 PRK14274 phosphate ABC transpo  88.3    0.24 5.3E-06   49.7   1.6   21  332-352    36-56  (259)
191 PF13191 AAA_16:  AAA ATPase do  88.2    0.18 3.9E-06   46.8   0.6   21  332-352    22-42  (185)
192 PRK09493 glnQ glutamine ABC tr  88.2    0.25 5.4E-06   48.9   1.7   21  332-352    25-45  (240)
193 PRK11607 potG putrescine trans  88.2    0.24 5.2E-06   53.5   1.6   21  332-352    43-63  (377)
194 cd03249 ABC_MTABC3_MDL1_MDL2 M  88.2    0.26 5.7E-06   48.6   1.8   21  332-352    27-47  (238)
195 cd03252 ABCC_Hemolysin The ABC  88.2    0.25 5.5E-06   48.7   1.7   21  332-352    26-46  (237)
196 CHL00131 ycf16 sulfate ABC tra  88.2    0.25 5.4E-06   49.2   1.6   21  332-352    31-51  (252)
197 TIGR03740 galliderm_ABC gallid  88.2    0.25 5.5E-06   48.3   1.6   21  332-352    24-44  (223)
198 PRK14239 phosphate transporter  88.1    0.25 5.4E-06   49.2   1.6   21  332-352    29-49  (252)
199 TIGR02770 nickel_nikD nickel i  88.1    0.25 5.5E-06   48.7   1.7   21  332-352    10-30  (230)
200 PTZ00301 uridine kinase; Provi  88.1     0.2 4.4E-06   49.9   1.0   18  335-352     4-21  (210)
201 PRK10575 iron-hydroxamate tran  88.1    0.25 5.5E-06   49.9   1.7   21  332-352    35-55  (265)
202 PRK09183 transposase/IS protei  88.1    0.22 4.9E-06   50.9   1.3   20  333-352   101-120 (259)
203 TIGR03411 urea_trans_UrtD urea  88.1    0.26 5.5E-06   48.8   1.6   21  332-352    26-46  (242)
204 cd03237 ABC_RNaseL_inhibitor_d  88.0    0.26 5.6E-06   49.8   1.7   21  332-352    23-43  (246)
205 TIGR02324 CP_lyasePhnL phospho  88.0    0.26 5.7E-06   48.2   1.7   21  332-352    32-52  (224)
206 PRK00698 tmk thymidylate kinas  88.0    0.22 4.8E-06   47.5   1.1   19  334-352     3-21  (205)
207 PRK11300 livG leucine/isoleuci  88.0    0.25 5.4E-06   49.3   1.5   21  332-352    29-49  (255)
208 cd03250 ABCC_MRP_domain1 Domai  88.0    0.27 5.9E-06   47.4   1.7   21  332-352    29-49  (204)
209 PRK14250 phosphate ABC transpo  88.0    0.27 5.7E-06   49.0   1.7   21  332-352    27-47  (241)
210 TIGR03238 dnd_assoc_3 dnd syst  88.0    0.25 5.5E-06   55.3   1.7   21  332-352    30-50  (504)
211 PRK14248 phosphate ABC transpo  88.0    0.26 5.7E-06   49.9   1.6   21  332-352    45-65  (268)
212 PRK13649 cbiO cobalt transport  87.9    0.26 5.6E-06   50.2   1.6   21  332-352    31-51  (280)
213 cd03232 ABC_PDR_domain2 The pl  87.9    0.26 5.6E-06   47.5   1.5   21  332-352    31-51  (192)
214 PF13401 AAA_22:  AAA domain; P  87.9    0.24 5.1E-06   43.6   1.2   20  333-352     3-22  (131)
215 PRK13645 cbiO cobalt transport  87.9    0.25 5.5E-06   50.6   1.5   21  332-352    35-55  (289)
216 PRK11144 modC molybdate transp  87.9    0.26 5.7E-06   52.4   1.7   21  332-352    22-42  (352)
217 cd00464 SK Shikimate kinase (S  87.9    0.19 4.2E-06   45.6   0.6   17  336-352     1-17  (154)
218 PRK11831 putative ABC transpor  87.9    0.27 5.8E-06   50.0   1.7   21  332-352    31-51  (269)
219 PRK14262 phosphate ABC transpo  87.9    0.27 5.8E-06   49.0   1.6   21  332-352    27-47  (250)
220 PRK10851 sulfate/thiosulfate t  87.9    0.26 5.7E-06   52.6   1.6   21  332-352    26-46  (353)
221 PRK14240 phosphate transporter  87.8    0.27   6E-06   48.9   1.7   21  332-352    27-47  (250)
222 PF00910 RNA_helicase:  RNA hel  87.7    0.18 3.9E-06   44.4   0.3   16  337-352     1-16  (107)
223 cd03369 ABCC_NFT1 Domain 2 of   87.7    0.29 6.2E-06   47.4   1.7   21  332-352    32-52  (207)
224 PRK03839 putative kinase; Prov  87.7    0.21 4.6E-06   47.2   0.8   17  336-352     2-18  (180)
225 PRK15056 manganese/iron transp  87.7    0.28   6E-06   49.9   1.7   21  332-352    31-51  (272)
226 PRK11000 maltose/maltodextrin   87.7    0.27 5.8E-06   52.8   1.6   21  332-352    27-47  (369)
227 PRK13548 hmuV hemin importer A  87.6    0.28   6E-06   49.5   1.6   21  332-352    26-46  (258)
228 cd03244 ABCC_MRP_domain2 Domai  87.6    0.29 6.3E-06   47.7   1.7   21  332-352    28-48  (221)
229 PF05673 DUF815:  Protein of un  87.6    0.16 3.5E-06   52.3  -0.1  131  335-474    53-199 (249)
230 cd01120 RecA-like_NTPases RecA  87.6    0.22 4.7E-06   44.5   0.7   16  337-352     2-17  (165)
231 CHL00181 cbbX CbbX; Provisiona  87.6    0.28 6.1E-06   51.0   1.7   48  303-352    30-77  (287)
232 PF00448 SRP54:  SRP54-type pro  87.5    0.23 4.9E-06   48.9   0.9   18  335-352     2-19  (196)
233 PRK14259 phosphate ABC transpo  87.5    0.29 6.2E-06   49.8   1.6   21  332-352    37-57  (269)
234 PRK11701 phnK phosphonate C-P   87.5    0.28 6.1E-06   49.3   1.6   21  332-352    30-50  (258)
235 PRK14256 phosphate ABC transpo  87.5    0.29 6.3E-06   48.9   1.6   21  332-352    28-48  (252)
236 PRK15093 antimicrobial peptide  87.5    0.29 6.2E-06   51.6   1.7   21  332-352    31-51  (330)
237 PRK14530 adenylate kinase; Pro  87.5    0.26 5.6E-06   48.3   1.2   19  334-352     3-21  (215)
238 TIGR01277 thiQ thiamine ABC tr  87.4    0.28 6.1E-06   47.8   1.5   21  332-352    22-42  (213)
239 cd03228 ABCC_MRP_Like The MRP   87.4    0.31 6.7E-06   46.0   1.7   21  332-352    26-46  (171)
240 PRK13638 cbiO cobalt transport  87.4    0.29 6.3E-06   49.7   1.6   21  332-352    25-45  (271)
241 PRK06696 uridine kinase; Valid  87.4    0.25 5.3E-06   48.9   1.0   18  335-352    23-40  (223)
242 TIGR01186 proV glycine betaine  87.4    0.28   6E-06   52.8   1.5   21  332-352    17-37  (363)
243 PRK14261 phosphate ABC transpo  87.4     0.3 6.5E-06   48.9   1.7   21  332-352    30-50  (253)
244 PRK13547 hmuV hemin importer A  87.4     0.3 6.4E-06   50.1   1.7   21  332-352    25-45  (272)
245 cd03233 ABC_PDR_domain1 The pl  87.3     0.3 6.5E-06   47.5   1.6   21  332-352    31-51  (202)
246 cd03248 ABCC_TAP TAP, the Tran  87.3    0.31 6.7E-06   47.8   1.7   21  332-352    38-58  (226)
247 cd03251 ABCC_MsbA MsbA is an e  87.3    0.31 6.7E-06   47.9   1.7   21  332-352    26-46  (234)
248 TIGR02769 nickel_nikE nickel i  87.3     0.3 6.5E-06   49.4   1.7   21  332-352    35-55  (265)
249 PRK15112 antimicrobial peptide  87.3     0.3 6.5E-06   49.5   1.6   21  332-352    37-57  (267)
250 PRK13632 cbiO cobalt transport  87.3     0.3 6.6E-06   49.6   1.7   21  332-352    33-53  (271)
251 PRK10619 histidine/lysine/argi  87.3     0.3 6.6E-06   49.0   1.7   21  332-352    29-49  (257)
252 cd03267 ABC_NatA_like Similar   87.3     0.3 6.6E-06   48.5   1.6   21  332-352    45-65  (236)
253 TIGR00455 apsK adenylylsulfate  87.2    0.26 5.7E-06   46.9   1.1   21  332-352    16-36  (184)
254 PRK13541 cytochrome c biogenes  87.2    0.31 6.7E-06   46.9   1.6   21  332-352    24-44  (195)
255 PRK09984 phosphonate/organopho  87.2    0.31 6.6E-06   49.1   1.6   21  332-352    28-48  (262)
256 cd03234 ABCG_White The White s  87.2     0.3 6.5E-06   48.0   1.5   21  332-352    31-51  (226)
257 TIGR03499 FlhF flagellar biosy  87.2    0.26 5.7E-06   50.9   1.2   21  332-352   192-212 (282)
258 cd03290 ABCC_SUR1_N The SUR do  87.2    0.32 6.9E-06   47.5   1.7   21  332-352    25-45  (218)
259 PF01926 MMR_HSR1:  50S ribosom  87.1    0.29 6.3E-06   42.7   1.3   16  337-352     2-17  (116)
260 cd04164 trmE TrmE (MnmE, ThdF,  87.1    0.31 6.7E-06   43.3   1.4   19  334-352     1-19  (157)
261 PRK09544 znuC high-affinity zi  87.1    0.32 6.9E-06   49.2   1.7   21  332-352    28-48  (251)
262 TIGR03258 PhnT 2-aminoethylpho  87.1    0.31 6.8E-06   52.3   1.7   21  332-352    29-49  (362)
263 PRK14253 phosphate ABC transpo  87.0    0.32   7E-06   48.4   1.7   21  332-352    27-47  (249)
264 PRK14270 phosphate ABC transpo  87.0    0.32   7E-06   48.6   1.7   21  332-352    28-48  (251)
265 PRK14238 phosphate transporter  87.0    0.32 6.9E-06   49.5   1.7   21  332-352    48-68  (271)
266 PRK14245 phosphate ABC transpo  87.0    0.31 6.8E-06   48.6   1.6   21  332-352    27-47  (250)
267 cd00267 ABC_ATPase ABC (ATP-bi  87.0    0.33 7.2E-06   44.9   1.6   21  332-352    23-43  (157)
268 PRK11614 livF leucine/isoleuci  87.0    0.31 6.8E-06   48.1   1.5   21  332-352    29-49  (237)
269 PRK14237 phosphate transporter  87.0    0.32   7E-06   49.3   1.7   21  332-352    44-64  (267)
270 PRK10418 nikD nickel transport  87.0    0.33 7.1E-06   48.8   1.7   21  332-352    27-47  (254)
271 cd03294 ABC_Pro_Gly_Bertaine T  87.0    0.32   7E-06   49.4   1.7   21  332-352    48-68  (269)
272 PRK11545 gntK gluconate kinase  87.0    0.16 3.6E-06   48.0  -0.4   13  340-352     1-13  (163)
273 cd00071 GMPK Guanosine monopho  86.9    0.25 5.5E-06   45.5   0.8   16  337-352     2-17  (137)
274 PRK10253 iron-enterobactin tra  86.9    0.33 7.1E-06   49.1   1.7   21  332-352    31-51  (265)
275 TIGR02142 modC_ABC molybdenum   86.9    0.32   7E-06   51.7   1.7   21  332-352    21-41  (354)
276 PF07724 AAA_2:  AAA domain (Cd  86.9    0.27 5.9E-06   47.3   1.0   17  336-352     5-21  (171)
277 PRK14531 adenylate kinase; Pro  86.9    0.26 5.5E-06   47.2   0.8   17  336-352     4-20  (183)
278 PF07728 AAA_5:  AAA domain (dy  86.9    0.28 6.1E-06   44.2   1.1   16  337-352     2-17  (139)
279 PRK13647 cbiO cobalt transport  86.9    0.32   7E-06   49.6   1.6   21  332-352    29-49  (274)
280 TIGR00968 3a0106s01 sulfate AB  86.8    0.34 7.3E-06   48.2   1.7   21  332-352    24-44  (237)
281 PRK14272 phosphate ABC transpo  86.8    0.34 7.3E-06   48.3   1.7   21  332-352    28-48  (252)
282 PRK11231 fecE iron-dicitrate t  86.8    0.34 7.3E-06   48.6   1.6   21  332-352    26-46  (255)
283 PRK09580 sufC cysteine desulfu  86.8    0.34 7.3E-06   48.1   1.6   21  332-352    25-45  (248)
284 PRK10419 nikE nickel transport  86.7    0.34 7.4E-06   49.2   1.7   21  332-352    36-56  (268)
285 PRK14244 phosphate ABC transpo  86.7    0.34 7.5E-06   48.4   1.7   21  332-352    29-49  (251)
286 TIGR01188 drrA daunorubicin re  86.7    0.34 7.3E-06   50.2   1.7   21  332-352    17-37  (302)
287 PRK14268 phosphate ABC transpo  86.7    0.34 7.4E-06   48.7   1.7   21  332-352    36-56  (258)
288 PRK14249 phosphate ABC transpo  86.7    0.35 7.5E-06   48.3   1.7   21  332-352    28-48  (251)
289 PRK14235 phosphate transporter  86.7    0.34 7.5E-06   49.1   1.7   21  332-352    43-63  (267)
290 cd03300 ABC_PotA_N PotA is an   86.7    0.35 7.6E-06   47.8   1.7   21  332-352    24-44  (232)
291 PRK14251 phosphate ABC transpo  86.6    0.35 7.6E-06   48.2   1.7   21  332-352    28-48  (251)
292 COG1127 Ttg2A ABC-type transpo  86.6    0.43 9.4E-06   49.2   2.3   21  332-352    32-52  (263)
293 PRK14269 phosphate ABC transpo  86.6    0.35 7.7E-06   48.2   1.7   21  332-352    26-46  (246)
294 cd03213 ABCG_EPDR ABCG transpo  86.5    0.36 7.8E-06   46.7   1.6   21  332-352    33-53  (194)
295 PRK11022 dppD dipeptide transp  86.5    0.34 7.3E-06   51.1   1.6   21  332-352    31-51  (326)
296 TIGR02639 ClpA ATP-dependent C  86.5     0.6 1.3E-05   54.5   3.7   17  336-352   486-502 (731)
297 PRK08533 flagellar accessory p  86.5    0.35 7.5E-06   48.5   1.6   21  332-352    22-42  (230)
298 PRK14243 phosphate transporter  86.4    0.36 7.8E-06   48.9   1.7   21  332-352    34-54  (264)
299 cd03253 ABCC_ATM1_transporter   86.4    0.37   8E-06   47.5   1.7   21  332-352    25-45  (236)
300 TIGR01288 nodI ATP-binding ABC  86.4    0.36 7.8E-06   50.0   1.6   21  332-352    28-48  (303)
301 cd03217 ABC_FeS_Assembly ABC-t  86.3    0.38 8.2E-06   46.6   1.7   21  332-352    24-44  (200)
302 PRK14722 flhF flagellar biosyn  86.2    0.32   7E-06   52.7   1.3   21  332-352   135-155 (374)
303 PRK11153 metN DL-methionine tr  86.2    0.36 7.8E-06   51.2   1.6   21  332-352    29-49  (343)
304 PRK13646 cbiO cobalt transport  86.2    0.37 7.9E-06   49.6   1.6   21  332-352    31-51  (286)
305 PF10662 PduV-EutP:  Ethanolami  86.2    0.32 6.9E-06   46.2   1.1   18  335-352     2-19  (143)
306 PRK14260 phosphate ABC transpo  86.2    0.38 8.2E-06   48.5   1.6   21  332-352    31-51  (259)
307 PRK13634 cbiO cobalt transport  86.1    0.37   8E-06   49.7   1.6   21  332-352    31-51  (290)
308 PRK14266 phosphate ABC transpo  86.1    0.39 8.4E-06   47.9   1.7   21  332-352    27-47  (250)
309 smart00072 GuKc Guanylate kina  86.1    0.36 7.7E-06   46.3   1.4   19  334-352     2-20  (184)
310 PRK14252 phosphate ABC transpo  86.1    0.39 8.3E-06   48.6   1.7   21  332-352    40-60  (265)
311 cd02028 UMPK_like Uridine mono  86.1    0.28   6E-06   47.3   0.6   17  336-352     1-17  (179)
312 PRK11308 dppF dipeptide transp  86.1    0.38 8.2E-06   50.8   1.7   21  332-352    39-59  (327)
313 PRK13651 cobalt transporter AT  86.0    0.37   8E-06   50.3   1.5   21  332-352    31-51  (305)
314 PRK09473 oppD oligopeptide tra  86.0    0.35 7.7E-06   51.1   1.4   21  332-352    40-60  (330)
315 TIGR03873 F420-0_ABC_ATP propo  86.0    0.39 8.4E-06   48.2   1.6   21  332-352    25-45  (256)
316 PRK14265 phosphate ABC transpo  86.0    0.39 8.5E-06   49.0   1.7   21  332-352    44-64  (274)
317 PRK14275 phosphate ABC transpo  86.0    0.39 8.5E-06   49.4   1.6   21  332-352    63-83  (286)
318 cd01394 radB RadB. The archaea  85.9    0.36 7.9E-06   47.0   1.3   21  332-352    17-37  (218)
319 COG4618 ArpD ABC-type protease  85.9    0.24 5.2E-06   55.6   0.1   68  332-410   360-435 (580)
320 cd01876 YihA_EngB The YihA (En  85.9    0.33 7.3E-06   43.2   1.0   16  337-352     2-17  (170)
321 TIGR02314 ABC_MetN D-methionin  85.9    0.38 8.3E-06   51.3   1.6   21  332-352    29-49  (343)
322 PRK03695 vitamin B12-transport  85.8    0.41 8.8E-06   48.1   1.7   21  332-352    20-40  (248)
323 COG4161 ArtP ABC-type arginine  85.8    0.43 9.4E-06   47.0   1.8   21  332-352    26-46  (242)
324 PRK13635 cbiO cobalt transport  85.8     0.4 8.7E-06   49.2   1.6   21  332-352    31-51  (279)
325 COG4608 AppF ABC-type oligopep  85.8    0.43 9.4E-06   49.6   1.8   21  332-352    37-57  (268)
326 cd01130 VirB11-like_ATPase Typ  85.8    0.39 8.5E-06   46.1   1.5   21  332-352    23-43  (186)
327 PRK15079 oligopeptide ABC tran  85.7     0.4 8.6E-06   50.8   1.6   21  332-352    45-65  (331)
328 PRK14236 phosphate transporter  85.7    0.41 8.9E-06   48.7   1.6   21  332-352    49-69  (272)
329 TIGR02982 heterocyst_DevA ABC   85.7    0.42 9.1E-06   46.8   1.7   21  332-352    29-49  (220)
330 COG4555 NatA ABC-type Na+ tran  85.7    0.36 7.8E-06   48.9   1.2   21  332-352    26-46  (245)
331 cd03271 ABC_UvrA_II The excisi  85.7    0.42 9.1E-06   49.3   1.7   21  332-352    19-39  (261)
332 PRK14271 phosphate ABC transpo  85.6    0.42   9E-06   49.0   1.7   21  332-352    45-65  (276)
333 PRK13650 cbiO cobalt transport  85.6     0.4 8.8E-06   49.1   1.6   21  332-352    31-51  (279)
334 cd03283 ABC_MutS-like MutS-lik  85.6    0.43 9.4E-06   46.8   1.7   19  334-352    25-43  (199)
335 PRK14254 phosphate ABC transpo  85.6    0.42 9.1E-06   49.2   1.7   21  332-352    63-83  (285)
336 cd03236 ABC_RNaseL_inhibitor_d  85.6    0.43 9.2E-06   48.6   1.7   22  331-352    23-44  (255)
337 PRK13975 thymidylate kinase; P  85.6    0.36 7.9E-06   46.0   1.1   19  334-352     2-20  (196)
338 cd02020 CMPK Cytidine monophos  85.4    0.31 6.7E-06   43.7   0.6   17  336-352     1-17  (147)
339 PRK14737 gmk guanylate kinase;  85.4    0.39 8.5E-06   46.7   1.3   20  333-352     3-22  (186)
340 PRK13640 cbiO cobalt transport  85.4    0.43 9.3E-06   48.9   1.6   21  332-352    31-51  (282)
341 PRK05057 aroK shikimate kinase  85.2    0.39 8.4E-06   45.9   1.1   18  335-352     5-22  (172)
342 COG0444 DppD ABC-type dipeptid  85.2    0.71 1.5E-05   49.1   3.2   41  332-372    29-75  (316)
343 PRK13639 cbiO cobalt transport  85.2    0.44 9.6E-06   48.6   1.6   21  332-352    26-46  (275)
344 TIGR03420 DnaA_homol_Hda DnaA   85.2    0.43 9.4E-06   46.3   1.5   20  333-352    37-56  (226)
345 PF01695 IstB_IS21:  IstB-like   85.1    0.42 9.2E-06   46.2   1.4   20  333-352    46-65  (178)
346 PRK13633 cobalt transporter AT  85.1    0.45 9.8E-06   48.7   1.6   21  332-352    34-54  (280)
347 PRK13641 cbiO cobalt transport  85.1    0.44 9.6E-06   49.0   1.5   21  332-352    31-51  (287)
348 PRK13637 cbiO cobalt transport  85.0    0.45 9.7E-06   49.0   1.6   21  332-352    31-51  (287)
349 PRK13652 cbiO cobalt transport  85.0    0.46 9.9E-06   48.5   1.6   21  332-352    28-48  (277)
350 TIGR01618 phage_P_loop phage n  85.0    0.46 9.9E-06   48.0   1.6   25  334-358    12-37  (220)
351 COG1120 FepC ABC-type cobalami  85.0    0.46   1E-05   49.2   1.6   21  332-352    26-46  (258)
352 TIGR03345 VI_ClpV1 type VI sec  85.0    0.33 7.3E-06   57.7   0.7   17  336-352   598-614 (852)
353 PRK13631 cbiO cobalt transport  85.0    0.46 9.9E-06   50.0   1.6   21  332-352    50-70  (320)
354 PRK02496 adk adenylate kinase;  85.0    0.37 7.9E-06   45.8   0.8   17  336-352     3-19  (184)
355 TIGR03878 thermo_KaiC_2 KaiC d  85.0    0.41 8.8E-06   48.8   1.2   21  332-352    34-54  (259)
356 COG2274 SunT ABC-type bacterio  84.9    0.43 9.3E-06   55.8   1.5   21  332-352   497-517 (709)
357 PRK14532 adenylate kinase; Pro  84.9    0.37   8E-06   45.9   0.8   17  336-352     2-18  (188)
358 PRK11176 lipid transporter ATP  84.9    0.46 9.9E-06   53.2   1.7   21  332-352   367-387 (582)
359 PRK09361 radB DNA repair and r  84.8    0.42 9.1E-06   46.9   1.2   21  332-352    21-41  (225)
360 PF08477 Miro:  Miro-like prote  84.8    0.42 9.2E-06   41.3   1.1   16  337-352     2-17  (119)
361 PRK13644 cbiO cobalt transport  84.8    0.47   1E-05   48.5   1.6   21  332-352    26-46  (274)
362 cd03299 ABC_ModC_like Archeal   84.8    0.49 1.1E-05   47.0   1.6   21  332-352    23-43  (235)
363 PRK13642 cbiO cobalt transport  84.7    0.48   1E-05   48.4   1.6   21  332-352    31-51  (277)
364 PF13476 AAA_23:  AAA domain; P  84.7    0.48   1E-05   44.2   1.5   18  335-352    20-37  (202)
365 cd03279 ABC_sbcCD SbcCD and ot  84.7    0.48   1E-05   46.5   1.5   20  333-352    27-46  (213)
366 PRK08356 hypothetical protein;  84.7    0.46 9.9E-06   46.0   1.4   20  333-352     4-23  (195)
367 cd01428 ADK Adenylate kinase (  84.6    0.39 8.4E-06   45.4   0.8   16  337-352     2-17  (194)
368 PRK14258 phosphate ABC transpo  84.6     0.5 1.1E-05   47.7   1.6   21  332-352    31-51  (261)
369 cd01393 recA_like RecA is a  b  84.5     0.5 1.1E-05   46.0   1.6   21  332-352    17-37  (226)
370 cd04159 Arl10_like Arl10-like   84.5    0.44 9.5E-06   42.1   1.1   16  337-352     2-17  (159)
371 cd03288 ABCC_SUR2 The SUR doma  84.4    0.52 1.1E-05   47.5   1.7   21  332-352    45-65  (257)
372 cd01672 TMPK Thymidine monopho  84.4    0.41 8.8E-06   44.9   0.8   17  336-352     2-18  (200)
373 PRK13636 cbiO cobalt transport  84.4    0.51 1.1E-05   48.4   1.6   21  332-352    30-50  (283)
374 PRK06893 DNA replication initi  84.3    0.38 8.2E-06   48.0   0.6   18  335-352    40-57  (229)
375 PRK13546 teichoic acids export  84.3    0.52 1.1E-05   48.2   1.7   21  332-352    48-68  (264)
376 PRK13643 cbiO cobalt transport  84.3     0.5 1.1E-05   48.7   1.5   21  332-352    30-50  (288)
377 PRK08084 DNA replication initi  84.3    0.46   1E-05   47.6   1.2   18  335-352    46-63  (235)
378 PRK12339 2-phosphoglycerate ki  84.2    0.48   1E-05   46.7   1.3   19  334-352     3-21  (197)
379 cd04155 Arl3 Arl3 subfamily.    84.2    0.48   1E-05   43.5   1.3   19  334-352    14-32  (173)
380 cd02025 PanK Pantothenate kina  84.2    0.39 8.5E-06   47.9   0.7   16  337-352     2-17  (220)
381 PRK12726 flagellar biosynthesi  84.2    0.73 1.6E-05   50.5   2.7   31  321-352   194-224 (407)
382 TIGR00635 ruvB Holliday juncti  84.2    0.44 9.4E-06   48.8   1.0   18  335-352    31-48  (305)
383 PHA02530 pseT polynucleotide k  84.1    0.43 9.3E-06   48.7   1.0   18  335-352     3-20  (300)
384 PRK14246 phosphate ABC transpo  84.1    0.54 1.2E-05   47.6   1.6   21  332-352    34-54  (257)
385 PHA00729 NTP-binding motif con  84.0    0.42 9.2E-06   48.5   0.8   17  336-352    19-35  (226)
386 PRK04040 adenylate kinase; Pro  84.0    0.48   1E-05   46.2   1.2   18  335-352     3-20  (188)
387 cd03297 ABC_ModC_molybdenum_tr  83.9    0.49 1.1E-05   46.1   1.2   18  335-352    24-41  (214)
388 TIGR00041 DTMP_kinase thymidyl  83.9    0.48   1E-05   45.1   1.1   19  334-352     3-21  (195)
389 COG1131 CcmA ABC-type multidru  83.7    0.55 1.2E-05   48.9   1.5   21  332-352    29-49  (293)
390 PRK13657 cyclic beta-1,2-gluca  83.6    0.56 1.2E-05   52.8   1.7   21  332-352   359-379 (588)
391 TIGR03269 met_CoM_red_A2 methy  83.6    0.56 1.2E-05   52.1   1.7   21  332-352    24-44  (520)
392 cd01123 Rad51_DMC1_radA Rad51_  83.6    0.54 1.2E-05   46.1   1.4   21  332-352    17-37  (235)
393 cd03278 ABC_SMC_barmotin Barmo  83.6    0.54 1.2E-05   46.0   1.4   19  333-352    22-40  (197)
394 PF05729 NACHT:  NACHT domain    83.5     0.5 1.1E-05   42.7   1.0   18  335-352     1-18  (166)
395 PRK01184 hypothetical protein;  83.5    0.49 1.1E-05   44.9   1.0   17  336-352     3-19  (184)
396 cd03272 ABC_SMC3_euk Eukaryoti  83.5    0.55 1.2E-05   46.4   1.4   19  333-351    22-40  (243)
397 PRK14263 phosphate ABC transpo  83.4    0.59 1.3E-05   47.4   1.6   21  332-352    32-52  (261)
398 PRK10938 putative molybdenum t  83.4    0.57 1.2E-05   51.5   1.6   21  332-352    27-47  (490)
399 PRK10751 molybdopterin-guanine  83.4     0.5 1.1E-05   46.0   1.0   18  335-352     7-24  (173)
400 PRK10762 D-ribose transporter   83.3    0.56 1.2E-05   51.9   1.5   21  332-352    28-48  (501)
401 PRK10522 multidrug transporter  83.3    0.58 1.3E-05   52.3   1.6   21  332-352   347-367 (547)
402 PRK06620 hypothetical protein;  83.3    0.48   1E-05   47.1   0.9   18  335-352    45-62  (214)
403 PRK06526 transposase; Provisio  83.2    0.53 1.2E-05   48.2   1.2   20  333-352    97-116 (254)
404 PRK14264 phosphate ABC transpo  83.2    0.61 1.3E-05   48.5   1.7   21  332-352    69-89  (305)
405 PRK05537 bifunctional sulfate   83.2    0.54 1.2E-05   53.6   1.3   22  331-352   389-410 (568)
406 COG2255 RuvB Holliday junction  83.1    0.48   1E-05   50.1   0.8   18  335-352    53-70  (332)
407 cd01128 rho_factor Transcripti  83.0    0.56 1.2E-05   48.0   1.3   20  333-352    15-34  (249)
408 PRK13947 shikimate kinase; Pro  83.0    0.55 1.2E-05   43.7   1.1   28  336-363     3-34  (171)
409 PRK09700 D-allose transporter   82.9    0.61 1.3E-05   51.7   1.6   21  332-352    29-49  (510)
410 cd03240 ABC_Rad50 The catalyti  82.9    0.71 1.5E-05   45.3   1.9   17  336-352    24-40  (204)
411 KOG0057 Mitochondrial Fe/S clu  82.9    0.38 8.2E-06   54.4  -0.0   66  332-408   376-447 (591)
412 COG1123 ATPase components of v  82.9    0.59 1.3E-05   53.0   1.5   21  332-352   315-335 (539)
413 cd04160 Arfrp1 Arfrp1 subfamil  82.8    0.57 1.2E-05   42.7   1.1   16  337-352     2-17  (167)
414 PRK13537 nodulation ABC transp  82.8    0.63 1.4E-05   48.6   1.5   21  332-352    31-51  (306)
415 TIGR00231 small_GTP small GTP-  82.8     0.6 1.3E-05   40.5   1.2   17  336-352     3-19  (161)
416 PRK12288 GTPase RsgA; Reviewed  82.8       2 4.3E-05   46.1   5.3   19  334-352   205-223 (347)
417 PRK09700 D-allose transporter   82.8    0.62 1.3E-05   51.6   1.6   21  332-352   287-307 (510)
418 TIGR01351 adk adenylate kinase  82.8    0.51 1.1E-05   46.1   0.8   16  337-352     2-17  (210)
419 cd01131 PilT Pilus retraction   82.7    0.54 1.2E-05   45.9   1.0   17  336-352     3-19  (198)
420 PF09439 SRPRB:  Signal recogni  82.6    0.62 1.3E-05   45.8   1.3   19  334-352     3-21  (181)
421 TIGR03269 met_CoM_red_A2 methy  82.6    0.65 1.4E-05   51.6   1.7   21  332-352   308-328 (520)
422 TIGR03522 GldA_ABC_ATP gliding  82.5    0.63 1.4E-05   48.3   1.4   21  332-352    26-46  (301)
423 PF00025 Arf:  ADP-ribosylation  82.5    0.67 1.5E-05   44.0   1.5   19  334-352    14-32  (175)
424 PRK08903 DnaA regulatory inact  82.5    0.61 1.3E-05   45.8   1.3   19  334-352    42-60  (227)
425 PRK15134 microcin C ABC transp  82.4    0.63 1.4E-05   51.8   1.5   21  332-352    33-53  (529)
426 PRK10982 galactose/methyl gala  82.4    0.65 1.4E-05   51.2   1.6   21  332-352    22-42  (491)
427 cd03291 ABCC_CFTR1 The CFTR su  82.4    0.69 1.5E-05   47.9   1.7   21  332-352    61-81  (282)
428 PRK10938 putative molybdenum t  82.3    0.67 1.4E-05   51.0   1.6   21  332-352   284-304 (490)
429 cd03289 ABCC_CFTR2 The CFTR su  82.3     0.7 1.5E-05   47.7   1.7   21  332-352    28-48  (275)
430 PRK15134 microcin C ABC transp  82.3    0.67 1.4E-05   51.6   1.6   21  332-352   310-330 (529)
431 TIGR02633 xylG D-xylose ABC tr  82.3    0.65 1.4E-05   51.2   1.5   21  332-352    25-45  (500)
432 PF13173 AAA_14:  AAA domain     82.2    0.73 1.6E-05   41.5   1.6   20  333-352     1-20  (128)
433 PRK03731 aroL shikimate kinase  82.2    0.61 1.3E-05   43.6   1.1   31  335-365     3-37  (171)
434 PF13481 AAA_25:  AAA domain; P  82.2    0.72 1.6E-05   43.6   1.6   21  332-352    30-50  (193)
435 PRK09270 nucleoside triphospha  82.2    0.59 1.3E-05   46.4   1.0   19  334-352    33-51  (229)
436 CHL00095 clpC Clp protease ATP  82.2     1.7 3.7E-05   51.5   5.0   17  336-352   541-557 (821)
437 COG0572 Udk Uridine kinase [Nu  82.1    0.72 1.6E-05   46.7   1.6   18  335-352     9-26  (218)
438 PRK07667 uridine kinase; Provi  82.1     0.6 1.3E-05   45.3   1.0   18  335-352    18-35  (193)
439 PRK06995 flhF flagellar biosyn  82.0     0.6 1.3E-05   52.3   1.2   20  333-352   255-274 (484)
440 PRK14490 putative bifunctional  82.0    0.68 1.5E-05   49.6   1.5   20  333-352     4-23  (369)
441 cd04156 ARLTS1 ARLTS1 subfamil  82.0    0.62 1.3E-05   42.1   1.0   16  337-352     2-17  (160)
442 TIGR03881 KaiC_arch_4 KaiC dom  81.8     0.7 1.5E-05   45.4   1.4   21  332-352    18-38  (229)
443 COG1122 CbiO ABC-type cobalt t  81.8    0.76 1.6E-05   46.8   1.7   21  332-352    28-48  (235)
444 PRK13549 xylose transporter AT  81.8     0.7 1.5E-05   51.2   1.6   21  332-352   286-306 (506)
445 TIGR02203 MsbA_lipidA lipid A   81.8    0.72 1.6E-05   51.4   1.7   21  332-352   356-376 (571)
446 PRK04182 cytidylate kinase; Pr  81.8    0.63 1.4E-05   43.2   1.0   17  336-352     2-18  (180)
447 PRK13549 xylose transporter AT  81.8    0.66 1.4E-05   51.4   1.3   21  332-352    29-49  (506)
448 cd04163 Era Era subfamily.  Er  81.7    0.69 1.5E-05   40.9   1.2   18  335-352     4-21  (168)
449 PRK05703 flhF flagellar biosyn  81.7    0.66 1.4E-05   51.0   1.3   42  304-352   198-239 (424)
450 cd00876 Ras Ras family.  The R  81.7    0.63 1.4E-05   41.5   1.0   16  337-352     2-17  (160)
451 PF06745 KaiC:  KaiC;  InterPro  81.7    0.72 1.6E-05   45.3   1.4   21  332-352    17-37  (226)
452 PRK09087 hypothetical protein;  81.7    0.62 1.4E-05   46.7   1.0   19  334-352    44-62  (226)
453 cd04123 Rab21 Rab21 subfamily.  81.5    0.71 1.5E-05   41.3   1.2   17  336-352     2-18  (162)
454 PRK11160 cysteine/glutathione   81.4    0.76 1.6E-05   51.8   1.7   21  332-352   364-384 (574)
455 COG1100 GTPase SAR1 and relate  81.4    0.65 1.4E-05   44.6   1.0   18  335-352     6-23  (219)
456 TIGR01194 cyc_pep_trnsptr cycl  81.4    0.75 1.6E-05   51.7   1.6   21  332-352   366-386 (555)
457 PRK14257 phosphate ABC transpo  81.4    0.79 1.7E-05   48.5   1.7   21  332-352   106-126 (329)
458 PF13086 AAA_11:  AAA domain; P  81.4    0.59 1.3E-05   44.4   0.7   17  336-352    19-35  (236)
459 PRK15064 ABC transporter ATP-b  81.3    0.78 1.7E-05   51.1   1.7   21  332-352    25-45  (530)
460 COG4778 PhnL ABC-type phosphon  81.3    0.84 1.8E-05   45.4   1.7   21  332-352    35-55  (235)
461 PRK14528 adenylate kinase; Pro  81.3    0.69 1.5E-05   44.7   1.1   17  336-352     3-19  (186)
462 PRK15453 phosphoribulokinase;   81.2    0.66 1.4E-05   48.8   1.0   19  334-352     5-23  (290)
463 PRK10762 D-ribose transporter   81.2    0.76 1.6E-05   50.9   1.5   21  332-352   276-296 (501)
464 TIGR01842 type_I_sec_PrtD type  81.2    0.78 1.7E-05   51.2   1.7   21  332-352   342-362 (544)
465 PRK15439 autoinducer 2 ABC tra  81.1    0.78 1.7E-05   51.0   1.6   21  332-352    35-55  (510)
466 PF00625 Guanylate_kin:  Guanyl  81.1     0.8 1.7E-05   43.7   1.5   19  334-352     2-20  (183)
467 PF03205 MobB:  Molybdopterin g  81.1    0.77 1.7E-05   42.8   1.3   17  336-352     2-18  (140)
468 TIGR03574 selen_PSTK L-seryl-t  81.0    0.64 1.4E-05   46.6   0.8   16  337-352     2-17  (249)
469 cd04138 H_N_K_Ras_like H-Ras/N  81.0    0.69 1.5E-05   41.4   1.0   17  336-352     3-19  (162)
470 TIGR02236 recomb_radA DNA repa  81.0    0.67 1.4E-05   48.1   1.0   21  332-352    93-113 (310)
471 PRK13536 nodulation factor exp  80.9    0.82 1.8E-05   48.7   1.6   21  332-352    65-85  (340)
472 PRK13946 shikimate kinase; Pro  80.9    0.74 1.6E-05   44.2   1.2   18  335-352    11-28  (184)
473 COG0467 RAD55 RecA-superfamily  80.9    0.77 1.7E-05   46.3   1.4   21  332-352    21-41  (260)
474 PRK15064 ABC transporter ATP-b  80.9    0.82 1.8E-05   51.0   1.7   21  332-352   343-363 (530)
475 cd01124 KaiC KaiC is a circadi  80.8    0.64 1.4E-05   43.6   0.7   16  337-352     2-17  (187)
476 PRK10416 signal recognition pa  80.6    0.73 1.6E-05   48.8   1.1   21  332-352   112-132 (318)
477 PRK10789 putative multidrug tr  80.6    0.84 1.8E-05   51.4   1.7   21  332-352   339-359 (569)
478 PRK10982 galactose/methyl gala  80.5    0.81 1.8E-05   50.4   1.5   21  332-352   272-292 (491)
479 PRK00080 ruvB Holliday junctio  80.5    0.67 1.4E-05   48.5   0.8   18  335-352    52-69  (328)
480 KOG3354 Gluconate kinase [Carb  80.5       1 2.2E-05   44.1   1.9   35  331-365     9-48  (191)
481 TIGR03015 pepcterm_ATPase puta  80.4    0.85 1.8E-05   45.5   1.5   39  300-352    23-61  (269)
482 smart00175 RAB Rab subfamily o  80.4    0.75 1.6E-05   41.4   1.0   17  336-352     2-18  (164)
483 TIGR02012 tigrfam_recA protein  80.2     0.8 1.7E-05   48.8   1.3   21  332-352    53-73  (321)
484 TIGR02173 cyt_kin_arch cytidyl  80.2    0.77 1.7E-05   42.4   1.0   17  336-352     2-18  (171)
485 PRK11288 araG L-arabinose tran  80.2    0.84 1.8E-05   50.5   1.5   21  332-352   277-297 (501)
486 TIGR02633 xylG D-xylose ABC tr  80.1    0.84 1.8E-05   50.4   1.4   21  332-352   284-304 (500)
487 PF13521 AAA_28:  AAA domain; P  80.1    0.61 1.3E-05   43.4   0.3   27  510-536   133-159 (163)
488 TIGR00554 panK_bact pantothena  80.1    0.75 1.6E-05   48.2   1.0   18  335-352    63-80  (290)
489 PRK10261 glutathione transport  80.1    0.87 1.9E-05   52.1   1.6   21  332-352    40-60  (623)
490 cd04161 Arl2l1_Arl13_like Arl2  80.0    0.71 1.5E-05   43.0   0.7   17  336-352     1-17  (167)
491 TIGR01192 chvA glucan exporter  80.0     0.9 1.9E-05   51.4   1.7   21  332-352   359-379 (585)
492 PF02367 UPF0079:  Uncharacteri  80.0     0.9 1.9E-05   42.0   1.4   21  332-352    13-33  (123)
493 PRK11147 ABC transporter ATPas  80.0    0.91   2E-05   52.0   1.7   21  332-352    27-47  (635)
494 cd01673 dNK Deoxyribonucleosid  80.0    0.73 1.6E-05   43.9   0.8   16  337-352     2-17  (193)
495 cd03243 ABC_MutS_homologs The   80.0    0.96 2.1E-05   43.9   1.6   31  319-352    17-47  (202)
496 cd01857 HSR1_MMR1 HSR1/MMR1.    80.0     1.1 2.4E-05   40.9   2.0   27  324-352    75-101 (141)
497 cd03116 MobB Molybdenum is an   79.8     0.8 1.7E-05   43.8   1.0   18  335-352     2-19  (159)
498 cd03273 ABC_SMC2_euk Eukaryoti  79.8    0.94   2E-05   45.5   1.6   19  334-352    25-43  (251)
499 PRK11819 putative ABC transpor  79.8    0.95 2.1E-05   50.9   1.7   21  332-352    31-51  (556)
500 PRK15439 autoinducer 2 ABC tra  79.8    0.91   2E-05   50.5   1.6   21  332-352   287-307 (510)

No 1  
>PLN02597 phosphoenolpyruvate carboxykinase [ATP]
Probab=100.00  E-value=2e-155  Score=1244.88  Aligned_cols=440  Identities=90%  Similarity=1.417  Sum_probs=425.0

Q ss_pred             CccccCCCCCcCCCCCCCCCCCCCCCCCcccchhccCcccceeEecCCHHHHHHHHHhccCCeEEeccCceEEecCCccc
Q 008523          102 PKVVRGDPARKAETPKFAADPGDHFSFTPTISVSDSSLKFTHVLYNLSPAELYEQAIKYEQGSFIASSGALATLSGAKTG  181 (563)
Q Consensus       102 ~~~~~~~~~~~~~~~~~~~~~~~~~~~s~~~~l~~~g~~~~~v~~Nls~~eL~e~A~~~~~Gt~~t~~GaL~~~tG~~TG  181 (563)
                      |+|+.|||..+..+++.        .-++...+..+|+...+|+||++++||||+|+++++|++++++|+|+++||++||
T Consensus         1 ~~~~~~~~~~~~~~~~~--------~~~~~~~~~~~~~~~~~v~~nl~~~~Lye~Al~~~eG~l~~~~GaL~v~TGk~TG   72 (555)
T PLN02597          1 PKVVRGDPARKKEPPKS--------VVAPTIDVSDSGLKFTHVLYNLSPAELYEQAIKYEKGSFITSTGALATLSGAKTG   72 (555)
T ss_pred             CccccCCccccCcCccc--------ccccccccccccCCcceEEeCCCHHHHHHHHHHhCCCeEEecCCCEEecCCCcCC
Confidence            78999999887765543        4667788999999999999999999999999999999877779999999999999


Q ss_pred             CCCCCeeeecCCCccccccccC------cCccc---------------ccEEEEEeeecCCCCCeeEEEEEcccccHHHH
Q 008523          182 RSPRDKRVVKDETTEHELWWGK------MKNHD---------------VQVFVNDQFLNWDPQNRVKVRIVSARAYHSLF  240 (563)
Q Consensus       182 RSpkdk~IV~d~~~~~~i~wg~------~~e~~---------------~~lyv~d~~~G~d~~~~i~vrvit~~a~~alf  240 (563)
                      |||+|||||+|+.++++||||+      |++++               ++|||+|+|+|+||+||++||+|++.|||+||
T Consensus        73 RSP~DKfIV~d~~t~~~iwWg~g~vN~p~~~~~f~~l~~~~~~~l~~~~~lfv~D~~~Gad~~~r~~vRvite~aw~alF  152 (555)
T PLN02597         73 RSPKDKRVVRDETTEDELWWGKGSPNIEMDEETFLVNRERAVDYLNSLDKVFVNDQFLNWDPENRIKVRIVSARAYHSLF  152 (555)
T ss_pred             CCcccceecCCCCcccceeccCCccCccCCHHHHHHHHHHHHHHHccCCCEEEEeeeeccCccceeeEEEEeCHHHHHHH
Confidence            9999999999999999999964      44432               46999999999999999999999999999999


Q ss_pred             HhccCcCCChHhhccCCCCCEEEEEcCCCCCCccccCCCCccEEEEecCCCeEEEEccccchhhHHHHHHHHHHhcccCc
Q 008523          241 MHNMCIRPTPEELENFGTPDFTIYNAGQFPCNRYTHYMTSSTSIDLNLARREMVILGTQYAGEMKKGLFSVMHYLMPKRQ  320 (563)
Q Consensus       241 ~~Nlf~rp~~~el~~~~~pd~tI~~~p~f~~~~~~~g~~s~~~i~id~~~~~i~I~Gt~Y~GEiKK~iltl~n~~l~~~G  320 (563)
                      ++|||+||+.+|++.|++||||||++|+|+++++.||++|+++|++|+++++++|+||+|+|||||++||+|||+|+++|
T Consensus       153 ~~nmfirP~~~el~~f~~PdftIi~ap~f~a~~~~~g~~Se~~i~in~~~~~~lI~GT~YaGE~KK~iFs~~~~ll~~rg  232 (555)
T PLN02597        153 MHNMCIRPTPEELEDFGTPDFTIYNAGQFPCNRYTHYMTSSTSIDLNLKRKEMVILGTQYAGEMKKGLFSLMHYLMPMRG  232 (555)
T ss_pred             HHhcCCCCChHHhccCCCCCEEEEeCCCCCCCccccCCCCCcEEEEEccCCeEEEEccchhhhhHHHHHHHHHHHHHHCC
Confidence            99999999999999998999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             eeeecccceecCCCCEEEEEecCCCCcccccccCCCceeecCceeecCCCccccCCceeEeecCCCCCCCchhhhhcccc
Q 008523          321 ILSLHSGCNMGKDGDVALFFGLSGTGKTTLSTDHNRYLIGDDEHCWGDNGVSNIEGGCYAKCIDLSREKEPDIWNAIKFG  400 (563)
Q Consensus       321 ~L~mH~sanvg~~G~valfFGLSGTGKTTLsad~~r~lIgDDe~~w~~~Gvfn~EgGcyaK~~dLs~e~EP~I~~ai~f~  400 (563)
                      +|+||||||++.+|++++|||||||||||||+|++|.||+||||+|+++||||||||||||||+|++|+||+||+|++|+
T Consensus       233 ~l~mHasaNv~~~g~~~lffGlSGtGKTTLsad~~~~li~DDEHgW~~~GVfNfEGGCYAK~i~Ls~e~EPeI~~Ai~fg  312 (555)
T PLN02597        233 ILSLHSGCNMGKDGDVALFFGLSGTGKTTLSTDPNRYLIGDDEHCWSDNGVSNIEGGCYAKCIDLSEEKEPDIWNAIKFG  312 (555)
T ss_pred             cEeecCeeccCCCCcEEEEEecCCCCccceecCCCCceeecccccccCCceEeecCceEEEecCCCcccchHHHHhcCCC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ceeeeeEEcCCCCcccCCCCCcccceeEEEecccccCCcCCCCCCCcceEEEEEeccCCCCCCeeecCHHHHHHHHHccc
Q 008523          401 AVLENVVFDEHTREVDYSDKSVTENTRAAYPIEYIPNAKIPCVGPHPKNVILLACDAFGVLPPVSKLNLAQTMYHFISGY  480 (563)
Q Consensus       401 ailENV~~d~~~~~vdf~d~s~t~NtR~~yPi~~i~N~~~~~~~g~P~~iIflt~Da~gvLPPVskLt~eQA~~~FlsGy  480 (563)
                      +|||||++|++++.|||+|.++|||||++|||++|+|+++|++++||++|||||||||||||||+|||+|||||||||||
T Consensus       313 avLENVv~d~~~~~~df~D~s~TeNtR~aYPi~~I~na~~p~~~~hP~~IifLT~DAfGVlPPvskLt~eQA~yhFlsGy  392 (555)
T PLN02597        313 TVLENVVFDEHTREVDYSDKSVTENTRASYPIEYIPNAKIPCVGPHPKNVILLACDAFGVLPPVSKLTLAQTMYHFISGY  392 (555)
T ss_pred             ceEEeeEECCCCCccCCcCCcccccceEEeEHHhccccCCCccCCCCCEEEEEeccccCCCCccccCCHHHHHHHHHhcc
Confidence            99999999999888999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ccccccccCCccCccccccccccCCCccCChHHHHHHHHHHHHHcCCEEEEEeccccCCcccccccchH
Q 008523          481 TALVAGTEDGIKEPTATFSACFGAAFIMLHPTKYAAMLAEKMQKHGATGWLVNTGWSGGRCVLKMVNLY  549 (563)
Q Consensus       481 Tak~aGtE~Gv~ep~atFs~cFg~PF~p~~p~~yae~L~~kl~~~~v~v~LiNTGw~gg~yg~G~r~~~  549 (563)
                      |||+||||+|++||+||||+|||+||||+||.+||+||++||++|+++||||||||+||+||+|+||++
T Consensus       393 TakvAGTE~Gv~ep~~tFS~CFG~PFl~l~P~~Ya~~L~eki~~~~~~vyLvNTGw~GG~yg~G~Ri~l  461 (555)
T PLN02597        393 TALVAGTEDGIKEPTATFSACFGAAFIMLHPTKYAAMLAEKMQKHGATAWLVNTGWSGGSYGVGKRMSL  461 (555)
T ss_pred             eeccccccCCCCCCcccchhccCCCCcCCCHHHHHHHHHHHHHHcCCCEEEEecCccCCCCCCcceech
Confidence            999999999999999999999999999999999999999999999999999999999999999999998


No 2  
>cd00484 PEPCK_ATP Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis. It catalyzes the reversible decarboxylation and phosphorylation of oxaloacetate to yield phosphoenolpyruvate and carbon dioxide, using a nucleotide molecule (ATP) for the phosphoryl transfer, and has a strict requirement for divalent metal ions for activity. PEPCK's separate into two phylogenetic groups based on their nucleotide substrate specificity, this model describes the ATP-dependent groups.
Probab=100.00  E-value=3.7e-151  Score=1212.38  Aligned_cols=405  Identities=66%  Similarity=1.073  Sum_probs=396.7

Q ss_pred             eeEecCCHHHHHHHHHhccCCeEEeccCceEEecCCcccCCCCCeeeecCCCccccccccC----cCccc----------
Q 008523          143 HVLYNLSPAELYEQAIKYEQGSFIASSGALATLSGAKTGRSPRDKRVVKDETTEHELWWGK----MKNHD----------  208 (563)
Q Consensus       143 ~v~~Nls~~eL~e~A~~~~~Gt~~t~~GaL~~~tG~~TGRSpkdk~IV~d~~~~~~i~wg~----~~e~~----------  208 (563)
                      +|+||++++||||+|+++++| +++++|+|+++||++|||||+|||||+|+.++++||||+    |++++          
T Consensus         2 ~v~~Nls~~eL~E~A~~~~eg-~~t~~GaL~v~TG~~TGRSPkDkfIV~~~~t~~~i~wg~vn~~~~~~~f~~L~~~~~~   80 (508)
T cd00484           2 HIHHNLSPAELYEEALKRGEG-VLTSTGALAVDTGKKTGRSPKDKFIVDEPSSEDDIWWGKVNQPISEETFEILRERAVD   80 (508)
T ss_pred             ccccCCCHHHHHHHHHhCCCC-EEecCCCeEeccCCccCCCCCceeEeCCCCccccccccccCcCCCHHHHHHHHHHHHH
Confidence            589999999999999999777 599999999999999999999999999999999999988    44432          


Q ss_pred             ----ccEEEEEeeecCCCCCeeEEEEEcccccHHHHHhccCcCCChHhhccCCCCCEEEEEcCCCCCCccccCCCCccEE
Q 008523          209 ----VQVFVNDQFLNWDPQNRVKVRIVSARAYHSLFMHNMCIRPTPEELENFGTPDFTIYNAGQFPCNRYTHYMTSSTSI  284 (563)
Q Consensus       209 ----~~lyv~d~~~G~d~~~~i~vrvit~~a~~alf~~Nlf~rp~~~el~~~~~pd~tI~~~p~f~~~~~~~g~~s~~~i  284 (563)
                          ++|||+|+|+|+||+||++||+|++.|||+|||+|||++|+.+|++.| +||||||++|+|+++++.+|++|+++|
T Consensus        81 yl~~~~lyv~D~~vGadp~~r~~vRvi~~~a~~alF~~nmfi~P~~eel~~f-~pdftI~~~P~f~~~~~~~G~~s~~~i  159 (508)
T cd00484          81 YLNTKKLFVFDGFAGADPEYRLKVRVITERAWHALFMRNMFIRPTEEELENF-GPDFTIYNAPKFKANPETDGMNSETFV  159 (508)
T ss_pred             HhcCCCEEEEeeeeecCcccceeeEEEECHHHHHHHHHhCCCCCChHHhccC-CcCEEEEECCCCcCCccccCCCcccEE
Confidence                789999999999999999999999999999999999999999999999 799999999999999999999999999


Q ss_pred             EEecCCCeEEEEccccchhhHHHHHHHHHHhcccCceeeecccceecCCCCEEEEEecCCCCcccccccCCCceeecCce
Q 008523          285 DLNLARREMVILGTQYAGEMKKGLFSVMHYLMPKRQILSLHSGCNMGKDGDVALFFGLSGTGKTTLSTDHNRYLIGDDEH  364 (563)
Q Consensus       285 ~id~~~~~i~I~Gt~Y~GEiKK~iltl~n~~l~~~G~L~mH~sanvg~~G~valfFGLSGTGKTTLsad~~r~lIgDDe~  364 (563)
                      ++|+++++++|+||+|+|||||++|++||++|+++|+|+||||||++.+|++++|||||||||||||+|+.|.||+||||
T Consensus       160 iin~~~~~~lI~GT~YaGEiKKgif~~~~~ll~~~g~l~lH~sanv~~~~~~~~ffGlSGtGKtTLsa~~~r~li~DDeh  239 (508)
T cd00484         160 IINFAEREMVIGGTEYAGEMKKGIFSVMNYLLPKKGVLSMHCSANVGKKGDVALFFGLSGTGKTTLSADPNRKLIGDDEH  239 (508)
T ss_pred             EEEccCCeEEEECccchhhhHHHHHHHHHHHHHhCCcEeeccccccCCCCCEEEEEecCCCCHHHhccCccCCeeccccc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             eecCCCccccCCceeEeecCCCCCCCchhhhhccccceeeeeEEcCCCCcccCCCCCcccceeEEEecccccCCcCCCCC
Q 008523          365 CWGDNGVSNIEGGCYAKCIDLSREKEPDIWNAIKFGAVLENVVFDEHTREVDYSDKSVTENTRAAYPIEYIPNAKIPCVG  444 (563)
Q Consensus       365 ~w~~~Gvfn~EgGcyaK~~dLs~e~EP~I~~ai~f~ailENV~~d~~~~~vdf~d~s~t~NtR~~yPi~~i~N~~~~~~~  444 (563)
                      +|+++||||||||||||||+|++|.||+||+|++|++|||||++|++++.|||+|.++|||||++|||++|+|+..++++
T Consensus       240 gW~~~Gvfn~EGGcYaK~i~Ls~e~EP~I~~Ai~fgavlENVv~d~~~~~~df~d~s~TeNtR~~yP~~~I~na~~~~~~  319 (508)
T cd00484         240 GWSDRGVFNIEGGCYAKCINLSEEKEPEIYNAIKFGAVLENVVVDEETREVDYDDDSITENTRAAYPIEHIPNAVIPGVG  319 (508)
T ss_pred             ccCCCceEeecCceEEEecCCCcccChHHHHhhccCceEeeeEEcCCCCccCCCCCcccccceEEeEHHHccccCCCCcC
Confidence            99999999999999999999999999999999999999999999988899999999999999999999999999999999


Q ss_pred             CCcceEEEEEeccCCCCCCeeecCHHHHHHHHHcccccccccccCCccCccccccccccCCCccCChHHHHHHHHHHHHH
Q 008523          445 PHPKNVILLACDAFGVLPPVSKLNLAQTMYHFISGYTALVAGTEDGIKEPTATFSACFGAAFIMLHPTKYAAMLAEKMQK  524 (563)
Q Consensus       445 g~P~~iIflt~Da~gvLPPVskLt~eQA~~~FlsGyTak~aGtE~Gv~ep~atFs~cFg~PF~p~~p~~yae~L~~kl~~  524 (563)
                      +||++|||||||||||||||+|||+||||||||||||||++|||+|++||+||||+|||+||||+||.+||+||+|||++
T Consensus       320 ~~p~~iifLT~DafgVlPPvskLt~eQA~y~FlsGyTak~agTE~Gv~ep~~tFS~cfg~PF~~~~p~~ya~~L~eki~~  399 (508)
T cd00484         320 GHPKNIIFLTADAFGVLPPVSKLTPEQAMYHFLSGYTAKVAGTERGITEPTATFSACFGAPFLPLHPTVYAEMLGEKIKK  399 (508)
T ss_pred             CCCCEEEEEeccccCCCCccccCCHHHHHHHHHccccccccccccCCcCCcccchhhcCCcCCCCCHHHHHHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cCCEEEEEeccccCCcccccccchH
Q 008523          525 HGATGWLVNTGWSGGRCVLKMVNLY  549 (563)
Q Consensus       525 ~~v~v~LiNTGw~gg~yg~G~r~~~  549 (563)
                      |+++||||||||+||+||+|+||++
T Consensus       400 ~~~~v~LvNTGw~GG~yg~G~Ri~l  424 (508)
T cd00484         400 HGAKVWLVNTGWTGGSYGVGKRIPL  424 (508)
T ss_pred             cCCCEEEEecCccCCCCCCCccccH
Confidence            9999999999999999999999998


No 3  
>PTZ00311 phosphoenolpyruvate carboxykinase; Provisional
Probab=100.00  E-value=2.7e-150  Score=1211.86  Aligned_cols=416  Identities=65%  Similarity=1.074  Sum_probs=403.3

Q ss_pred             cchhccCcccceeEecCCHHHHHHHHH-hccCCeEEeccCceEEecCCcccCCCCCeeeecCCCccccccccC----cCc
Q 008523          132 ISVSDSSLKFTHVLYNLSPAELYEQAI-KYEQGSFIASSGALATLSGAKTGRSPRDKRVVKDETTEHELWWGK----MKN  206 (563)
Q Consensus       132 ~~l~~~g~~~~~v~~Nls~~eL~e~A~-~~~~Gt~~t~~GaL~~~tG~~TGRSpkdk~IV~d~~~~~~i~wg~----~~e  206 (563)
                      ..|...||...+|+||+++++|||+|+ ++++|. ++++|+|+++||++|||||+|||||+|+.++++||||+    |++
T Consensus        32 ~~l~~~g~~~~~i~~Nl~~~~L~E~al~~~~~g~-~t~~GaL~v~TG~~TGRSpkDKfIV~~~~~~d~i~Wg~vN~p~~~  110 (561)
T PTZ00311         32 EELHKLGLHNTTIHRNLTVPELYEHALKYEKNTS-ITSTGALCVYSGAKTGRSPKDKRIVKEDSSEDDIWWGKVNIPLSE  110 (561)
T ss_pred             ccHhhcCCCCCeEEeCCCHHHHHHHHHhhcCCcE-EecCCceEEecCCccCCCCCceEEeCCCCcccccccCccCccCCH
Confidence            346677898889999999999999999 566774 99999999999999999999999999999999999998    444


Q ss_pred             cc---------------ccEEEEEeeecCCCCCeeEEEEEcccccHHHHHhccCcCCChHhh----ccCCCCCEEEEEcC
Q 008523          207 HD---------------VQVFVNDQFLNWDPQNRVKVRIVSARAYHSLFMHNMCIRPTPEEL----ENFGTPDFTIYNAG  267 (563)
Q Consensus       207 ~~---------------~~lyv~d~~~G~d~~~~i~vrvit~~a~~alf~~Nlf~rp~~~el----~~~~~pd~tI~~~p  267 (563)
                      ++               ++|||+|+|+|+||+||++||+|+++|||+|||+|||++|+.+|+    +.| +||||||++|
T Consensus       111 ~~f~~L~~~~~~yl~~~~~lyv~D~~vGaDp~~~l~vRvit~~a~~alF~~nmfirP~~~el~~~~~~f-~PdftIi~~P  189 (561)
T PTZ00311        111 ESFEINKKRAIDYLNTRERLFVVDGYAGWDPKYRLKVRVITTRAYHALFMRNMLIRPTNEELKKFGEDF-VPDFTIYNAG  189 (561)
T ss_pred             HHHHHHHHHHHHHHhcCCCEEEEeeeeecCcccceeEEEEecHHHHHHHHHHCCCCCChHHhhccccCC-CCCEEEEECC
Confidence            32               689999999999999999999999999999999999999999999    777 8999999999


Q ss_pred             CCCCCccccCCCCccEEEEecCCCeEEEEccccchhhHHHHHHHHHHhcccCceeeecccceecCCCCEEEEEecCCCCc
Q 008523          268 QFPCNRYTHYMTSSTSIDLNLARREMVILGTQYAGEMKKGLFSVMHYLMPKRQILSLHSGCNMGKDGDVALFFGLSGTGK  347 (563)
Q Consensus       268 ~f~~~~~~~g~~s~~~i~id~~~~~i~I~Gt~Y~GEiKK~iltl~n~~l~~~G~L~mH~sanvg~~G~valfFGLSGTGK  347 (563)
                      +|+++++.+|++|+++|++|+++++++|+||+|+|||||++||+||++|+++|+|+||||||++++|++++|||||||||
T Consensus       190 ~f~a~~~~~G~~se~~i~in~~~~~~lI~GT~YaGEiKKgiFt~~~~ll~~rg~l~lHasa~v~~~g~~~~ffGlSGtGK  269 (561)
T PTZ00311        190 EFKANRLIEGVTSETSVALNFKRREMVILGTQYAGEMKKGILTVMMYLMPKQGVLPLHSSANVGKKGDVTLFFGLSGTGK  269 (561)
T ss_pred             CCCCCcccCCCCcccEEEEEccCCeEEEEcccchhhhHHHHHHHHHHHHHHCCceeeeeeEeeCCCCCEEEEEccCCCCH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ccccccCCCceeecCceeecCCCccccCCceeEeecCCCCCCCchhhhhccccceeeeeEEcCCCCcccCCCCCccccee
Q 008523          348 TTLSTDHNRYLIGDDEHCWGDNGVSNIEGGCYAKCIDLSREKEPDIWNAIKFGAVLENVVFDEHTREVDYSDKSVTENTR  427 (563)
Q Consensus       348 TTLsad~~r~lIgDDe~~w~~~Gvfn~EgGcyaK~~dLs~e~EP~I~~ai~f~ailENV~~d~~~~~vdf~d~s~t~NtR  427 (563)
                      ||||+|++|.||+||||+|+++||||+|||||||||+|++|.||+||+|++|++|||||++|++++.|||+|.++|||||
T Consensus       270 tTLsa~~~~~li~DD~~gW~~~Gvfn~EGGCYAK~i~Ls~e~EPeI~~Ai~fgavLENVv~d~~~~~~df~d~s~TeNtR  349 (561)
T PTZ00311        270 TTLSADPNRKLIGDDEHVWTDDGVFNIEGGCYAKCIDLSKETEPEIYNAIRFGAVLENVVLDKVTREVDFNDISITENTR  349 (561)
T ss_pred             HHhccCCCCceeecccccccCCceEeecCceEEEecCCCcccChHHHHhhccCceEEeeEEcCCCCcccCCCCcccccce
Confidence            99999999999999999999999999999999999999999999999999999999999999988999999999999999


Q ss_pred             EEEecccccCCcCCCCCCCcceEEEEEeccCCCCCCeeecCHHHHHHHHHcccccccccccCCccCccccccccccCCCc
Q 008523          428 AAYPIEYIPNAKIPCVGPHPKNVILLACDAFGVLPPVSKLNLAQTMYHFISGYTALVAGTEDGIKEPTATFSACFGAAFI  507 (563)
Q Consensus       428 ~~yPi~~i~N~~~~~~~g~P~~iIflt~Da~gvLPPVskLt~eQA~~~FlsGyTak~aGtE~Gv~ep~atFs~cFg~PF~  507 (563)
                      ++|||++|+|+++|++++||++|||||||||||||||+|||+||||||||||||||++|||+|++||+||||+|||+|||
T Consensus       350 ~ayP~~~I~na~~~~~~~~P~~IifLT~DafGVlPPvskLt~eQA~yhFlsGyTakvaGTE~Gvtep~~tFS~CFg~PFl  429 (561)
T PTZ00311        350 CAYPLEHIPNAKIPAVGGHPKNIIFLTCDAFGVLPPVSKLTPEQAMYHFISGYTAKVAGTEVGVKEPTATFSACFGEPFL  429 (561)
T ss_pred             EEeEHHhccccCCCCcCCCCCEEEEEeccccCCCCccccCCHHHHHHHHHccccccccccccCCccCccccccccCCcCC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cCChHHHHHHHHHHHHHcCCEEEEEeccccCCcccc-cccchH
Q 008523          508 MLHPTKYAAMLAEKMQKHGATGWLVNTGWSGGRCVL-KMVNLY  549 (563)
Q Consensus       508 p~~p~~yae~L~~kl~~~~v~v~LiNTGw~gg~yg~-G~r~~~  549 (563)
                      |+||.+||+||++||++|+++||||||||+||+||+ |+||++
T Consensus       430 ~l~p~~Ya~lL~eki~~~~~~v~LvNTGw~GG~yg~~G~Ri~l  472 (561)
T PTZ00311        430 VLHPTVYAEMLAEKIKKHNTRVWLLNTGWIGGSYGSGGKRMPL  472 (561)
T ss_pred             CCCHHHHHHHHHHHHHHcCCCEEEeecCccCCcCCCCCcccCH
Confidence            999999999999999999999999999999999999 999998


No 4  
>COG1866 PckA Phosphoenolpyruvate carboxykinase (ATP) [Energy production and conversion]
Probab=100.00  E-value=2.5e-149  Score=1169.58  Aligned_cols=414  Identities=54%  Similarity=0.905  Sum_probs=402.0

Q ss_pred             chhccCccc-ceeEecCCHHHHHHHHHhccCCeEEeccCceEEecCCcccCCCCCeeeecCCCccccccccC----cCcc
Q 008523          133 SVSDSSLKF-THVLYNLSPAELYEQAIKYEQGSFIASSGALATLSGAKTGRSPRDKRVVKDETTEHELWWGK----MKNH  207 (563)
Q Consensus       133 ~l~~~g~~~-~~v~~Nls~~eL~e~A~~~~~Gt~~t~~GaL~~~tG~~TGRSpkdk~IV~d~~~~~~i~wg~----~~e~  207 (563)
                      .+..+++.. ..|++|++.++|||++++++||. ++++|+|++.||.||||||||||||+|+.+++.+||+.    |+++
T Consensus         9 ~~~~~~~~~~~~v~~n~s~~~L~e~~i~~~eg~-lt~~Gal~~~TG~~TGRSPkDkfiV~~~~t~~~i~W~~~Nkpi~~e   87 (529)
T COG1866           9 ELEALGIRDVEDVVYNLSAAQLYEEAIRRGEGV-LTATGALRVDTGIYTGRSPKDKFIVRDDSTRDTIWWGTRNKPISPE   87 (529)
T ss_pred             hHHHhcccchHHHHhcCCHHHHHHHHhhcCCCc-cCCCCceEEecccccCCCCCCceEEecCcccccccccccCccCCHH
Confidence            467778875 79999999999999999999995 99999999999999999999999999999999999984    5554


Q ss_pred             c--------------ccEEEEEeeecCCCCCeeEEEEEcccccHHHHHhccCcCCChHhhccCCCCCEEEEEcCCCCCCc
Q 008523          208 D--------------VQVFVNDQFLNWDPQNRVKVRIVSARAYHSLFMHNMCIRPTPEELENFGTPDFTIYNAGQFPCNR  273 (563)
Q Consensus       208 ~--------------~~lyv~d~~~G~d~~~~i~vrvit~~a~~alf~~Nlf~rp~~~el~~~~~pd~tI~~~p~f~~~~  273 (563)
                      .              +++||+|+++|+|+++++++|+|++.|||+||++||||||+.+|+..| +|||+|+++|.|++++
T Consensus        88 ~f~~L~~~~~~yl~~k~lfv~d~~~Ga~~~~~l~vrvvte~Awh~lF~~nlfIrP~~e~l~~~-~~dftvin~p~f~~~~  166 (529)
T COG1866          88 TFDRLKGDVTDYLSGKDLFVVDGFAGADPDYRLPVRVVTEVAWHALFIRNLFIRPTGEELSTF-KPDFTVINAPSFKADP  166 (529)
T ss_pred             HHHHHHHHHHHHhccCcEEEEEeeecCCccceeeeEeehhhHHHHHHHHhcccccchhhhccC-CCCeEEEeCCcCCCCh
Confidence            3              789999999999999999999999999999999999999999999998 9999999999999999


Q ss_pred             cccCCCCccEEEEecCCCeEEEEccccchhhHHHHHHHHHHhcccCceeeecccceecCCCCEEEEEecCCCCccccccc
Q 008523          274 YTHYMTSSTSIDLNLARREMVILGTQYAGEMKKGLFSVMHYLMPKRQILSLHSGCNMGKDGDVALFFGLSGTGKTTLSTD  353 (563)
Q Consensus       274 ~~~g~~s~~~i~id~~~~~i~I~Gt~Y~GEiKK~iltl~n~~l~~~G~L~mH~sanvg~~G~valfFGLSGTGKTTLsad  353 (563)
                      ..+|++|+++|++|++++.++|+||.|+|||||++|++|||+||.+|+++||||||+|+.|++++|||||||||||||+|
T Consensus       167 ~~~g~~Se~~i~~n~~~~~~lIggT~YaGEMKK~~fs~mnylLP~~~i~~MHcsANvG~~gdvalFFGLSGTGKTTLSaD  246 (529)
T COG1866         167 KRDGLRSETFVAFNFTERIVLIGGTWYAGEMKKGIFSVMNYLLPLKGILSMHCSANVGEKGDVALFFGLSGTGKTTLSAD  246 (529)
T ss_pred             hhcccccccEEEEecccceeeeeccchhhhhhhhHHHHhhccccccccccceeccccCcCCCeEEEEeccCCCcceeccC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCceeecCceeecCCCccccCCceeEeecCCCCCCCchhhhhccccceeeeeEEcCCCCcccCCCCCcccceeEEEecc
Q 008523          354 HNRYLIGDDEHCWGDNGVSNIEGGCYAKCIDLSREKEPDIWNAIKFGAVLENVVFDEHTREVDYSDKSVTENTRAAYPIE  433 (563)
Q Consensus       354 ~~r~lIgDDe~~w~~~Gvfn~EgGcyaK~~dLs~e~EP~I~~ai~f~ailENV~~d~~~~~vdf~d~s~t~NtR~~yPi~  433 (563)
                      |+|+|||||||+|+++||||||||||+|||+|++|+||+||+||+++++||||++|++ +.|||+|.|+|||||++|||+
T Consensus       247 p~R~LIGDDEHgW~d~GVFN~EGGCYAK~I~Ls~e~EP~I~~Ai~~~avLENVVvded-g~~Df~D~SlTeNTR~aYpi~  325 (529)
T COG1866         247 PHRRLIGDDEHGWDDRGVFNFEGGCYAKTINLSEEKEPEIYAAIKRGAVLENVVVDED-GTPDFDDGSLTENTRAAYPIE  325 (529)
T ss_pred             CccccccCcccccCCCceEeecCccccccccCchhhchhHHHHhhccceeeeEEEcCC-CCcCCccccccccccccchHh
Confidence            9999999999999999999999999999999999999999999999999999999997 899999999999999999999


Q ss_pred             cccCCcCCCCCCCcceEEEEEeccCCCCCCeeecCHHHHHHHHHcccccccccccCCccCccccccccccCCCccCChHH
Q 008523          434 YIPNAKIPCVGPHPKNVILLACDAFGVLPPVSKLNLAQTMYHFISGYTALVAGTEDGIKEPTATFSACFGAAFIMLHPTK  513 (563)
Q Consensus       434 ~i~N~~~~~~~g~P~~iIflt~Da~gvLPPVskLt~eQA~~~FlsGyTak~aGtE~Gv~ep~atFs~cFg~PF~p~~p~~  513 (563)
                      +|+|++....++||++|||||||||||||||||||+||||||||||||||++|||+|++||+||||+|||+||||+||.+
T Consensus       326 ~Ipn~~~~~~~ghp~~iIfLTaDafGVlPPvsrLTpeQamYhFlsG~TaK~agTE~Gvtep~pTFStCFGaPFmp~hp~~  405 (529)
T COG1866         326 HIPNVSPSVKAGHPKNVIFLTADAFGVLPPVSRLTPEQAMYHFLSGYTAKLAGTERGVTEPEPTFSTCFGAPFMPLHPTR  405 (529)
T ss_pred             hccccCcccccCCCceEEEEeccccCCCCcchhcCHHHHHHHHHcchhhhccccccCCCCCCcccccccCCcccCCChhH
Confidence            99996665667799999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHcCCEEEEEeccccCCcccccccchH
Q 008523          514 YAAMLAEKMQKHGATGWLVNTGWSGGRCVLKMVNLY  549 (563)
Q Consensus       514 yae~L~~kl~~~~v~v~LiNTGw~gg~yg~G~r~~~  549 (563)
                      ||++|.++|++||++||||||||+||+||+|+||++
T Consensus       406 YA~~L~~~i~~~~~~vyLvNTGWtGg~yg~GkRi~i  441 (529)
T COG1866         406 YAELLGKLIKAHGANVYLVNTGWTGGAYGTGKRIPI  441 (529)
T ss_pred             HHHHHHHHHHHcCCcEEEEecCccCCCCCCccccCH
Confidence            999999999999999999999999999999999998


No 5  
>TIGR00224 pckA phosphoenolpyruvate carboxykinase (ATP). Involved in the gluconeogenesis pathway. It converts oxaloacetic acid to phosphoenolpyruvate using ATP. Enzyme is a monomer. The reaction is also catalysed by phosphoenolpyruvate carboxykinase (GTP) (EC 4.1.1.32) using GTP instead of ATP, described in PROSITE:PDOC00421
Probab=100.00  E-value=2.4e-147  Score=1181.62  Aligned_cols=410  Identities=54%  Similarity=0.871  Sum_probs=396.0

Q ss_pred             chhccCccc-ceeEecCCHHHHHHHHHhc-----cCCeEEeccCceEEecCCcccCCCCCeeeecCCCccccccccC---
Q 008523          133 SVSDSSLKF-THVLYNLSPAELYEQAIKY-----EQGSFIASSGALATLSGAKTGRSPRDKRVVKDETTEHELWWGK---  203 (563)
Q Consensus       133 ~l~~~g~~~-~~v~~Nls~~eL~e~A~~~-----~~Gt~~t~~GaL~~~tG~~TGRSpkdk~IV~d~~~~~~i~wg~---  203 (563)
                      .|...|+.. .+|+||+++++|||+|+++     ++|. ++++|+|+++||++|||||+|||||+|+.++++||||+   
T Consensus         9 ~l~~~g~~~~~~v~~Nl~~~~L~e~a~~~~~~~~~eg~-~t~~Gal~v~TG~~TGRSpkDK~IV~~~~t~~~i~Wg~vN~   87 (532)
T TIGR00224         9 ELEALGISDVHDIVYNPSYAQLYEEELKPSLTGYEKGV-LTSTGAVAVDTGIFTGRSPKDKYIVEDETTKDTIWWGPVNK   87 (532)
T ss_pred             hHHhcCCCCCceEEeCCCHHHHHHHHHhhccccCCCce-eccCCceEEecCCeeCCCcCceEEeCCCCcccccccCcCCc
Confidence            455667865 6899999999999999999     6785 99999999999999999999999999999999999988   


Q ss_pred             -cCccc--------------ccEEEEEeeecCCCCCeeEEEEEcccccHHHHHhccCcCCChHhhccCCCCCEEEEEcCC
Q 008523          204 -MKNHD--------------VQVFVNDQFLNWDPQNRVKVRIVSARAYHSLFMHNMCIRPTPEELENFGTPDFTIYNAGQ  268 (563)
Q Consensus       204 -~~e~~--------------~~lyv~d~~~G~d~~~~i~vrvit~~a~~alf~~Nlf~rp~~~el~~~~~pd~tI~~~p~  268 (563)
                       |+++.              ++|||+|+|+|+||+||++||||+++|||+||++|||+||+.+|++.| +||||||++|+
T Consensus        88 p~~~~~f~~L~~~v~~~l~~~~lyv~D~~~GaDp~~rl~vRvite~AwhalF~~nmfirP~~eel~~f-ePdftI~~~p~  166 (532)
T TIGR00224        88 PLSEETWQHLKGLVTRQLSRKRLFVVDAFCGADPKYRLSVRVVTEVAWQAHFVKNMFIRPTEEELAGF-EPDFTVMNGAK  166 (532)
T ss_pred             CCCHHHHHHHHHHHHHHhcCCCEEEEeeeeccCcccceeEEEEEcHHHHHHHHHhhCCCCChHHhccC-CCCEEEEeCCC
Confidence             44432              679999999999999999999999999999999999999999999999 99999999999


Q ss_pred             CC-CCccccCCCCccEEEEecCCCeEEEEccccchhhHHHHHHHHHHhcccCceeeecccceecCCCCEEEEEecCCCCc
Q 008523          269 FP-CNRYTHYMTSSTSIDLNLARREMVILGTQYAGEMKKGLFSVMHYLMPKRQILSLHSGCNMGKDGDVALFFGLSGTGK  347 (563)
Q Consensus       269 f~-~~~~~~g~~s~~~i~id~~~~~i~I~Gt~Y~GEiKK~iltl~n~~l~~~G~L~mH~sanvg~~G~valfFGLSGTGK  347 (563)
                      |. +++..+|++|+++|++|+++++++|+||+|+|||||++|++||++|+++|+|+||||||++++|++++|||||||||
T Consensus       167 f~~ad~~~~g~~S~~~i~in~~~~~~lI~GT~YaGEiKKgiFs~~~~ll~~rg~l~lH~sanv~~~g~~~~ffGlSGtGK  246 (532)
T TIGR00224       167 FTNPNWKEQGLNSENFVAFNLTERMQLIGGTWYGGEMKKGMFSMMNYLLPLKGILSMHCSANVGEKGDVALFFGLSGTGK  246 (532)
T ss_pred             CCCCCcccCCCCcCcEEEEecccCeEEEECcchhhhhHHHHHHHHHHHHHhCCeEeecCeeeeCCCCCEEEEEecCCCCh
Confidence            99 88889999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ccccccCCCceeecCceeecCCCccccCCceeEeecCCCCCCCchhhhhccccceeeeeEEcCCCCcccCCCCCccccee
Q 008523          348 TTLSTDHNRYLIGDDEHCWGDNGVSNIEGGCYAKCIDLSREKEPDIWNAIKFGAVLENVVFDEHTREVDYSDKSVTENTR  427 (563)
Q Consensus       348 TTLsad~~r~lIgDDe~~w~~~Gvfn~EgGcyaK~~dLs~e~EP~I~~ai~f~ailENV~~d~~~~~vdf~d~s~t~NtR  427 (563)
                      |||++|++|.||+||||+|+++||||||||||||||+|++|+||+||+|++|++|||||++|++ +.|||+|.++|+|||
T Consensus       247 TTLsad~~r~li~DDEhgW~~~Gvfn~EGGCYaK~i~Ls~e~EPeI~~Ai~fgavLENVv~d~~-~~vdf~d~s~TeNtR  325 (532)
T TIGR00224       247 TTLSTDPKRRLIGDDEHGWDDDGVFNFEGGCYAKTIHLSEEKEPEIYNAIRRDALLENVVVRED-GTVDFDDGSKTENTR  325 (532)
T ss_pred             hhhhccccccccccccccccCCceEeecCceEEEecCCCcccchHHHHhcCCCceEEeeeECCC-CCccCCCCcccccce
Confidence            9999999999999999999999999999999999999999999999999999999999999997 899999999999999


Q ss_pred             EEEecccccCCcCCC-CCCCcceEEEEEeccCCCCCCeeecCHHHHHHHHHcccccccccccCCccCccccccccccCCC
Q 008523          428 AAYPIEYIPNAKIPC-VGPHPKNVILLACDAFGVLPPVSKLNLAQTMYHFISGYTALVAGTEDGIKEPTATFSACFGAAF  506 (563)
Q Consensus       428 ~~yPi~~i~N~~~~~-~~g~P~~iIflt~Da~gvLPPVskLt~eQA~~~FlsGyTak~aGtE~Gv~ep~atFs~cFg~PF  506 (563)
                      ++|||++|+|++.++ +++||++|||||||||||||||+|||+||||||||||||||+||||+||+||+||||+|||+||
T Consensus       326 ~ayPi~~I~n~~~~~~~~~~p~~iifLT~DAfGVlPPvskLt~eQA~yhFlsGyTakvAGTE~Gv~ep~~tFS~Cfg~PF  405 (532)
T TIGR00224       326 VSYPIYHIDNIVKPVSAAGHATKVIFLTADAFGVLPPVSKLTPEQTMYHFLSGFTAKLAGTERGITEPTPTFSACFGAAF  405 (532)
T ss_pred             EEeEHHhccccCCCCccCCCCCEEEEEeccccCCCCccccCCHHHHHHHHHhcceeccccccCCCCCCcccchhhcCCCC
Confidence            999999999998777 7789999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ccCChHHHHHHHHHHHHHcCCEEEEEeccccCCcccccccchH
Q 008523          507 IMLHPTKYAAMLAEKMQKHGATGWLVNTGWSGGRCVLKMVNLY  549 (563)
Q Consensus       507 ~p~~p~~yae~L~~kl~~~~v~v~LiNTGw~gg~yg~G~r~~~  549 (563)
                      ||+||.+||+||++||++|+++||||||||+    |+|+||++
T Consensus       406 l~~~p~~Ya~lL~~ki~~~~~~v~LvNTGw~----G~G~Ri~l  444 (532)
T TIGR00224       406 LSLHPTQYAEVLVKRMQAAGAQAYLVNTGWN----GTGKRISI  444 (532)
T ss_pred             CCCCHHHHHHHHHHHHHHcCCCEEEEecCcc----cCCcEecH
Confidence            9999999999999999999999999999999    59999998


No 6  
>PF01293 PEPCK_ATP:  Phosphoenolpyruvate carboxykinase The Prosite pattern is specific to the ATP binding region;  InterPro: IPR001272  Phosphoenolpyruvate carboxykinase (PEPCK) catalyses the first committed (rate-limiting) step in hepatic gluconeogenesis, namely the reversible decarboxylation of oxaloacetate to phosphoenolpyruvate (PEP) and carbon dioxide, using either ATP or GTP as a source of phosphate. The ATP-utilising (4.1.1.49 from EC) and GTP-utilising (4.1.1.32 from EC) enzymes form two divergent subfamilies, which have little sequence similarity but which retain conserved active site residues. ATP-utilising PEPCKs are monomers or oligomers of identical subunits found in certain bacteria, yeast, trypanosomatids, and plants, while GTP-utilising PEPCKs are mainly monomers found in animals and some bacteria []. Both require divalent cations for activity, such as magnesium or manganese. One cation interacts with the enzyme at metal binding site 1 to elicit activation, while the second cation interacts at metal binding site 2 to serve as a metal-nucleotide substrate. In bacteria, fungi and plants, PEPCK is involved in the glyoxylate bypass, an alternative to the tricarboxylic acid cycle.  PEPCK helps to regulate blood glucose levels. The rate of gluconeogenesis can be controlled through transcriptional regulation of the PEPCK gene by cAMP (the mediator of glucagon and catecholamines), glucocorticoids and insulin. In general, PEPCK expression is induced by glucagon, catecholamines and glucocorticoids during periods of fasting and in response to stress, but is inhibited by (glucose-induced) insulin upon feeding []. With type II diabetes, this regulation system can fail, resulting in increased gluconeogenesis that in turn raises glucose levels []. PEPCK consists of an N-terminal and a catalytic C-terminal domain, with the active site and metal ions located in a cleft between them. Both domains have an alpha/beta topology that is partly similar to one another [, ]. Substrate binding causes PEPCK to undergo a conformational change, which accelerates catalysis by forcing bulk solvent molecules out of the active site []. PCK uses an alpha/beta/alpha motif for nucleotide binding, this motif differing from other kinase domains. GTP-utilising PEPCK has a PEP-binding domain and two kinase motifs to bind GTP and magnesium. This entry represents ATP-utilising phosphoenolpyruvate carboxykinase enzymes.; GO: 0004612 phosphoenolpyruvate carboxykinase (ATP) activity, 0005524 ATP binding, 0006094 gluconeogenesis; PDB: 2PY7_X 2OLR_A 1AYL_A 1K3D_A 1OEN_A 1AQ2_A 1OS1_A 2OLQ_A 1K3C_A 2PXZ_X ....
Probab=100.00  E-value=1.4e-138  Score=1115.53  Aligned_cols=408  Identities=57%  Similarity=0.971  Sum_probs=350.3

Q ss_pred             ceeEecCCHHHHHHHHHhccCCeEEeccCceEEecCCcccCCCCCeeeecCCCccccccccC----cCccc---------
Q 008523          142 THVLYNLSPAELYEQAIKYEQGSFIASSGALATLSGAKTGRSPRDKRVVKDETTEHELWWGK----MKNHD---------  208 (563)
Q Consensus       142 ~~v~~Nls~~eL~e~A~~~~~Gt~~t~~GaL~~~tG~~TGRSpkdk~IV~d~~~~~~i~wg~----~~e~~---------  208 (563)
                      .+|+||||++||||+|+++++|+ ++++|+|+++||++|||||+|||||+++.++++||||+    |++++         
T Consensus         2 ~~v~~Nls~~~L~e~a~~~~eg~-lt~~Gal~v~tG~~TGRSp~dkfIV~~~~~~~~v~Wg~~n~~i~~e~f~~L~~~v~   80 (466)
T PF01293_consen    2 ANVYRNLSPPELYEEAIKRGEGV-LTKTGALVVNTGKFTGRSPKDKFIVDEPGTEDKVWWGSVNQPISEEQFEKLLERVV   80 (466)
T ss_dssp             SEEEES--HHHHHHHHCHTTTEE-E-TTSSEEE--TT-SSB-GGGEEEE-STTTTTTS-BTTSBEEE-HHHHHHHHHHHH
T ss_pred             CeeEeCCCHHHHHHHHHhcCCCE-EccCCCEEEeCCCccCCCCCceEEecCCccccccccccCCcccCHHHHHHHHHHHH
Confidence            47999999999999999999995 99999999999999999999999999999999999988    45432         


Q ss_pred             -----ccEEEEEeeecCCCCCeeEEEEEcccccHHHHHhccCcCCChHhhccCCCCCEEEEEcCCCCCCccccCCCCccE
Q 008523          209 -----VQVFVNDQFLNWDPQNRVKVRIVSARAYHSLFMHNMCIRPTPEELENFGTPDFTIYNAGQFPCNRYTHYMTSSTS  283 (563)
Q Consensus       209 -----~~lyv~d~~~G~d~~~~i~vrvit~~a~~alf~~Nlf~rp~~~el~~~~~pd~tI~~~p~f~~~~~~~g~~s~~~  283 (563)
                           ++|||+|+++|+||+||++||+|++.+||+||++|||++|..+|+.+| +||||||++|+|.++++.+|++|+++
T Consensus        81 ~yL~~k~lyv~D~~vG~d~~~~~~vRvit~~a~~aLF~~nL~~~p~~~e~~~f-~pd~tI~~~p~f~~~p~~~g~~s~~~  159 (466)
T PF01293_consen   81 DYLSTKELYVQDGYVGADPDYRIKVRVITERAWHALFARNLFIRPPPEELQNF-EPDFTIINAPDFKADPEIDGTNSDTF  159 (466)
T ss_dssp             HHHTTSEEEEEEEEESSSTTT-EEEEEEESSHHHHHHHHHHSB-GSHHHHHT--S-SEEEEEETTS--TTCHCT-SSS-E
T ss_pred             HHhcccceEEEEEEEecCHHHceeEEEEeCcHHHHHHHHHhhcCCChhHhccc-CCCEEEEeCCccccCCCcCCCCCCcE
Confidence                 799999999999999999999999999999999999999999999999 99999999999999999999999999


Q ss_pred             EEEecCCCeEEEEccccchhhHHHHHHHHHHhcccCceeeecccceecCCCCEEEEEecCCCCcccccccCCCceeecCc
Q 008523          284 IDLNLARREMVILGTQYAGEMKKGLFSVMHYLMPKRQILSLHSGCNMGKDGDVALFFGLSGTGKTTLSTDHNRYLIGDDE  363 (563)
Q Consensus       284 i~id~~~~~i~I~Gt~Y~GEiKK~iltl~n~~l~~~G~L~mH~sanvg~~G~valfFGLSGTGKTTLsad~~r~lIgDDe  363 (563)
                      |++|+++|+++|+||+|+|||||++||+||++++++|+||||||||++++|++++|||||||||||||+||+|.||||||
T Consensus       160 i~~d~~~~~~vI~Gt~Y~GEiKK~ift~~n~ll~~~g~l~mH~san~~~~gd~alfFGLSGTGKTTLs~d~~r~ligDDe  239 (466)
T PF01293_consen  160 IIFDFERNVAVILGTRYAGEIKKGIFTVMNYLLPRNGVLPMHCSANVGKDGDTALFFGLSGTGKTTLSADPERELIGDDE  239 (466)
T ss_dssp             EEEETTTTEEEEES---THHHHHHHHHHHHHHHHHTT-EEEEEEEEEETTSSEEEEEESTTSSHHHHHSBTTSEEEESSE
T ss_pred             EEEccccCeEEEECCcccccchHHHHHHHHHhhHhcCeEEEEeeeeeCCCCCeEEEEecCCCCccccccCCcceEEeCce
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             eeecCCCccccCCceeEeecCCCCCCCchhhhhccccceeeeeEEcCCCCcccCCCCCcccceeEEEecccccCCcCCCC
Q 008523          364 HCWGDNGVSNIEGGCYAKCIDLSREKEPDIWNAIKFGAVLENVVFDEHTREVDYSDKSVTENTRAAYPIEYIPNAKIPCV  443 (563)
Q Consensus       364 ~~w~~~Gvfn~EgGcyaK~~dLs~e~EP~I~~ai~f~ailENV~~d~~~~~vdf~d~s~t~NtR~~yPi~~i~N~~~~~~  443 (563)
                      |+|+++|+||+|||||+||+||+++.||+||+|++|++|+|||++|+++++|||+|+++|+|||++|||++|+|++.++.
T Consensus       240 ~~w~d~gv~~~EggcyaKt~~l~~~~ep~i~~ai~~~avlENV~~d~~~~~vd~~d~s~t~N~R~~~p~~~i~n~~~~~~  319 (466)
T PF01293_consen  240 HGWSDGGVFNFEGGCYAKTIDLSKESEPEIYNAIKFGAVLENVVVDEETREVDFDDDSITENTRAIYPREFIPNAVDPGD  319 (466)
T ss_dssp             EEEESSEEEES-SEEEEE-TT--TTTSHHHHHCCSTT-EEES-EEETTTSCEETT--SS-S--EEEEEGGGSSSB-SSSE
T ss_pred             eeecCCceEeecCceeeeecCCCcccchhHHHHhccCeeecceEEeCCCCccCCccccccCceeEEEEhhHhhccccccc
Confidence            99999999999999999999999999999999999999999999998899999999999999999999999999998888


Q ss_pred             CCCcceEEEEEeccCCCCCCeeecCHHHHHHHHHcccccccccccCCccCccccccccccCCCccCChHHHHHHHHHHHH
Q 008523          444 GPHPKNVILLACDAFGVLPPVSKLNLAQTMYHFISGYTALVAGTEDGIKEPTATFSACFGAAFIMLHPTKYAAMLAEKMQ  523 (563)
Q Consensus       444 ~g~P~~iIflt~Da~gvLPPVskLt~eQA~~~FlsGyTak~aGtE~Gv~ep~atFs~cFg~PF~p~~p~~yae~L~~kl~  523 (563)
                      ++||++||||+||+|||||||+|||++||||||+||||+|++|||.|++||++|||+||++|||++||.+||++|+++|+
T Consensus       320 ~~~p~~IifLt~Da~gvlPPvskLt~~qa~~~F~~G~t~k~agtE~g~~ep~~~fs~~f~~PF~~~~p~~ya~~l~~~~~  399 (466)
T PF01293_consen  320 GGHPKNIIFLTCDAFGVLPPVSKLTPEQAMYYFLSGYTAKVAGTERGVTEPQATFSECFGNPFMPLPPSVYAELLKEKIK  399 (466)
T ss_dssp             ES-EEEEEEEE--TTS-S-SEEEE-HHHHHHHHHH-EEEEETTSBTTSSSEEEEE-GGG-GGG-SS-HHHHHHHHHHHHH
T ss_pred             cCCCCEEEEEECCCCCCCCcceeCCHHHHHHHHHHHHHhhhcccccCccCCCCceecccCCCCccCCHHHHHHHHHHHHH
Confidence            89999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HcCCEEEEEeccccCCcccccccchHHh
Q 008523          524 KHGATGWLVNTGWSGGRCVLKMVNLYAD  551 (563)
Q Consensus       524 ~~~v~v~LiNTGw~gg~yg~G~r~~~~~  551 (563)
                      +++++||||||||+||+||+|+||+++.
T Consensus       400 ~~~~~~yl~NTG~~gg~~~~g~ri~~~~  427 (466)
T PF01293_consen  400 KHGVNCYLVNTGWTGGPYGVGKRIPLEY  427 (466)
T ss_dssp             HHT-EEEEEE-SBETTSCCCSSB--HHH
T ss_pred             hcCCCEEEEeCCccCCCCCceeECCHHH
Confidence            9999999999999999999999999843


No 7  
>PRK09344 phosphoenolpyruvate carboxykinase; Provisional
Probab=100.00  E-value=2.7e-137  Score=1112.72  Aligned_cols=413  Identities=55%  Similarity=0.925  Sum_probs=402.9

Q ss_pred             hhccCccc-ceeEecCCHHHHHHHHHhccCCeEEeccCceEEecCCcccCCCCCeeeecCCCccccccccC----cCccc
Q 008523          134 VSDSSLKF-THVLYNLSPAELYEQAIKYEQGSFIASSGALATLSGAKTGRSPRDKRVVKDETTEHELWWGK----MKNHD  208 (563)
Q Consensus       134 l~~~g~~~-~~v~~Nls~~eL~e~A~~~~~Gt~~t~~GaL~~~tG~~TGRSpkdk~IV~d~~~~~~i~wg~----~~e~~  208 (563)
                      |...||.. .+++||+++++|||+|+++++|+ ++++|+|+++||++|||||+|||||+|+.++++||||+    |++++
T Consensus         8 l~~~g~~~~~~i~~n~~~~~L~e~a~~~~~g~-~t~~Gal~~~tG~~tGRSp~dk~iV~~~~~~~~i~wg~~n~~~~~~~   86 (526)
T PRK09344          8 LEAYGITNLSNVHYNLSYAELYEEALRRGEGV-LTDTGALAVDTGKFTGRSPKDKFIVRDPSTEDTIWWGDDNKPISPEK   86 (526)
T ss_pred             hhhcCCCCcceeEeCCCHHHHHHHHHHcCCCe-eccCCceEEecCCccCCCcCceeeecCccccccccccccCCCCCHHH
Confidence            77888886 79999999999999999999995 99999999999999999999999999999999999987    55432


Q ss_pred             --------------ccEEEEEeeecCCCCCeeEEEEEcccccHHHHHhccCcCCChHhhccCCCCCEEEEEcCCCCCCcc
Q 008523          209 --------------VQVFVNDQFLNWDPQNRVKVRIVSARAYHSLFMHNMCIRPTPEELENFGTPDFTIYNAGQFPCNRY  274 (563)
Q Consensus       209 --------------~~lyv~d~~~G~d~~~~i~vrvit~~a~~alf~~Nlf~rp~~~el~~~~~pd~tI~~~p~f~~~~~  274 (563)
                                    ++|||+|+++|+||+|+++||++++++||+||++|||++|..+|++.+ +||||||++|+|+++|.
T Consensus        87 f~~l~~~~~~~l~~~~lyv~d~~vG~d~~~~~~vrvi~~~a~~~lf~~nlf~~p~~~e~~~~-~Pd~~ii~~p~~~~~~~  165 (526)
T PRK09344         87 FDALKQKVLAYLSGKDLFVVDGFAGADPEYRLPVRVITELAWHALFVRNLFIRPSEEELASF-EPDFTIINAPKFKADPE  165 (526)
T ss_pred             HHHHHHHHHHHhcCCcEEEEeeeecCChhHeeeEEEEecHHHHHHHHhhcCCCCChhHhccC-CCCEEEEEcCCCCCCcc
Confidence                          789999999999999999999999999999999999999999999988 99999999999999999


Q ss_pred             ccCCCCccEEEEecCCCeEEEEccccchhhHHHHHHHHHHhcccCceeeecccceecCCCCEEEEEecCCCCcccccccC
Q 008523          275 THYMTSSTSIDLNLARREMVILGTQYAGEMKKGLFSVMHYLMPKRQILSLHSGCNMGKDGDVALFFGLSGTGKTTLSTDH  354 (563)
Q Consensus       275 ~~g~~s~~~i~id~~~~~i~I~Gt~Y~GEiKK~iltl~n~~l~~~G~L~mH~sanvg~~G~valfFGLSGTGKTTLsad~  354 (563)
                      .+|++|+++|++|+++|+++|+||+|||||||++||+||++++++|+|||||||+++++|++++|||||||||||||+++
T Consensus       166 ~~g~~s~~~i~~~~~~~~~~I~Gt~Y~GE~KK~~lt~~~~~l~~rg~l~lH~sa~i~~~g~~~~ffGlSGtGKSTls~~~  245 (526)
T PRK09344        166 RDGTNSETFIAINFTERIVLIGGTDYAGEMKKSIFSVMNYLLPLKGVLPMHCSANVGEEGDVALFFGLSGTGKTTLSADP  245 (526)
T ss_pred             ccCCCCCceEEEecccCeEEEEcchhHHHHHHHHHHHHHHHHHHCCcEeeeCeeecCCCCcEEEEEeecCCCeeeccccC
Confidence            99999999999999999999999999999999999999999999999999999999988999999999999999999999


Q ss_pred             CCceeecCceeecCCCccccCCceeEeecCCCCCCCchhhhhccccceeeeeEEcCCCCcccCCCCCcccceeEEEeccc
Q 008523          355 NRYLIGDDEHCWGDNGVSNIEGGCYAKCIDLSREKEPDIWNAIKFGAVLENVVFDEHTREVDYSDKSVTENTRAAYPIEY  434 (563)
Q Consensus       355 ~r~lIgDDe~~w~~~Gvfn~EgGcyaK~~dLs~e~EP~I~~ai~f~ailENV~~d~~~~~vdf~d~s~t~NtR~~yPi~~  434 (563)
                      ++.||+||||+|+++|+||+|+|||+||+||+++.||+||+|++|++++|||++|+ +|.|||+|+++|+|||++||+++
T Consensus       246 ~~~li~DD~~~~~d~gvfn~EgGcyaK~~dL~~~~EP~I~~a~~~gavlENV~~d~-~~~vdf~d~s~T~NtR~~yP~~~  324 (526)
T PRK09344        246 NRKLIGDDEHGWDDGGVFNFEGGCYAKTINLSEEAEPEIYDAIRFGAVLENVVVDE-DGTVDFDDGSLTENTRAAYPIEH  324 (526)
T ss_pred             CcceeccceEEEcCCceEeccceEEEEecCCCccccchHhhhhccCceeeeEEECC-CCcccCCCCcccccceEEEEhHH
Confidence            99999999999999999999999999999999999999999999999999999999 78999999999999999999999


Q ss_pred             ccCCcCCCCCCCcceEEEEEeccCCCCCCeeecCHHHHHHHHHcccccccccccCCccCccccccccccCCCccCChHHH
Q 008523          435 IPNAKIPCVGPHPKNVILLACDAFGVLPPVSKLNLAQTMYHFISGYTALVAGTEDGIKEPTATFSACFGAAFIMLHPTKY  514 (563)
Q Consensus       435 i~N~~~~~~~g~P~~iIflt~Da~gvLPPVskLt~eQA~~~FlsGyTak~aGtE~Gv~ep~atFs~cFg~PF~p~~p~~y  514 (563)
                      |+|++.++.++||++||||+||+|||||||+|||++|||||||||||+|++|||.|++||+||||+|||+||||+||.+|
T Consensus       325 i~n~~~~~~~~~p~~iifLt~Da~gvlPPvskLt~eQA~y~FlsGyTak~agtE~G~tep~~tfs~cFg~PF~p~~p~~y  404 (526)
T PRK09344        325 IPNAVKPSRAGHPKNIIFLTADAFGVLPPVSKLTPEQAMYHFLSGYTAKVAGTERGVTEPQPTFSTCFGAPFLPLHPTVY  404 (526)
T ss_pred             hcCccccccCCCCCEEEEEEcCCcCCCCcceeCCHHHHHHHHHcCceecccccccCcccCCceeecccCCCCcCCCHHHH
Confidence            99999999989999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHcCCEEEEEeccccCCcccccccchH
Q 008523          515 AAMLAEKMQKHGATGWLVNTGWSGGRCVLKMVNLY  549 (563)
Q Consensus       515 ae~L~~kl~~~~v~v~LiNTGw~gg~yg~G~r~~~  549 (563)
                      |++|++||++|+++||||||||+||+||+|+||++
T Consensus       405 a~~L~~kl~~~~~~vylvNTGw~GG~~g~g~ri~~  439 (526)
T PRK09344        405 AELLGERIKAHGAKVYLVNTGWTGGPYGTGKRISI  439 (526)
T ss_pred             HHHHHHHHHHcCCCEEEEecccccCCCCCCccCCH
Confidence            99999999999999999999999999999999998


No 8  
>cd01919 PEPCK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis. It catalyzes the reversible decarboxylation and phosphorylation of oxaloacetate to yield phosphoenolpyruvate and carbon dioxide, using a nucleotide molecule (ATP  or GTP) for the phosphoryl transfer, and has a strict requirement for divalent metal ions for activity.  PEPCK's separate into two phylogenetic groups based on their nucleotide substrate specificity (the ATP-, and GTP-dependent groups).
Probab=100.00  E-value=2.8e-118  Score=966.71  Aligned_cols=406  Identities=41%  Similarity=0.596  Sum_probs=389.3

Q ss_pred             eeEecCCHHHHHHHHHhc-cCCeEEeccCceEEecCCcccCCCCCeeeecCCCccccccc----cC----cCccc-----
Q 008523          143 HVLYNLSPAELYEQAIKY-EQGSFIASSGALATLSGAKTGRSPRDKRVVKDETTEHELWW----GK----MKNHD-----  208 (563)
Q Consensus       143 ~v~~Nls~~eL~e~A~~~-~~Gt~~t~~GaL~~~tG~~TGRSpkdk~IV~d~~~~~~i~w----g~----~~e~~-----  208 (563)
                      +|+||+++++|||+|+++ ++|. ++++|+|++.||++|||||+|||||+++.+++.+||    ++    ++++.     
T Consensus         2 ~v~~n~~~~~L~e~~~~~~g~~~-~~~~g~l~~~tg~~tgRsp~dkfIv~~~~~~~~~~w~~~w~~~N~~~~~~~~~~~~   80 (515)
T cd01919           2 HIHINDENGRLLQQMLEEYGILR-LTKNGALAVTDPRDTGRSPSDKVIVTQDQRRTVPIPKTGLSQLNRWLSEEDFEKAF   80 (515)
T ss_pred             ceEECCCHHHHHHHHHHhcCCEE-ECCCceEEECCCCccccCCCceEEeCCCccccCccccccccccCCCCCHHHHHHHH
Confidence            589999999999999999 7775 889999999999999999999999999999999995    54    44432     


Q ss_pred             ----------ccEEEEEeeecCCCCCeeEEEEEcccccHHHHHhccCcCCChHhhccCCCCCEEEEEcCCCCCCccc-cC
Q 008523          209 ----------VQVFVNDQFLNWDPQNRVKVRIVSARAYHSLFMHNMCIRPTPEELENFGTPDFTIYNAGQFPCNRYT-HY  277 (563)
Q Consensus       209 ----------~~lyv~d~~~G~d~~~~i~vrvit~~a~~alf~~Nlf~rp~~~el~~~~~pd~tI~~~p~f~~~~~~-~g  277 (563)
                                ++|||+|+++|+|+++++++|+||++|||+|||+|||++|..+|++.|++|||++|++|+|++++.. ++
T Consensus        81 ~~~~~~~m~gr~myV~d~~~G~~~~~~~~~r~it~~ay~~lf~~~m~~~p~~~~l~~~~~p~~~ii~~~g~~~~~~~w~g  160 (515)
T cd01919          81 NARFPGLMKGRTLFVVDFFMGPGSPLRLIVRELTDSPYVAAFMRIMTIMPTDEELAAFGDPDVKCLNSVGCPLPLQKWPG  160 (515)
T ss_pred             HHHHHHHhcCCCEEEEeceECCCCcccccEEEEEChHHHHHHHHHhccCCChHHHhhCCCCCEEEEeCCCCcCCccCCCC
Confidence                      7899999999999999999999999999999999999999989999997799999999999999987 89


Q ss_pred             CCCccEEEEecCCCeEEEEccccchhhHHHHHHHHHHhcccCceeeecccceecCCCCEEEEEecCCCCcccccccCCCc
Q 008523          278 MTSSTSIDLNLARREMVILGTQYAGEMKKGLFSVMHYLMPKRQILSLHSGCNMGKDGDVALFFGLSGTGKTTLSTDHNRY  357 (563)
Q Consensus       278 ~~s~~~i~id~~~~~i~I~Gt~Y~GEiKK~iltl~n~~l~~~G~L~mH~sanvg~~G~valfFGLSGTGKTTLsad~~r~  357 (563)
                      +.|+++|++|+++++++|+||+|+|||||++||+||++++++|+|+||||++++++|++++||||||||||||++++++.
T Consensus       161 ~~s~~~I~~~~~~~~i~i~Gt~Y~Ge~KK~~l~~~~~l~~~~g~L~~H~s~~~~~~g~~~~~~GlSGtGKTTLa~~~~~~  240 (515)
T cd01919         161 LPSLTLVAHNPDRREQIIFGTGYGGEMKKGFLRMMSRLAPEEGWLAMHMSANVGTNGDVLVFFGLSGTGKTTLSMDPKRE  240 (515)
T ss_pred             CCCCcEEEEEcccCEEEEecCccccchHHHHHHHHHHHHHhcCceeeeceeeccCCCCEEEEEecccCCCcccccCCCcC
Confidence            99999999999999999999999999999999999999999999999999998999999999999999999999999999


Q ss_pred             eeecCceeecCCCccccCCceeEeecCCCCCCCchhhhhccccceeeeeEEcCCCCcccCCCCCcccceeEEEecccccC
Q 008523          358 LIGDDEHCWGDNGVSNIEGGCYAKCIDLSREKEPDIWNAIKFGAVLENVVFDEHTREVDYSDKSVTENTRAAYPIEYIPN  437 (563)
Q Consensus       358 lIgDDe~~w~~~Gvfn~EgGcyaK~~dLs~e~EP~I~~ai~f~ailENV~~d~~~~~vdf~d~s~t~NtR~~yPi~~i~N  437 (563)
                      ||+||+|+|+++|+||+|+|||+||+||+++.||+||++++|++|+|||.+|++ +.|+|+|.++|+|+|++||+++|+|
T Consensus       241 ligDD~~~w~~~gv~N~EgGcyak~~gls~e~eP~i~~ai~~~aileNV~~d~~-g~v~~~~~s~t~NtR~~yP~~~i~n  319 (515)
T cd01919         241 LIGDDEHWWKDDGVFNPEGGCYAKAIGLSVKTEPNIYKAIRKNAIFENVAETSD-GGIDFEDISAHPNTRVCYPASHIPI  319 (515)
T ss_pred             eecccEEEEeCCCEEecCCceEEEecCCCcccCHHHHHHhcCCcEEEeeeEcCC-CCEeCCCCCCCchheEEeEHHhCCC
Confidence            999999999999999999999999999999999999999999999999999995 6889999999999999999999999


Q ss_pred             CcCC-CCCCCcceEEEEEeccCCCCCCeeecCHHHHHHHHHcccccccccccCCccCccccccccccCCCccCChHHHHH
Q 008523          438 AKIP-CVGPHPKNVILLACDAFGVLPPVSKLNLAQTMYHFISGYTALVAGTEDGIKEPTATFSACFGAAFIMLHPTKYAA  516 (563)
Q Consensus       438 ~~~~-~~~g~P~~iIflt~Da~gvLPPVskLt~eQA~~~FlsGyTak~aGtE~Gv~ep~atFs~cFg~PF~p~~p~~yae  516 (563)
                      +..+ ..+++|++||||+||+|||||||+||+++||||||+||||+|+||||+|+++|++|||+||++|||++||.+||+
T Consensus       320 ~~~~~~~g~~~~~IiFltrda~gvlPpV~~lt~eqavy~f~sg~T~ktAgteag~~~p~~~fs~cf~~PFl~~~p~~Ya~  399 (515)
T cd01919         320 IDAAWESAGHIEGVIFLTRDAFGVVPPVYRLTWQQGVFVFAAGRTAATAGTEAGHKGKIPMFSPCFGRPFLGYHFTKYLE  399 (515)
T ss_pred             CCCccccCCCccEEEEEecCCCCCCCcEEEccHHHHHHHHHhhhhhhhcchhcccccCceeecccccCCcccCCHHHHHH
Confidence            9766 447899999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHcCCEEEEEeccccCCcccccccchHHh
Q 008523          517 MLAEKMQKHGATGWLVNTGWSGGRCVLKMVNLYAD  551 (563)
Q Consensus       517 ~L~~kl~~~~v~v~LiNTGw~gg~yg~G~r~~~~~  551 (563)
                      +|.+++++++++||||||||+||+ |+|+||.+.+
T Consensus       400 ~l~e~~~~~~~~i~lvNtg~~gg~-G~g~r~~~~~  433 (515)
T cd01919         400 HLLSMMQHPLPKIFLVNTGRKGKE-GKFKRPGFGE  433 (515)
T ss_pred             HHHHHHhhcCCcEEEEeccccCCC-CCcccCCHHH
Confidence            999999999999999999999999 9999999843


No 9  
>cd00819 PEPCK_GTP Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis. It catalyzes the reversible decarboxylation and phosphorylation of oxaloacetate to yield phosphoenolpyruvate and carbon dioxide, using a nucleotide molecule (GTP) for the phosphoryl transfer, and has a strict requirement for divalent metal ions for activity. PEPCK's separate into two phylogenetic groups based on their nucleotide substrate specificity, this model describes the GTP-dependent group.
Probab=99.96  E-value=2.3e-27  Score=257.61  Aligned_cols=376  Identities=18%  Similarity=0.233  Sum_probs=266.7

Q ss_pred             cceeEecC-CHHH---HHHHHHhccCCeEEec-cCceEEecCC-cccCCCCCeeeecCCCccc--cccccC---cCcc--
Q 008523          141 FTHVLYNL-SPAE---LYEQAIKYEQGSFIAS-SGALATLSGA-KTGRSPRDKRVVKDETTEH--ELWWGK---MKNH--  207 (563)
Q Consensus       141 ~~~v~~Nl-s~~e---L~e~A~~~~~Gt~~t~-~GaL~~~tG~-~TGRSpkdk~IV~d~~~~~--~i~wg~---~~e~--  207 (563)
                      +.+|++.- |.+|   |.+++++.++-.-+.. -|..++.|.. =+.|.=...||.-+...+.  ...|-.   +.++  
T Consensus        14 Pd~v~~cdGS~ee~~~l~~~~v~~G~~~~L~~~~~~~l~rs~p~DvARve~rTfI~s~~~~dagp~nnw~~p~e~~~~l~   93 (579)
T cd00819          14 PDSVYICDGSEEEYDRLRDLMVEQGEEIRLNKYPNSYLARSDPSDVARVESRTFICSEDEEDAGPTNNWMDPEEMKAELK   93 (579)
T ss_pred             CCEEEEcCCCHHHHHHHHHHHHhcCcEeeCCCCCCCEEEeCCccccceeccceEEecCchhccCCccccCCHHHHHHHHH
Confidence            67898876 4333   6677775533221211 2333333322 2444444557776543322  234532   1111  


Q ss_pred             --------cccEEEEEeeecC-CCCCeeEEEEEcccccHHHHHhccCcCCChHhhccCCCCCEE--EEEcCC--------
Q 008523          208 --------DVQVFVNDQFLNW-DPQNRVKVRIVSARAYHSLFMHNMCIRPTPEELENFGTPDFT--IYNAGQ--------  268 (563)
Q Consensus       208 --------~~~lyv~d~~~G~-d~~~~i~vrvit~~a~~alf~~Nlf~rp~~~el~~~~~pd~t--I~~~p~--------  268 (563)
                              -|.|||.....|- ...+......||+++|..+.|+=|. |--...++..+..+|+  |++...        
T Consensus        94 ~lf~G~M~GRTMYVipfsmGP~gSp~s~~gVqiTDS~YVv~sm~imt-R~g~~vl~~lg~~~Fv~~vHSvG~pl~~~~~~  172 (579)
T cd00819          94 ELFKGCMRGRTMYVIPFSMGPLGSPISKIGVELTDSPYVVHSMRIMT-RMGKAVLDALGEGEFVPCLHSVGAPLSAGQKD  172 (579)
T ss_pred             hhCCcccCCCeEEEEeeecCCCCCCcccceEEEeCCHHHHHhHHHHH-hcCHHHHHhcCcCCeeeeeccCCCcCCCCCCC
Confidence                    1899997766665 8888899999999999999887654 4455666665445674  444332        


Q ss_pred             -CCCCccccCCCCccEEEEecCCCeEEEEccccchhh---HHHH-HHHHHHhcccCceeeecccc-ee-cCCCCEEEEEe
Q 008523          269 -FPCNRYTHYMTSSTSIDLNLARREMVILGTQYAGEM---KKGL-FSVMHYLMPKRQILSLHSGC-NM-GKDGDVALFFG  341 (563)
Q Consensus       269 -f~~~~~~~g~~s~~~i~id~~~~~i~I~Gt~Y~GEi---KK~i-ltl~n~~l~~~G~L~mH~sa-nv-g~~G~valfFG  341 (563)
                       |++|+      .++.|+.+++.++|+..|+.|.|+-   ||.. |+++.+++.++|||++|+-. .+ +++|++..|.|
T Consensus       173 ~wpcn~------~~~~I~h~pe~~~I~S~gSgYGGNaLlgKKcfaLRiAs~~ar~eGWLAEHMlIlgvt~P~G~~~yvaa  246 (579)
T cd00819         173 VWPCNP------EKKYIVHFPEEREIWSFGSGYGGNALLGKKCFALRIASVMARDEGWLAEHMLILGVTNPEGEKKYFAA  246 (579)
T ss_pred             CCCCCC------CccEEEEEcCCCeEEEecCCcCCCcccchhHHHHHHHHHHhHhcCcHHHhhHHheeeCCCCCEEEEEE
Confidence             33322      2478999999999999999999995   9987 99999999999999999953 22 47788766666


Q ss_pred             --cCCCCcccccc-cC---C--CceeecCc-ee-ecCCCcc---ccCCceeEeecCCCCCCCchhhhhccccceeeeeEE
Q 008523          342 --LSGTGKTTLST-DH---N--RYLIGDDE-HC-WGDNGVS---NIEGGCYAKCIDLSREKEPDIWNAIKFGAVLENVVF  408 (563)
Q Consensus       342 --LSGTGKTTLsa-d~---~--r~lIgDDe-~~-w~~~Gvf---n~EgGcyaK~~dLs~e~EP~I~~ai~f~ailENV~~  408 (563)
                        +|+||||+|++ .|   +  -.+||||. -+ +.+||..   |.|.|+|..+.+.+.+..|.++++++-.+|+.||.+
T Consensus       247 AFPSaCGKTnlAMl~p~~~gwkv~~vGDDIAwm~~~~dG~l~AINPE~GfFGVapGtn~~tnP~am~~l~~n~IFTNVa~  326 (579)
T cd00819         247 AFPSACGKTNLAMLIPPLPGWKVETVGDDIAWMKFGEDGRLYAINPEAGFFGVAPGTNAKTNPNAMATLHKNTIFTNVAL  326 (579)
T ss_pred             EcccccccccHhhcCCCCCCceeEEeccceeeeEECCCCcEEEEcCCCCeeEeCCCCCCCcCHHHHHHhcCCceEEEEeE
Confidence              99999999998 33   2  34899993 33 3367853   999999999999999999999999999999999999


Q ss_pred             cCCCCcccCCCCC-------------------------cccceeEEEecccccCCc--CCCCCCCcceEEEEE-eccCCC
Q 008523          409 DEHTREVDYSDKS-------------------------VTENTRAAYPIEYIPNAK--IPCVGPHPKNVILLA-CDAFGV  460 (563)
Q Consensus       409 d~~~~~vdf~d~s-------------------------~t~NtR~~yPi~~i~N~~--~~~~~g~P~~iIflt-~Da~gv  460 (563)
                      +++| .|-+.+..                         .++|+|++.|+...|++.  .+...|+|++.|++. +| ...
T Consensus       327 t~DG-~vwWeG~~~e~p~~~~~w~~~G~~w~~~~~~paAHPNsRFt~p~~q~p~idp~wedP~GVpI~aiiFGGRr-~~t  404 (579)
T cd00819         327 TEDG-DVWWEGLTEEPPEHLTDWQGLGKRWTPGDGEPAAHPNSRFTAPASQCPNIDPEWENPEGVPIDAIIFGGRR-PDT  404 (579)
T ss_pred             cCCC-CeeCCCCCCCCCCceeeccCCCCCCCCCCCCcCCCCcccccccHHHCCcCCccccCCCCCEEEEEEECCcC-CCC
Confidence            8864 67665443                         399999999999999985  446679997777766 66 478


Q ss_pred             CCCeeec-CHHHHHHHHHccccc--c----cccccCCccCccccccccccCCCccCChHHHHHH---HHHHHHHcCCEEE
Q 008523          461 LPPVSKL-NLAQTMYHFISGYTA--L----VAGTEDGIKEPTATFSACFGAAFIMLHPTKYAAM---LAEKMQKHGATGW  530 (563)
Q Consensus       461 LPPVskL-t~eQA~~~FlsGyTa--k----~aGtE~Gv~ep~atFs~cFg~PF~p~~p~~yae~---L~~kl~~~~v~v~  530 (563)
                      +|+|.+. +.+++++   .|.+-  .    ..|+ .|+..    +-|+.-.||+..+..+|-+-   +++++...--++|
T Consensus       405 vPlV~ea~~W~hGV~---~GA~m~SE~TAAa~g~-~g~~r----~dPmAmlPF~gy~~gdY~~hwL~~g~~~~~~~PkIF  476 (579)
T cd00819         405 VPLVYEAFNWNHGVF---IGASMGSETTAAAEGK-VGVVR----RDPFAMLPFCGYNMGDYFRHWLSFGRKLGAKLPKIF  476 (579)
T ss_pred             CCeEEEccCccccee---eechhhhHHHHHhhcC-CCcEE----eCcccccccCCCCHHHHHHHHHHHhccccCCCCcEE
Confidence            9999987 6787776   67662  2    2222 24433    56789999999999999887   4456533334455


Q ss_pred             EEe
Q 008523          531 LVN  533 (563)
Q Consensus       531 LiN  533 (563)
                      -||
T Consensus       477 ~VN  479 (579)
T cd00819         477 GVN  479 (579)
T ss_pred             EEe
Confidence            555


No 10 
>PRK04210 phosphoenolpyruvate carboxykinase; Provisional
Probab=99.96  E-value=3.7e-27  Score=256.46  Aligned_cols=401  Identities=17%  Similarity=0.198  Sum_probs=274.5

Q ss_pred             cceeEecC-CHH---HHHHHHHhccCCeEEec---cCceEEecCCc-ccCCCCCeeeecCCCccc--cccccC---cCcc
Q 008523          141 FTHVLYNL-SPA---ELYEQAIKYEQGSFIAS---SGALATLSGAK-TGRSPRDKRVVKDETTEH--ELWWGK---MKNH  207 (563)
Q Consensus       141 ~~~v~~Nl-s~~---eL~e~A~~~~~Gt~~t~---~GaL~~~tG~~-TGRSpkdk~IV~d~~~~~--~i~wg~---~~e~  207 (563)
                      +.+|++.- |.+   .|.+++++.++-.-+..   .+...+.|... +.|.=...||.-+...+.  ...|-.   +.++
T Consensus        26 Pd~v~~cdGS~ee~~~l~~~~v~~G~~~~L~~~k~~~~~~~rsdp~DvARve~rTfI~s~~~~dagp~nnw~~p~e~~~~  105 (601)
T PRK04210         26 PDRVVWCDGSEEEYDRLRDQAVEAGTEIKLNPEKRPNSFLARSDPSDVARVEDRTFICSEKEEDAGPTNNWMDPAEMRET  105 (601)
T ss_pred             CCEEEEeCCCHHHHHHHHHHHHHcCCEeeccCCCCCceeeccCChhhhhhcccceEEecCchhhcCCccCcCCHHHHHHH
Confidence            67999877 444   47777876533211211   12222222221 244444457766543221  233633   2111


Q ss_pred             ----------cccEEEEEeeecC-CCCCeeEEEEEcccccHHHHHhccCcCCChHhhccCC-CCCEE--EEEcCCCCCC-
Q 008523          208 ----------DVQVFVNDQFLNW-DPQNRVKVRIVSARAYHSLFMHNMCIRPTPEELENFG-TPDFT--IYNAGQFPCN-  272 (563)
Q Consensus       208 ----------~~~lyv~d~~~G~-d~~~~i~vrvit~~a~~alf~~Nlf~rp~~~el~~~~-~pd~t--I~~~p~f~~~-  272 (563)
                                -|.|||.....|- ...+......||+++|..+.|+=| .|--.+.++..+ ..+|+  |++...-... 
T Consensus       106 l~~lf~G~M~GRTMyVipfsmGP~gSp~s~~gVqiTDS~YVv~sm~im-tR~g~~~l~~l~~~~~Fv~~vHSvG~p~~~~  184 (601)
T PRK04210        106 LKGLFKGCMRGRTMYVVPFSMGPLGSPFAKIGVEITDSPYVVHSMRIM-TRMGKAVLDVLGEDGEFVPCVHSVGAPLEPG  184 (601)
T ss_pred             HHHhcCCccCCCeEEEeeeeeCCCCCCcccceEEeeCCHHHHHhHHHH-HhccHHHHHhhCCCCceeeeeccCCCCCCCC
Confidence                      1899997766665 888899999999999999998765 455566665554 35674  4444321111 


Q ss_pred             ----ccccCCCCccEEEEec-CCCeEEEEccccchhh----HHHHHHHHHHhcccCceeeecccc-ee-cCCCCEEEEEe
Q 008523          273 ----RYTHYMTSSTSIDLNL-ARREMVILGTQYAGEM----KKGLFSVMHYLMPKRQILSLHSGC-NM-GKDGDVALFFG  341 (563)
Q Consensus       273 ----~~~~g~~s~~~i~id~-~~~~i~I~Gt~Y~GEi----KK~iltl~n~~l~~~G~L~mH~sa-nv-g~~G~valfFG  341 (563)
                          +++.  + +..+|+++ +.++|+..|+.|.|+-    ||-.|+++.+++.++|||+.|+-. .+ +++|++..|.|
T Consensus       185 ~~~v~wpc--n-~~r~i~h~pe~~~I~S~gSgYgGNaLLGkKc~ALRiAs~~ar~eGWLAEHMlIlgvt~P~G~~~yvaa  261 (601)
T PRK04210        185 QKDVPWPC--N-DTKYIVHFPETREIWSYGSGYGGNALLGKKCFALRIASVMARDEGWLAEHMLILGVTSPEGRKTYFAA  261 (601)
T ss_pred             CCCCCCCC--C-CCeEEEEeCCCcEEEEecCCCCCCccchhHHHHHHHHHHHhHhcccHHHhhHHheeeCCCCCEEEEEE
Confidence                1111  1 23455665 6669999999999983    999999999999999999999963 22 47888877777


Q ss_pred             --cCCCCccccccc-C---CC--ceeecCc-eeec-CCCcc---ccCCceeEeecCCCCCCCchhhhhccc-cceeeeeE
Q 008523          342 --LSGTGKTTLSTD-H---NR--YLIGDDE-HCWG-DNGVS---NIEGGCYAKCIDLSREKEPDIWNAIKF-GAVLENVV  407 (563)
Q Consensus       342 --LSGTGKTTLsad-~---~r--~lIgDDe-~~w~-~~Gvf---n~EgGcyaK~~dLs~e~EP~I~~ai~f-~ailENV~  407 (563)
                        +|+||||+|++- |   +-  ..||||. -++. .||..   |.|.|+|..+.+.+.+..|.+|++++. .+|+.||.
T Consensus       262 AFPSaCGKTnlAMl~p~~~gwkv~~VGDDIAwm~~~~dG~l~AiNPE~GfFGVapGtn~~tnP~am~~l~~~n~IFTNVa  341 (601)
T PRK04210        262 AFPSACGKTNLAMLIPPIPGWKVETVGDDIAWIRPGEDGRLYAINPEAGFFGVAPGTNEKTNPNAMATLKPGNVIFTNVA  341 (601)
T ss_pred             ecccccccccHhhcCCCCCCceeEEeecceeeeeECCCCcEEEEccCCCeeEeCCCCCCCcCHHHHHhcccCCeEEeeeE
Confidence              999999999982 2   21  3799993 4444 78954   899999999999999999999999987 89999999


Q ss_pred             EcCCCCcccCCCC-----------------------CcccceeEEEecccccCCc--CCCCCCCcceEEEEE-eccCCCC
Q 008523          408 FDEHTREVDYSDK-----------------------SVTENTRAAYPIEYIPNAK--IPCVGPHPKNVILLA-CDAFGVL  461 (563)
Q Consensus       408 ~d~~~~~vdf~d~-----------------------s~t~NtR~~yPi~~i~N~~--~~~~~g~P~~iIflt-~Da~gvL  461 (563)
                      ++++| .|-+.+.                       ..++|+|++.|+...||+.  .+...|+|++.|++. +| ..++
T Consensus       342 lt~DG-~vwWeG~~~~~P~~~~dw~G~~W~p~~~~paaHPNsRFt~p~~q~p~idp~wedP~GVpIsaiiFGGRr-~~t~  419 (601)
T PRK04210        342 LTDDG-DVWWEGMTEEPPAHLIDWQGNDWTPGSGEPAAHPNARFTVPASQCPNLDPEWEDPAGVPISAIIFGGRR-SDTV  419 (601)
T ss_pred             ECCCC-CeecCCCCCCCCCcccccCCCcCCCCCCCCCCCCccceeccHHHCCcCCccccCCCCCEEEEEEECCcC-CCCC
Confidence            98864 5544432                       2899999999999999985  446779997777766 66 4789


Q ss_pred             CCeeec-CHHHHHHHHHcccc--cccccccCCccCccccccccccCCCccCChHHHHHH---HHHHHHHcCCEEEEEe--
Q 008523          462 PPVSKL-NLAQTMYHFISGYT--ALVAGTEDGIKEPTATFSACFGAAFIMLHPTKYAAM---LAEKMQKHGATGWLVN--  533 (563)
Q Consensus       462 PPVskL-t~eQA~~~FlsGyT--ak~aGtE~Gv~ep~atFs~cFg~PF~p~~p~~yae~---L~~kl~~~~v~v~LiN--  533 (563)
                      |+|.+. +.+..++   .|.|  |..|....|. ..+-.+.|+.-.||+..+..+|.+-   +++++...--++|-||  
T Consensus       420 PlV~ea~~W~hGV~---~GAtm~SE~TAAa~G~-~g~~r~dPmAmlpF~gy~~gdY~~hwl~~g~~~~~~~PkIF~VNwF  495 (601)
T PRK04210        420 PLVTEAFDWQHGVY---MGATMGSETTAAAEGK-VGVVRRDPMAMLPFCGYNMGDYFQHWLDFGKKLGSKLPKIFGVNWF  495 (601)
T ss_pred             CeeEEccCccchhe---eecchhhHHHHHHhcc-CCcEeeCcchhccccCCCHHHHHHHHHHHhcccCCCCCcEEEeeee
Confidence            999987 7888887   6777  2222222222 1122366789999999999999987   4445522234444444  


Q ss_pred             ----cc---ccCCcccccccchHHhHhc
Q 008523          534 ----TG---WSGGRCVLKMVNLYADILG  554 (563)
Q Consensus       534 ----TG---w~gg~yg~G~r~~~~~~l~  554 (563)
                          .|   |-  .||...|. +.|++.
T Consensus       496 rkd~~G~flWP--GfgeN~RV-L~Wi~~  520 (601)
T PRK04210        496 RKDEDGKFLWP--GFGENMRV-LKWIVD  520 (601)
T ss_pred             eecCCCCCcCC--CCcchhHH-HHHHHH
Confidence                22   33  47888888 888775


No 11 
>PF00821 PEPCK:  Phosphoenolpyruvate carboxykinase;  InterPro: IPR008209  Phosphoenolpyruvate carboxykinase (PEPCK) catalyses the first committed (rate-limiting) step in hepatic gluconeogenesis, namely the reversible decarboxylation of oxaloacetate to phosphoenolpyruvate (PEP) and carbon dioxide, using either ATP or GTP as a source of phosphate. The ATP-utilising (4.1.1.49 from EC) and GTP-utilising (4.1.1.32 from EC) enzymes form two divergent subfamilies, which have little sequence similarity but which retain conserved active site residues. ATP-utilising PEPCKs are monomers or oligomers of identical subunits found in certain bacteria, yeast, trypanosomatids, and plants, while GTP-utilising PEPCKs are mainly monomers found in animals and some bacteria []. Both require divalent cations for activity, such as magnesium or manganese. One cation interacts with the enzyme at metal binding site 1 to elicit activation, while the second cation interacts at metal binding site 2 to serve as a metal-nucleotide substrate. In bacteria, fungi and plants, PEPCK is involved in the glyoxylate bypass, an alternative to the tricarboxylic acid cycle.  PEPCK helps to regulate blood glucose levels. The rate of gluconeogenesis can be controlled through transcriptional regulation of the PEPCK gene by cAMP (the mediator of glucagon and catecholamines), glucocorticoids and insulin. In general, PEPCK expression is induced by glucagon, catecholamines and glucocorticoids during periods of fasting and in response to stress, but is inhibited by (glucose-induced) insulin upon feeding []. With type II diabetes, this regulation system can fail, resulting in increased gluconeogenesis that in turn raises glucose levels []. PEPCK consists of an N-terminal and a catalytic C-terminal domain, with the active site and metal ions located in a cleft between them. Both domains have an alpha/beta topology that is partly similar to one another [, ]. Substrate binding causes PEPCK to undergo a conformational change, which accelerates catalysis by forcing bulk solvent molecules out of the active site []. PCK uses an alpha/beta/alpha motif for nucleotide binding, this motif differing from other kinase domains. GTP-utilising PEPCK has a PEP-binding domain and two kinase motifs to bind GTP and magnesium. This entry represents GTP-utilising phosphoenolpyruvate carboxykinase enzymes.; GO: 0004611 phosphoenolpyruvate carboxykinase activity, 0005525 GTP binding, 0006094 gluconeogenesis; PDB: 2FAH_A 2FAF_A 2QZY_B 2ZCI_D 3MOE_A 3DT7_B 2RKD_A 2RKA_A 2RK8_A 2QF2_B ....
Probab=99.94  E-value=6.8e-26  Score=247.18  Aligned_cols=400  Identities=17%  Similarity=0.195  Sum_probs=251.6

Q ss_pred             cceeEecC-CHH---HHHHHHHhccCCeEEeccC----ceEEecCCcccCCCCCeeeecCCCcc--ccccccC---c---
Q 008523          141 FTHVLYNL-SPA---ELYEQAIKYEQGSFIASSG----ALATLSGAKTGRSPRDKRVVKDETTE--HELWWGK---M---  204 (563)
Q Consensus       141 ~~~v~~Nl-s~~---eL~e~A~~~~~Gt~~t~~G----aL~~~tG~~TGRSpkdk~IV~d~~~~--~~i~wg~---~---  204 (563)
                      +..|++.- |.+   +|.+++++.++-..+...+    -|+...-.=..|.-...||+-+...+  -...|-.   +   
T Consensus        12 P~~I~icdGS~eE~~~l~~~~~~~G~~~~L~~~~~~n~~l~~sdp~DvARve~~TfI~t~~~~d~~p~~nw~~~~~~~~~   91 (586)
T PF00821_consen   12 PDSIYICDGSEEENDRLRDELVEQGEEIPLNPPKHPNCYLHRSDPSDVARVESRTFICTEDKEDAGPTNNWMDPEEMKAE   91 (586)
T ss_dssp             BSEEEE----HHHHHHHHHHHHHTTSEEEE-TTTSBSEEEE---TTSSS--GGGEEEE-SSHHHHSTTSSEE-HHHHHHH
T ss_pred             CCEEEEcCCCHHHHHHHHHHHHHcCCEEeCCCCCCCCcEEEecCccccceecCceEEEcCCccccCCccCCCCHHHHHHH
Confidence            56777754 443   4777776543222121111    23322223356666666877654332  2223533   1   


Q ss_pred             -Ccc------cccEEEEEeeecC-CCCCeeEEEEEcccccHHHHHhccCcCCChHhhccCC-CCCEE--EEEcCC-----
Q 008523          205 -KNH------DVQVFVNDQFLNW-DPQNRVKVRIVSARAYHSLFMHNMCIRPTPEELENFG-TPDFT--IYNAGQ-----  268 (563)
Q Consensus       205 -~e~------~~~lyv~d~~~G~-d~~~~i~vrvit~~a~~alf~~Nlf~rp~~~el~~~~-~pd~t--I~~~p~-----  268 (563)
                       .+.      -|.|||.....|- ...+......+|+++|..+.|+=| .|-..+.++..+ ..+|+  |++...     
T Consensus        92 l~~~f~G~M~GRtMyVipfsmGP~gsp~s~~gVqlTDS~YVv~sm~im-tR~g~~v~~~l~~~~~Fv~~vHSvG~pl~~~  170 (586)
T PF00821_consen   92 LDELFPGCMKGRTMYVIPFSMGPIGSPFSKIGVQLTDSPYVVHSMRIM-TRMGYAVLDRLGDDGEFVRCVHSVGAPLPPG  170 (586)
T ss_dssp             HHCCSTTTTTTSEEEEEEEEESSTTSTT-EEEEEEES-HHHHHHHHHH-SEESHHHHHHHTTT--SEEEEEE-S--SSTS
T ss_pred             HHHhchhhhhhchHHhhHhhhCCCCCCCccceEEccCcHHHHHhHHHH-HhcCHHHHHHhCCCCceEeeecccCCcCCCC
Confidence             111      1899998777776 888999999999999999998765 455555554443 33564  555442     


Q ss_pred             -----CCCCccccCCCCccEEEEecCCCeEEEEccccchh---hHH-HHHHHHHHhcccCceeeecccc-ee-cCCCCEE
Q 008523          269 -----FPCNRYTHYMTSSTSIDLNLARREMVILGTQYAGE---MKK-GLFSVMHYLMPKRQILSLHSGC-NM-GKDGDVA  337 (563)
Q Consensus       269 -----f~~~~~~~g~~s~~~i~id~~~~~i~I~Gt~Y~GE---iKK-~iltl~n~~l~~~G~L~mH~sa-nv-g~~G~va  337 (563)
                           |++|+      .+++|+.+++++.|+..|+.|.|+   .|| ..|+++.+++.++|||+.|+-. .+ +++|++.
T Consensus       171 ~~~~~wpcn~------~~~~I~h~p~~~~I~S~gsgYGGNaLlgKKc~aLRiAs~~ar~eGWLAEHMlIlgit~P~G~~~  244 (586)
T PF00821_consen  171 QKDVNWPCNP------DKRYIVHFPEEREIWSFGSGYGGNALLGKKCFALRIASVIARDEGWLAEHMLILGITNPEGRKT  244 (586)
T ss_dssp             S--BTB---G------GG-EEEEECCCTEEEEES--SHHHHSTCCCCCCCHHHHHHHHHHT-EEESEEEEEEE-TTS-EE
T ss_pred             CCCCCCCCCc------cceEEEEECCCCeEEEeCCCcCcchhhhhhhhhHHHHHHHHHhhhHHhhhhheeeEecCCCCEE
Confidence                 23332      368999999999999999999998   899 8999999999999999999964 22 5889998


Q ss_pred             EEEe--cCCCCcccccc-cC---CC--ceeecC-ceee-cCCCc---cccCCceeEeecCCCCCCCchhhhhccccceee
Q 008523          338 LFFG--LSGTGKTTLST-DH---NR--YLIGDD-EHCW-GDNGV---SNIEGGCYAKCIDLSREKEPDIWNAIKFGAVLE  404 (563)
Q Consensus       338 lfFG--LSGTGKTTLsa-d~---~r--~lIgDD-e~~w-~~~Gv---fn~EgGcyaK~~dLs~e~EP~I~~ai~f~ailE  404 (563)
                      .|.|  +|+||||+|++ .|   +=  ..|||| +-+| +.||.   .|.|.|+|.-..+.+.+..|.+++++.-++|+-
T Consensus       245 yiaaAFPSaCGKTnlAMl~p~~pGwkve~VGDDIAWmr~~~dG~lrAiNPE~GfFGVapGtn~~tnP~am~~l~~ntIFT  324 (586)
T PF00821_consen  245 YIAAAFPSACGKTNLAMLQPTLPGWKVETVGDDIAWMRFGEDGRLRAINPENGFFGVAPGTNMKTNPNAMATLGKNTIFT  324 (586)
T ss_dssp             EEEEE-TTTSSHHHHHT---SSTT-EEEEEESS-EEEEE-TTSBEEEE---SEEEEE-TT-STTT-HHHHHHTTBSEEEE
T ss_pred             EEEEecCcccccccHHhcCCCCCCcEEEEeeccchheeEcCCCcEEEeecccceEEeccCCCCCCCHHHHHHhhccceEe
Confidence            8887  99999999998 33   21  379999 4454 48995   499999999999999999999999999999999


Q ss_pred             eeEEcCCCCcc--------------cCCCC---------CcccceeEEEecccccCCc--CCCCCCCcceEEEEE-eccC
Q 008523          405 NVVFDEHTREV--------------DYSDK---------SVTENTRAAYPIEYIPNAK--IPCVGPHPKNVILLA-CDAF  458 (563)
Q Consensus       405 NV~~d~~~~~v--------------df~d~---------s~t~NtR~~yPi~~i~N~~--~~~~~g~P~~iIflt-~Da~  458 (563)
                      ||.++++| .|              ||.+.         ..++|+|.+.|+...||+.  .+...|+|++.|++. +|+ 
T Consensus       325 NVa~t~dG-~vwWeG~~~~~p~~~~dw~G~~W~~~~~~paaHPNsRft~pa~qcp~i~p~wedp~GVpIsaiiFGGRr~-  402 (586)
T PF00821_consen  325 NVALTDDG-DVWWEGMDEEPPEHLIDWQGEPWTPESGEPAAHPNSRFTAPASQCPNIDPEWEDPKGVPISAIIFGGRRS-  402 (586)
T ss_dssp             S-EEETTS--EE-TT-SS---T-EE-TTSSEE-TTSSS-SS-TT-EEEEEGGGSTTB-TTTT-TT-EEEEEEEEEEBBS-
T ss_pred             eeeecCCC-ceeeccCCCCCCcccccCCCCcCCCCCCCCCCCCcccccCCHhHCCCCCccccCCCcceEEEEEEeccCC-
Confidence            99999874 54              34333         2689999999999999985  346679996666655 765 


Q ss_pred             CCCCCeeec-CHHHHHHHHHcccc--cccccccCCccCccccccccccCCCccCChHHHHHHHHH---HHHHcCCEEEEE
Q 008523          459 GVLPPVSKL-NLAQTMYHFISGYT--ALVAGTEDGIKEPTATFSACFGAAFIMLHPTKYAAMLAE---KMQKHGATGWLV  532 (563)
Q Consensus       459 gvLPPVskL-t~eQA~~~FlsGyT--ak~aGtE~Gv~ep~atFs~cFg~PF~p~~p~~yae~L~~---kl~~~~v~v~Li  532 (563)
                      ..+|+|..- +.+..++   .|.|  |..|....|... +..+.|+.-.||+..+..+|.+--.+   ++.++--++|-|
T Consensus       403 ~tvPlV~ea~~W~HGV~---~gAtm~SE~TAAa~g~~g-~~~~dPmAmlpF~gy~~gdY~~hwL~~~~~~~~k~PkIF~V  478 (586)
T PF00821_consen  403 DTVPLVYEAFNWQHGVF---LGATMRSEATAAAEGKVG-VVRRDPMAMLPFCGYNMGDYLQHWLSMGKKLGRKLPKIFHV  478 (586)
T ss_dssp             SSS-SEEE-SSHHHHHH---HHHT-EEEE-TTSSS-TT-EEEE-GGGTTTT-SS-HHHHHHHHHHHGGSTTGBS-EEEEE
T ss_pred             CCCCceEEccCCCceeE---EeeeecccccchhccCCC-ceecCCccccccCcCCHHHHHHHHHHhhcccccCCCcEEEE
Confidence            688999875 8999998   6777  333333333322 23467889999999999999887433   343445678888


Q ss_pred             e---ccccCC----cccccccchHHhHhc
Q 008523          533 N---TGWSGG----RCVLKMVNLYADILG  554 (563)
Q Consensus       533 N---TGw~gg----~yg~G~r~~~~~~l~  554 (563)
                      |   .+-.|.    .||...|+ +.|++.
T Consensus       479 NwFrk~~~G~flWPGfgen~RV-L~Wi~~  506 (586)
T PF00821_consen  479 NWFRKDEDGKFLWPGFGENSRV-LKWIER  506 (586)
T ss_dssp             EST-B-TTSSBSS--GGGHHHH-HHHHHH
T ss_pred             EeeEEcCCCccccCCCcccHHH-HHHHHH
Confidence            8   332222    57788999 888875


No 12 
>COG1274 PckA Phosphoenolpyruvate carboxykinase (GTP) [Energy production and conversion]
Probab=99.87  E-value=7.3e-21  Score=202.92  Aligned_cols=315  Identities=19%  Similarity=0.220  Sum_probs=231.6

Q ss_pred             ccEEEEEeeecC-CCCCeeEEEEEcccccHHHHHhccCcCCChHhhccCC-CCCEE--EEEcCCCCCCccccC---CCCc
Q 008523          209 VQVFVNDQFLNW-DPQNRVKVRIVSARAYHSLFMHNMCIRPTPEELENFG-TPDFT--IYNAGQFPCNRYTHY---MTSS  281 (563)
Q Consensus       209 ~~lyv~d~~~G~-d~~~~i~vrvit~~a~~alf~~Nlf~rp~~~el~~~~-~pd~t--I~~~p~f~~~~~~~g---~~s~  281 (563)
                      |.|||+....|- +..|.+....+|+++|..+.|+-| .|--.++++..| ...|+  |.++..-.+....+-   .+.-
T Consensus       124 rtmyVvpf~mGP~~Spf~~~gVeiTDS~YVv~sm~im-tRmG~~vl~~lG~~g~Fvk~vHSvG~pL~pg~~dv~wPcn~~  202 (608)
T COG1274         124 RTMYVVPFCMGPLNSPFTILGVELTDSPYVVHSMRIM-TRMGKEVLEKLGDDGNFVKCVHSVGKPLDPGQKDVAWPCNET  202 (608)
T ss_pred             ceEEEEeeeeCCCCCCcccceeEeecCceeeeehHHH-HHHHHHHHHhcCCCCceeeeeeccCCCCCCCcccCcCCcccc
Confidence            899998777776 888999999999999998876644 344556666664 23364  554443111111110   0001


Q ss_pred             cEEEEecCCCeEEEEccccchh---hHH-HHHHHHHHhcccCceeeecccc-ee-cCCCCEEEEEe--cCCCCcccccc-
Q 008523          282 TSIDLNLARREMVILGTQYAGE---MKK-GLFSVMHYLMPKRQILSLHSGC-NM-GKDGDVALFFG--LSGTGKTTLST-  352 (563)
Q Consensus       282 ~~i~id~~~~~i~I~Gt~Y~GE---iKK-~iltl~n~~l~~~G~L~mH~sa-nv-g~~G~valfFG--LSGTGKTTLsa-  352 (563)
                      -.|..-++.+.|+..|+.|.|+   .|| -.|+++.+.+.++|||+.|+-. .+ +++|+...|.|  +|+||||.|++ 
T Consensus       203 k~i~hfped~~v~S~gsgYGGNall~KKC~ALRias~~A~~EGWLAEHMlil~v~~PeGk~~yftaAFPSacGKTnlAMi  282 (608)
T COG1274         203 KYIRHFPEDREVWSFGSGYGGNALLGKKCLALRIASVMARDEGWLAEHMLILGVTNPEGKKYYFTAAFPSACGKTNLAMI  282 (608)
T ss_pred             cceeecCCCcceEeecCCccchhhhhhhHHHHHHHHHHhhhhhhHhhhheeeEecCCCCceEEEEeecccccCccchhhc
Confidence            1223345588999999999998   899 7999999999999999999974 22 58899999998  99999999998 


Q ss_pred             c---CC--CceeecCc-eee-cCCCc-c--ccCCceeEeecCCCCCCCchhhhhcc-ccceeeeeEEcCCCCcc------
Q 008523          353 D---HN--RYLIGDDE-HCW-GDNGV-S--NIEGGCYAKCIDLSREKEPDIWNAIK-FGAVLENVVFDEHTREV------  415 (563)
Q Consensus       353 d---~~--r~lIgDDe-~~w-~~~Gv-f--n~EgGcyaK~~dLs~e~EP~I~~ai~-f~ailENV~~d~~~~~v------  415 (563)
                      .   |+  -.+||||. .+- ..||. |  |.|.|+|+-..+.+....|-+++.++ -.+|+.||.|.++| .|      
T Consensus       283 ~p~~pGWk~~~igDDIawik~~~DG~lyAvNPE~GfFGVapGtn~~tnpnam~tl~~~n~IFTNV~lT~DG-dvwWEG~~  361 (608)
T COG1274         283 PPTIPGWKAETIGDDIAWIKFGKDGRLYAVNPEIGFFGVAPGTNEKTNPNAMATLHSGNTIFTNVALTDDG-DVWWEGLE  361 (608)
T ss_pred             CCCCCCcceeeccCceeeeeccCCCceEeeccccceEEeecCCCccCChhHHHHhccCceEEeeeeecCCC-CccccCCC
Confidence            2   32  35899993 232 46884 3  99999999999999999999999997 79999999998764 44      


Q ss_pred             --------cCCC----------CCcccceeEEEecccccCCc--CCCCCCCcceEEEEE-eccCCCCCCeee-cCHHHHH
Q 008523          416 --------DYSD----------KSVTENTRAAYPIEYIPNAK--IPCVGPHPKNVILLA-CDAFGVLPPVSK-LNLAQTM  473 (563)
Q Consensus       416 --------df~d----------~s~t~NtR~~yPi~~i~N~~--~~~~~g~P~~iIflt-~Da~gvLPPVsk-Lt~eQA~  473 (563)
                              |+.+          ...+.|+|.+.|++..|++.  -+...|+|++.|++. +| ..++|+|-. ++.+..+
T Consensus       362 ~~~p~~l~dw~G~~w~~~~~g~paAHpNsRft~pl~~~P~ld~ew~dP~GVpi~aiiFGgRr-~~TvPlV~EA~~W~HGV  440 (608)
T COG1274         362 GEPPEELIDWKGNDWRPGETGEPAAHPNSRFTVPLSQCPNLDPEWDDPEGVPIDAIIFGGRR-PTTVPLVTEAFDWEHGV  440 (608)
T ss_pred             CCCccccccCCCCccCCCCCCCCCCCCCcccccchhhCCccCccccCCCCceEeeEEecCcC-CcccCceeeecccccce
Confidence                    2221          12689999999999999985  335568997776666 65 578899886 4888887


Q ss_pred             HHHHccccccccc---cc--CCccCccccccccccCCCccCChHHHHHH---HHHHHHHcCCEEEEEe
Q 008523          474 YHFISGYTALVAG---TE--DGIKEPTATFSACFGAAFIMLHPTKYAAM---LAEKMQKHGATGWLVN  533 (563)
Q Consensus       474 ~~FlsGyTak~aG---tE--~Gv~ep~atFs~cFg~PF~p~~p~~yae~---L~~kl~~~~v~v~LiN  533 (563)
                      +   +|.|-.+..   +|  +|..    .|-|+.-.||+..+-.+|-.-   |++|+++.--++|.||
T Consensus       441 ~---mGA~m~Se~TAA~~Gk~G~l----r~dPmAmLpF~gyn~~dYf~hwl~~G~k~~~k~PKIF~VN  501 (608)
T COG1274         441 F---MGATMGSETTAAAEGKVGVL----RRDPMAMLPFCGYNMGDYFRHWLEFGRKLRDKLPKIFGVN  501 (608)
T ss_pred             e---eeeccccchhhhhhccccce----ecCcchhcccccccHHHHHHHHHHHHHhhhccCCcEEEEE
Confidence            6   677722211   22  2333    367889999999999999876   6667776556667666


No 13 
>KOG3749 consensus Phosphoenolpyruvate carboxykinase [Energy production and conversion]
Probab=99.23  E-value=4.7e-11  Score=128.01  Aligned_cols=306  Identities=22%  Similarity=0.251  Sum_probs=203.4

Q ss_pred             ccEEEEEeeecC--CCCCeeEEEEEcccccHHHHHhccCcCCChHhhccCCCCCEE--EEEc--C---------CCCCCc
Q 008523          209 VQVFVNDQFLNW--DPQNRVKVRIVSARAYHSLFMHNMCIRPTPEELENFGTPDFT--IYNA--G---------QFPCNR  273 (563)
Q Consensus       209 ~~lyv~d~~~G~--d~~~~i~vrvit~~a~~alf~~Nlf~rp~~~el~~~~~pd~t--I~~~--p---------~f~~~~  273 (563)
                      |.+||+..-.|-  .|-..+ -..+|+++|.-+.||-|+..-+ ..++..+..||+  +...  |         .|+++|
T Consensus       155 RtMYVvPFSMGpvGsplski-GiqlTDspyvV~smRimtR~g~-~Vl~~l~~~dFvrClHSVG~Prp~~~~~v~~wpcnP  232 (640)
T KOG3749|consen  155 RTMYVVPFSMGPVGSPLSKI-GIQLTDSPYVVLSMRIMTRMGT-PVLDALGDGDFVRCLHSVGMPRPGQQKIVNPWPCNP  232 (640)
T ss_pred             ceEEEEeeccCCCCCcchhc-eeEecCCceeeeehhHHHHhcc-HHHHHhcccchhhhhhhcCCCCCcccCCCCCCCCCc
Confidence            899999988876  454444 3478999999998888875421 122223344553  2221  1         255555


Q ss_pred             cccCCCCccEEEEecCCCeEEEEccccchh---hHHH-HHHHHHHhcccCceeeecccceec---CCCCEEEE--EecCC
Q 008523          274 YTHYMTSSTSIDLNLARREMVILGTQYAGE---MKKG-LFSVMHYLMPKRQILSLHSGCNMG---KDGDVALF--FGLSG  344 (563)
Q Consensus       274 ~~~g~~s~~~i~id~~~~~i~I~Gt~Y~GE---iKK~-iltl~n~~l~~~G~L~mH~sanvg---~~G~valf--FGLSG  344 (563)
                      +      .++|..-+.++.|+..|..|-|+   =||- .|+++..+..++|||..|+-. .+   +.|+...+  .=+|.
T Consensus       233 e------~t~i~hkp~e~EI~s~GsgyGgnsllGkKcFalriaS~iak~eGWLAEhmlI-lgITnP~g~k~~iaaafpSa  305 (640)
T KOG3749|consen  233 E------RTLIAHKPDEREIWSFGSGYGGNSLLGKKCFALRIASRLAKDEGWLAEHMLI-LGITNPKGEKKYIAAAFPSA  305 (640)
T ss_pred             c------eeEEeecCccceeeeeccCCCCCccccchhhhhhhhhhhhhhhhhHHHhHHH-hcccCCCCCceEEEEecccc
Confidence            3      36787889999999999999997   3343 566778899999999999963 33   56764333  33899


Q ss_pred             CCcccccc-cC---CC--ceeecCc--eeecCCCc---cccCCceeEeecCCCCCCCchhhhhccccceeeeeEEcCCCC
Q 008523          345 TGKTTLST-DH---NR--YLIGDDE--HCWGDNGV---SNIEGGCYAKCIDLSREKEPDIWNAIKFGAVLENVVFDEHTR  413 (563)
Q Consensus       345 TGKTTLsa-d~---~r--~lIgDDe--~~w~~~Gv---fn~EgGcyaK~~dLs~e~EP~I~~ai~f~ailENV~~d~~~~  413 (563)
                      ||||.|++ .|   +-  ..+|||.  --|+.+|.   +|.|.|+|.-..+-+...-|.-.+.+.-++|++||.=..+| 
T Consensus       306 cgktnLam~~p~lPGwKV~cVgddiaWmkf~~dG~l~ainPEngffgvapgts~~tnP~am~t~~~ntIftnvaeTsDg-  384 (640)
T KOG3749|consen  306 CGKTNLAMMNPTLPGWKVECVGDDIAWMKFDADGRLRAINPENGFFGVAPGTSEKTNPNAMATIQKNTIFTNVAETSDG-  384 (640)
T ss_pred             cccchHhhcCCCCCCceEEEeccceeEEEecCCCeEEEecccccccccCCCcccccCHHHHHHHHhccceeeeeeccCC-
Confidence            99999988 33   43  3699993  33777894   59999999999999999999888888889999998766653 


Q ss_pred             cccCCC-------------------------CCcccceeEEEecccccCCc--CCCCCCCcceEEEEE-eccCCCCCCee
Q 008523          414 EVDYSD-------------------------KSVTENTRAAYPIEYIPNAK--IPCVGPHPKNVILLA-CDAFGVLPPVS  465 (563)
Q Consensus       414 ~vdf~d-------------------------~s~t~NtR~~yPi~~i~N~~--~~~~~g~P~~iIflt-~Da~gvLPPVs  465 (563)
                      .+.+.+                         .--++|.|.+-|-..-|++.  -.+..|.|...|++. +.-.| .|-|-
T Consensus       385 ~~~weg~e~~l~~~v~it~wlgk~w~~~~~~~aahPnsrf~~pa~Qcpii~p~Wesp~GVPI~AiiFggRRp~g-vPLvy  463 (640)
T KOG3749|consen  385 GVYWEGIEKPLAPGVTITSWLGKPWSIGDGEPAAHPNSRFCAPASQCPIIDPAWESPEGVPISAIIFGGRRPAG-VPLVY  463 (640)
T ss_pred             ceeeccccccccCCceeecccCCcccCCCCCcCCCCcccccCchhhCCCcCccccCCCCCceeEEEecCCCCCC-CceEE
Confidence            343321                         12579999999999988873  335568997766666 44334 36555


Q ss_pred             ec-CHHHHHHH---HHccccc--ccccccCCc-cCccccccccccCCCccCChHHHHHHHHHHHHH---cCCEEEEEe
Q 008523          466 KL-NLAQTMYH---FISGYTA--LVAGTEDGI-KEPTATFSACFGAAFIMLHPTKYAAMLAEKMQK---HGATGWLVN  533 (563)
Q Consensus       466 kL-t~eQA~~~---FlsGyTa--k~aGtE~Gv-~ep~atFs~cFg~PF~p~~p~~yae~L~~kl~~---~~v~v~LiN  533 (563)
                      +- +.+..+..   .-|-.||  +..|  +=| -.      ++.-.||+-..-.+|-+--.+.=+.   .--++|-+|
T Consensus       464 Ea~~WehGVfvga~mrseataaae~~g--kiimhd------P~amrpf~gynfgkYl~HWL~m~~~~~~~~PkIFhvN  533 (640)
T KOG3749|consen  464 EANSWEHGVFVGAAMRSEATAAAEHKG--KIIMHD------PFAMRPFFGYNFGKYLEHWLSMGQRPKAKLPKIFHVN  533 (640)
T ss_pred             EccccccceeeeehhhhhhhHHHHhcC--ceEeeC------chhccccccCcHHHHHHHHHHhccCCCCCCCcEEEee
Confidence            53 56554431   0022221  1111  222 23      3566888888888887664332222   124677776


No 14 
>cd00820 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis. It catalyzes the reversible decarboxylation and phosphorylation of oxaloacetate to yield phosphoenolpyruvate and carbon dioxide, using a nucleotide molecule (ATP  or GTP) for the phosphoryl transfer, and has a strict requirement for divalent metal ions for activity.  PEPCK's separate into two phylogenetic groups based on their nucleotide substrate specificity (the ATP-, and GTP-dependent groups).HprK/P, the bifunctional histidine-containing protein kinase/phosphatase, controls the phosphorylation state of the phosphocarrier protein HPr and regulates the utilization of carbon sources by gram-positive bacteria. It catalyzes both the ATP-dependent phosphorylation of HPr and its dephosphorylation by phosphorolysis. PEPCK and the C-terminal catalytic domain of HprK/P are structural
Probab=97.66  E-value=1.1e-05  Score=72.41  Aligned_cols=49  Identities=31%  Similarity=0.200  Sum_probs=36.7

Q ss_pred             ceeeecccceecCCCCEEEEEecCCCCcccccc-cC--CCceeecCceeecC
Q 008523          320 QILSLHSGCNMGKDGDVALFFGLSGTGKTTLST-DH--NRYLIGDDEHCWGD  368 (563)
Q Consensus       320 G~L~mH~sanvg~~G~valfFGLSGTGKTTLsa-d~--~r~lIgDDe~~w~~  368 (563)
                      |++.+|+.+-.-+.|+.+++.|+||+|||||.. -+  .-.+.+||...|+.
T Consensus         1 ~~~aL~~vsl~i~~ge~v~I~GpSGsGKSTLl~~l~~G~i~~~g~di~~~~~   52 (107)
T cd00820           1 GTTSLHGVLVDVYGKVGVLITGDSGIGKTELALELIKRKHRLVGDDNVEIRE   52 (107)
T ss_pred             CceEEEeeEEEEcCCEEEEEEcCCCCCHHHHHHHhhCCeEEEeeEeHHHhhh
Confidence            678899966444778999999999999999766 22  23467777666654


No 15 
>cd01918 HprK_C HprK/P, the bifunctional histidine-containing protein kinase/phosphatase, controls the phosphorylation state of the phosphocarrier protein HPr and regulates the utilization of carbon sources by gram-positive bacteria. It catalyzes both the ATP-dependent phosphorylation of Ser-46 of HPr and its dephosphorylation by phosphorolysis. The latter reaction uses inorganic phosphate as substrate and produces pyrophosphate. Phosphoenolpyruvate carboxykinase (PEPCK) and the C-terminal catalytic domain of HprK/P are structurally similar with conserved active site residues suggesting these two phosphotransferases have related functions.  The HprK/P N-terminal domain is structurally similar to the N-terminal domains of the MurE and MurF amino acid ligases.
Probab=97.54  E-value=4.6e-05  Score=72.24  Aligned_cols=45  Identities=27%  Similarity=0.355  Sum_probs=36.5

Q ss_pred             eeecccceecCCCCEEEEEecCCCCcccccc---cCCCceeecCceeec
Q 008523          322 LSLHSGCNMGKDGDVALFFGLSGTGKTTLST---DHNRYLIGDDEHCWG  367 (563)
Q Consensus       322 L~mH~sanvg~~G~valfFGLSGTGKTTLsa---d~~r~lIgDDe~~w~  367 (563)
                      ..+||++ +.-+|.-++|.|+||+|||||+.   ..+..+|+||.....
T Consensus         3 ~~~H~~~-v~~~g~gvLi~G~sG~GKStlal~L~~~g~~lvaDD~v~v~   50 (149)
T cd01918           3 VTVHGVL-VEVGGIGVLITGPSGIGKSELALELIKRGHRLVADDRVVVK   50 (149)
T ss_pred             ccEEEEE-EEECCEEEEEEcCCCCCHHHHHHHHHHcCCeEEECCEEEEE
Confidence            5789988 66678889999999999999876   456679999965543


No 16 
>PF07475 Hpr_kinase_C:  HPr Serine kinase C-terminal domain;  InterPro: IPR011104 Two-component signal transduction systems enable bacteria to sense, respond, and adapt to a wide range of environments, stressors, and growth conditions []. Some bacteria can contain up to as many as 200 two-component systems that need tight regulation to prevent unwanted cross-talk []. These pathways have been adapted to response to a wide variety of stimuli, including nutrients, cellular redox state, changes in osmolarity, quorum signals, antibiotics, and more []. Two-component systems are comprised of a sensor histidine kinase (HK) and its cognate response regulator (RR) []. The HK catalyses its own auto-phosphorylation followed by the transfer of the phosphoryl group to the receiver domain on RR; phosphorylation of the RR usually activates an attached output domain, which can then effect changes in cellular physiology, often by regulating gene expression. Some HK are bifunctional, catalysing both the phosphorylation and dephosphorylation of their cognate RR. The input stimuli can regulate either the kinase or phosphatase activity of the bifunctional HK. A variant of the two-component system is the phospho-relay system. Here a hybrid HK auto-phosphorylates and then transfers the phosphoryl group to an internal receiver domain, rather than to a separate RR protein. The phosphoryl group is then shuttled to histidine phosphotransferase (HPT) and subsequently to a terminal RR, which can evoke the desired response [, ]. This entry represents the C-terminal kinase domain of Hpr Serine/threonine kinase PtsK. This kinase is the sensor in a multicomponent phosphorelay system in control of carbon catabolic repression in bacteria []. This kinase in unusual in that it recognises the tertiary structure of its target and is a member of a novel family unrelated to any previously described protein phosphorylating enzymes []. X-ray analysis of the full-length crystalline enzyme from Staphylococcus xylosus at a resolution of 1.95 A shows the enzyme to consist of two clearly separated domains that are assembled in a hexameric structure resembling a three-bladed propeller [].; GO: 0000155 two-component sensor activity, 0004672 protein kinase activity, 0005524 ATP binding, 0000160 two-component signal transduction system (phosphorelay), 0006109 regulation of carbohydrate metabolic process; PDB: 2QMH_C 1KKM_B 1KKL_C 1JB1_A 3TQF_B 1KNX_B 1KO7_A.
Probab=97.10  E-value=0.00029  Score=68.32  Aligned_cols=46  Identities=28%  Similarity=0.346  Sum_probs=37.6

Q ss_pred             eeeecccceecCCCCEEEEEecCCCCcccccc---cCCCceeecCceeec
Q 008523          321 ILSLHSGCNMGKDGDVALFFGLSGTGKTTLST---DHNRYLIGDDEHCWG  367 (563)
Q Consensus       321 ~L~mH~sanvg~~G~valfFGLSGTGKTTLsa---d~~r~lIgDDe~~w~  367 (563)
                      ...+||++ +.-+|.-++|.|.||+|||||+.   ..+..||+||.....
T Consensus         6 ~~~~Hg~~-v~i~G~GVLi~G~SG~GKS~lAl~Li~rGh~lvaDD~v~i~   54 (171)
T PF07475_consen    6 RTTLHGSL-VDIGGVGVLITGPSGIGKSELALELIKRGHRLVADDRVEIR   54 (171)
T ss_dssp             EEEEESEE-EEETTEEEEEEESTTSSHHHHHHHHHHTT-EEEESSEEEEE
T ss_pred             cceeeEEE-EEECCEEEEEECCCCCCHHHHHHHHHHCCCeEEeCCEEEEE
Confidence            36789987 77889899999999999999876   557889999965543


No 17 
>TIGR00679 hpr-ser Hpr(Ser) kinase/phosphatase. The hprK gene of Enterococcus faecalis encodes a bifunctional enzyme: the HPr kinase/phosphatase
Probab=96.78  E-value=0.00071  Score=70.98  Aligned_cols=71  Identities=24%  Similarity=0.265  Sum_probs=49.0

Q ss_pred             eEEEEccccchhhHHHHHHHHHHhcc-cCceeeecccceecCCCCEEEEEecCCCCcccccc---cCCCceeecCcee
Q 008523          292 EMVILGTQYAGEMKKGLFSVMHYLMP-KRQILSLHSGCNMGKDGDVALFFGLSGTGKTTLST---DHNRYLIGDDEHC  365 (563)
Q Consensus       292 ~i~I~Gt~Y~GEiKK~iltl~n~~l~-~~G~L~mH~sanvg~~G~valfFGLSGTGKTTLsa---d~~r~lIgDDe~~  365 (563)
                      .+-++-+.+.+-  ..+..+..|+-. -.+..++||++ +.-.|..++|.|.||+|||||+.   +.+..||+||...
T Consensus       106 ~ip~l~t~~~~~--~~~~~l~~~L~~~la~~~~~hg~~-v~i~g~gvli~G~sg~GKS~lal~Li~rg~~lvaDD~~~  180 (304)
T TIGR00679       106 QVPILKTDLFST--ELSFRLETYLNEQFAPTAAIHGVL-VEVYGVGVLITGKSGVGKSETALELINRGHRLVADDAVE  180 (304)
T ss_pred             CCcEEEeCCcHH--HHHHHHHHHHHHhhccceeeeeEE-EEECCEEEEEEcCCCCCHHHHHHHHHHcCCceeecCeEE
Confidence            344455555552  122223333333 35678999987 77788899999999999999776   5678899999654


No 18 
>COG1493 HprK Serine kinase of the HPr protein, regulates carbohydrate metabolism [Signal transduction mechanisms]
Probab=96.58  E-value=0.0016  Score=68.18  Aligned_cols=73  Identities=23%  Similarity=0.284  Sum_probs=48.0

Q ss_pred             EEEEccccchhhHHHHHHHHHHhcc-cCceeeecccceecCCCCEEEEEecCCCCcccccc---cCCCceeecCceeecC
Q 008523          293 MVILGTQYAGEMKKGLFSVMHYLMP-KRQILSLHSGCNMGKDGDVALFFGLSGTGKTTLST---DHNRYLIGDDEHCWGD  368 (563)
Q Consensus       293 i~I~Gt~Y~GEiKK~iltl~n~~l~-~~G~L~mH~sanvg~~G~valfFGLSGTGKTTLsa---d~~r~lIgDDe~~w~~  368 (563)
                      +-|+-+.++..  --.+++.+|+.. ---...+||.+ +.-.|.-+++.|+||.|||+|+-   +.+..||+||.....-
T Consensus       106 ~pil~s~~~ts--~l~~~l~~yL~~~lA~~~~vHGvl-~~I~GvGVLItG~SG~GKSElALeLi~rghrLVaDD~V~i~~  182 (308)
T COG1493         106 IPILTSKLSTS--ELSFTLTNYLSRPLAERVNVHGVL-LDIFGVGVLITGPSGAGKSELALELIKRGHRLVADDAVEIFR  182 (308)
T ss_pred             CceEEecchHH--HHHHHHHHHhhhhcccceeeeeEE-EEEeeeEEEEECCCCCCHhHHHHHHHHhccceeccccEEEEe
Confidence            44444554442  123445555444 22235789965 55566669999999999998665   6688999999776553


No 19 
>PRK05428 HPr kinase/phosphorylase; Provisional
Probab=96.34  E-value=0.0023  Score=67.38  Aligned_cols=72  Identities=24%  Similarity=0.228  Sum_probs=47.9

Q ss_pred             eEEEEccccc-hh-hHHHHHHHHHHhcccCceeeecccceecCCCCEEEEEecCCCCcccccc---cCCCceeecCceee
Q 008523          292 EMVILGTQYA-GE-MKKGLFSVMHYLMPKRQILSLHSGCNMGKDGDVALFFGLSGTGKTTLST---DHNRYLIGDDEHCW  366 (563)
Q Consensus       292 ~i~I~Gt~Y~-GE-iKK~iltl~n~~l~~~G~L~mH~sanvg~~G~valfFGLSGTGKTTLsa---d~~r~lIgDDe~~w  366 (563)
                      .+-++-|.+. .+ |-+...-+...++++   ..+||++ +.-.|.-+++.|.||.|||+|+.   +.+..||+||....
T Consensus       106 ~ipll~t~~~t~~~i~~l~~~L~~~la~~---~~iHg~~-v~V~G~GvLi~G~SG~GKSelALeLi~rGh~LVaDD~v~i  181 (308)
T PRK05428        106 GIPLLRTPLSTTRLISKLTNYLDRKLAPR---TSVHGVL-VDIYGIGVLITGESGIGKSETALELIKRGHRLVADDAVDI  181 (308)
T ss_pred             CCcEEEeCCcHHHHHHHHHHHHHHHhhhc---ceeeeEE-EEECCEEEEEEcCCCCCHHHHHHHHHHcCCceEecCeEEE
Confidence            3444555543 23 223333333334443   5789987 77788889999999999999776   55788999996554


Q ss_pred             c
Q 008523          367 G  367 (563)
Q Consensus       367 ~  367 (563)
                      .
T Consensus       182 ~  182 (308)
T PRK05428        182 K  182 (308)
T ss_pred             E
Confidence            3


No 20 
>COG0529 CysC Adenylylsulfate kinase and related kinases [Inorganic ion transport and metabolism]
Probab=95.20  E-value=0.0079  Score=59.18  Aligned_cols=21  Identities=48%  Similarity=0.858  Sum_probs=19.0

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      +.|.+++|.||||+|||||+.
T Consensus        21 ~~~~viW~TGLSGsGKSTiA~   41 (197)
T COG0529          21 QKGAVIWFTGLSGSGKSTIAN   41 (197)
T ss_pred             CCCeEEEeecCCCCCHHHHHH
Confidence            457899999999999999987


No 21 
>PRK06217 hypothetical protein; Validated
Probab=95.00  E-value=0.014  Score=55.86  Aligned_cols=35  Identities=26%  Similarity=0.345  Sum_probs=27.6

Q ss_pred             EEEEEecCCCCcccccc----cCCCceeecCceeecCCC
Q 008523          336 VALFFGLSGTGKTTLST----DHNRYLIGDDEHCWGDNG  370 (563)
Q Consensus       336 valfFGLSGTGKTTLsa----d~~r~lIgDDe~~w~~~G  370 (563)
                      .+++.|.||+|||||+.    ..+-.+|.-|...|...+
T Consensus         3 ~I~i~G~~GsGKSTla~~L~~~l~~~~~~~D~~~~~~~~   41 (183)
T PRK06217          3 RIHITGASGSGTTTLGAALAERLDIPHLDTDDYFWLPTD   41 (183)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHcCCcEEEcCceeeccCC
Confidence            48999999999999886    335557888888886544


No 22 
>PF13207 AAA_17:  AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A ....
Probab=94.47  E-value=0.017  Score=50.58  Aligned_cols=17  Identities=41%  Similarity=0.694  Sum_probs=15.5

Q ss_pred             EEEEEecCCCCcccccc
Q 008523          336 VALFFGLSGTGKTTLST  352 (563)
Q Consensus       336 valfFGLSGTGKTTLsa  352 (563)
                      ++++.|+|||||||++.
T Consensus         1 vI~I~G~~gsGKST~a~   17 (121)
T PF13207_consen    1 VIIISGPPGSGKSTLAK   17 (121)
T ss_dssp             EEEEEESTTSSHHHHHH
T ss_pred             CEEEECCCCCCHHHHHH
Confidence            57899999999999887


No 23 
>COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism]
Probab=94.41  E-value=0.022  Score=60.79  Aligned_cols=21  Identities=43%  Similarity=0.782  Sum_probs=19.0

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ++|.-++|.|+||||||||..
T Consensus        27 ~~Gef~vllGPSGcGKSTlLr   47 (338)
T COG3839          27 EDGEFVVLLGPSGCGKSTLLR   47 (338)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            789999999999999999664


No 24 
>PF13555 AAA_29:  P-loop containing region of AAA domain
Probab=94.31  E-value=0.023  Score=46.66  Aligned_cols=21  Identities=48%  Similarity=0.735  Sum_probs=18.0

Q ss_pred             cCCCCEEEEEecCCCCccccc
Q 008523          331 GKDGDVALFFGLSGTGKTTLS  351 (563)
Q Consensus       331 g~~G~valfFGLSGTGKTTLs  351 (563)
                      .++|++++|.|.+|+|||||.
T Consensus        20 ~~~g~~tli~G~nGsGKSTll   40 (62)
T PF13555_consen   20 DPRGDVTLITGPNGSGKSTLL   40 (62)
T ss_pred             cCCCcEEEEECCCCCCHHHHH
Confidence            356789999999999999964


No 25 
>PF01583 APS_kinase:  Adenylylsulphate kinase;  InterPro: IPR002891 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases. Protein kinases catalyse the transfer of the gamma phosphate from nucleotide triphosphates (often ATP) to one or more amino acid residues in a protein substrate side chain, resulting in a conformational change affecting protein function. Phosphoprotein phosphatases catalyse the reverse process. Protein kinases fall into three broad classes, characterised with respect to substrate specificity []:   Serine/threonine-protein kinases Tyrosine-protein kinases Dual specific protein kinases (e.g. MEK - phosphorylates both Thr and Tyr on target proteins)   Protein kinase function has been evolutionarily conserved from Escherichia coli to human []. Protein kinases play a role in a multitude of cellular processes, including division, proliferation, apoptosis, and differentiation []. Phosphorylation usually results in a functional change of the target protein by changing enzyme activity, cellular location, or association with other proteins. The catalytic subunits of protein kinases are highly conserved, and several structures have been solved [], leading to large screens to develop kinase-specific inhibitors for the treatments of a number of diseases []. This domain contains an ATP binding P-loop motif [].; GO: 0005524 ATP binding, 0016301 kinase activity, 0016772 transferase activity, transferring phosphorus-containing groups, 0000103 sulfate assimilation; PDB: 1M7H_B 1M7G_B 3CR7_B 1D6J_A 2OFW_G 1X6V_B 1XNJ_A 1XJQ_B 2PEY_A 2PEZ_B ....
Probab=93.99  E-value=0.02  Score=54.80  Aligned_cols=19  Identities=58%  Similarity=0.779  Sum_probs=16.9

Q ss_pred             CCEEEEEecCCCCcccccc
Q 008523          334 GDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       334 G~valfFGLSGTGKTTLsa  352 (563)
                      |.+++|.||||+|||||+.
T Consensus         2 g~vIwltGlsGsGKtTlA~   20 (156)
T PF01583_consen    2 GFVIWLTGLSGSGKTTLAR   20 (156)
T ss_dssp             -EEEEEESSTTSSHHHHHH
T ss_pred             CEEEEEECCCCCCHHHHHH
Confidence            5689999999999999987


No 26 
>PRK07261 topology modulation protein; Provisional
Probab=93.92  E-value=0.033  Score=53.15  Aligned_cols=32  Identities=28%  Similarity=0.358  Sum_probs=22.8

Q ss_pred             EEEEEecCCCCcccccccC----CCceeecCceeec
Q 008523          336 VALFFGLSGTGKTTLSTDH----NRYLIGDDEHCWG  367 (563)
Q Consensus       336 valfFGLSGTGKTTLsad~----~r~lIgDDe~~w~  367 (563)
                      .+++.|.||+|||||+..-    +-.+|+-|...|.
T Consensus         2 ri~i~G~~GsGKSTla~~l~~~~~~~~i~~D~~~~~   37 (171)
T PRK07261          2 KIAIIGYSGSGKSTLARKLSQHYNCPVLHLDTLHFQ   37 (171)
T ss_pred             EEEEEcCCCCCHHHHHHHHHHHhCCCeEecCCEEec
Confidence            4789999999999998721    2335666656564


No 27 
>smart00382 AAA ATPases associated with a variety of cellular activities. AAA - ATPases associated with a variety of cellular activities. This profile/alignment only detects a fraction of this vast family. The poorly conserved N-terminal helix is missing from the alignment.
Probab=93.84  E-value=0.027  Score=47.89  Aligned_cols=19  Identities=53%  Similarity=0.868  Sum_probs=16.8

Q ss_pred             CCEEEEEecCCCCcccccc
Q 008523          334 GDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       334 G~valfFGLSGTGKTTLsa  352 (563)
                      +..++|+|++|||||||..
T Consensus         2 ~~~~~l~G~~G~GKTtl~~   20 (148)
T smart00382        2 GEVILIVGPPGSGKTTLAR   20 (148)
T ss_pred             CCEEEEECCCCCcHHHHHH
Confidence            4679999999999999775


No 28 
>COG4148 ModC ABC-type molybdate transport system, ATPase component [Inorganic ion transport and metabolism]
Probab=93.68  E-value=0.056  Score=56.83  Aligned_cols=25  Identities=36%  Similarity=0.603  Sum_probs=19.4

Q ss_pred             ceecCCC-CEEEEEecCCCCcccccc
Q 008523          328 CNMGKDG-DVALFFGLSGTGKTTLST  352 (563)
Q Consensus       328 anvg~~G-~valfFGLSGTGKTTLsa  352 (563)
                      ++....| .++++||+||+|||||..
T Consensus        17 a~~~~p~~GvTAlFG~SGsGKTslin   42 (352)
T COG4148          17 ANFTLPARGITALFGPSGSGKTSLIN   42 (352)
T ss_pred             EeccCCCCceEEEecCCCCChhhHHH
Confidence            4444444 689999999999999765


No 29 
>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms]
Probab=93.62  E-value=0.033  Score=56.40  Aligned_cols=21  Identities=38%  Similarity=0.653  Sum_probs=19.4

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      +.|+.+++.|+||||||||.+
T Consensus        29 ~~Ge~vaI~GpSGSGKSTLLn   49 (226)
T COG1136          29 EAGEFVAIVGPSGSGKSTLLN   49 (226)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            679999999999999999876


No 30 
>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism]
Probab=93.61  E-value=0.034  Score=56.42  Aligned_cols=21  Identities=43%  Similarity=0.768  Sum_probs=19.0

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      +.|.++++.|+||+|||||..
T Consensus        26 ~~Gevv~iiGpSGSGKSTlLR   46 (240)
T COG1126          26 EKGEVVVIIGPSGSGKSTLLR   46 (240)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            569999999999999999765


No 31 
>COG1117 PstB ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism]
Probab=93.58  E-value=0.033  Score=56.53  Aligned_cols=21  Identities=38%  Similarity=0.551  Sum_probs=18.5

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      +.+.+++|.|+|||||||+..
T Consensus        31 ~~~~VTAlIGPSGcGKST~LR   51 (253)
T COG1117          31 PKNKVTALIGPSGCGKSTLLR   51 (253)
T ss_pred             cCCceEEEECCCCcCHHHHHH
Confidence            567899999999999999765


No 32 
>PF13671 AAA_33:  AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B ....
Probab=93.57  E-value=0.032  Score=50.06  Aligned_cols=28  Identities=32%  Similarity=0.580  Sum_probs=20.3

Q ss_pred             EEEEEecCCCCccccccc----CCCceeecCc
Q 008523          336 VALFFGLSGTGKTTLSTD----HNRYLIGDDE  363 (563)
Q Consensus       336 valfFGLSGTGKTTLsad----~~r~lIgDDe  363 (563)
                      ++++.|++||||||++..    .+-.+|.-|+
T Consensus         1 lii~~G~pgsGKSt~a~~l~~~~~~~~i~~D~   32 (143)
T PF13671_consen    1 LIILCGPPGSGKSTLAKRLAKRLGAVVISQDE   32 (143)
T ss_dssp             EEEEEESTTSSHHHHHHHHHHHSTEEEEEHHH
T ss_pred             CEEEECCCCCCHHHHHHHHHHHCCCEEEeHHH
Confidence            579999999999998762    2333555554


No 33 
>PRK08118 topology modulation protein; Reviewed
Probab=93.41  E-value=0.034  Score=52.99  Aligned_cols=33  Identities=27%  Similarity=0.410  Sum_probs=24.6

Q ss_pred             EEEEEecCCCCcccccc----cCCCceeecCceeecC
Q 008523          336 VALFFGLSGTGKTTLST----DHNRYLIGDDEHCWGD  368 (563)
Q Consensus       336 valfFGLSGTGKTTLsa----d~~r~lIgDDe~~w~~  368 (563)
                      .++++|++|+|||||+.    ..+-.++.=|...|..
T Consensus         3 rI~I~G~~GsGKSTlak~L~~~l~~~~~~lD~l~~~~   39 (167)
T PRK08118          3 KIILIGSGGSGKSTLARQLGEKLNIPVHHLDALFWKP   39 (167)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHhCCCceecchhhccc
Confidence            58999999999999886    2244467677677753


No 34 
>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism]
Probab=93.36  E-value=0.039  Score=56.63  Aligned_cols=21  Identities=38%  Similarity=0.653  Sum_probs=18.8

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|..+.+.|+||||||||..
T Consensus        27 ~~GEfvsilGpSGcGKSTLLr   47 (248)
T COG1116          27 EKGEFVAILGPSGCGKSTLLR   47 (248)
T ss_pred             CCCCEEEEECCCCCCHHHHHH
Confidence            568899999999999999765


No 35 
>cd03220 ABC_KpsT_Wzt ABC_KpsT_Wzt   The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export.  Among the variety of membrane-linked or extracellular polysaccharides excreted by bacteria, only capsular polysaccharides, lipopolysaccharides, and teichoic acids have been shown to be exported by ABC transporters.  A typical system is made of a conserved integral membrane and an ABC.  In addition to these proteins, capsular polysaccharide exporter systems require two 'accessory' proteins to perform their function: a periplasmic (E.coli) or a lipid-anchored outer membrane protein called OMA (Neisseria meningitidis and Haemophilus influenzae) and a cytoplasmic membrane protein MPA2.
Probab=93.25  E-value=0.078  Score=52.40  Aligned_cols=47  Identities=21%  Similarity=0.323  Sum_probs=31.0

Q ss_pred             hhHHHHHHHHHHhcccCceeeeccccee-cCCCCEEEEEecCCCCcccccc
Q 008523          303 EMKKGLFSVMHYLMPKRQILSLHSGCNM-GKDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       303 EiKK~iltl~n~~l~~~G~L~mH~sanv-g~~G~valfFGLSGTGKTTLsa  352 (563)
                      +||+  +.+-+......+...+|. .+. -..|+.+++.|++|+|||||..
T Consensus        19 ~~~~--l~~~~~~~~~~~~~il~~-vs~~i~~Ge~~~i~G~nGsGKSTLl~   66 (224)
T cd03220          19 SLKK--LGILGRKGEVGEFWALKD-VSFEVPRGERIGLIGRNGAGKSTLLR   66 (224)
T ss_pred             hhhh--hhhhhhhhhcCCeEEEee-eEEEEcCCCEEEEECCCCCCHHHHHH
Confidence            3677  444444444444444543 333 3678999999999999999765


No 36 
>KOG0058 consensus Peptide exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport]
Probab=93.04  E-value=0.02  Score=66.01  Aligned_cols=66  Identities=29%  Similarity=0.536  Sum_probs=43.9

Q ss_pred             CCEEEEEecCCCCcccccc------cC-CCceeecCceeecCCCccccCCceeEeecCCCCCCCchhhhhccccceeeee
Q 008523          334 GDVALFFGLSGTGKTTLST------DH-NRYLIGDDEHCWGDNGVSNIEGGCYAKCIDLSREKEPDIWNAIKFGAVLENV  406 (563)
Q Consensus       334 G~valfFGLSGTGKTTLsa------d~-~r~lIgDDe~~w~~~Gvfn~EgGcyaK~~dLs~e~EP~I~~ai~f~ailENV  406 (563)
                      |.++++.|+||+||||++.      +| +..++-|..-      +-+++.=.|-+-+++= .+||.+|.    ++|.||+
T Consensus       494 Ge~vALVGPSGsGKSTiasLL~rfY~PtsG~IllDG~~------i~~~~~~~lr~~Ig~V-~QEPvLFs----~sI~eNI  562 (716)
T KOG0058|consen  494 GEVVALVGPSGSGKSTIASLLLRFYDPTSGRILLDGVP------ISDINHKYLRRKIGLV-GQEPVLFS----GSIRENI  562 (716)
T ss_pred             CCEEEEECCCCCCHHHHHHHHHHhcCCCCCeEEECCee------hhhcCHHHHHHHeeee-eccceeec----ccHHHHH
Confidence            7899999999999999776      77 4555555421      2233333445555553 47887775    5788887


Q ss_pred             EEcC
Q 008523          407 VFDE  410 (563)
Q Consensus       407 ~~d~  410 (563)
                      .+--
T Consensus       563 ~YG~  566 (716)
T KOG0058|consen  563 AYGL  566 (716)
T ss_pred             hcCC
Confidence            7644


No 37 
>COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism]
Probab=93.03  E-value=0.028  Score=58.39  Aligned_cols=56  Identities=25%  Similarity=0.299  Sum_probs=34.8

Q ss_pred             CCCCEEEEEecCCCCcccccc------cC-CCceeecCceeecCCCcc-ccCCceeEeecCCCC
Q 008523          332 KDGDVALFFGLSGTGKTTLST------DH-NRYLIGDDEHCWGDNGVS-NIEGGCYAKCIDLSR  387 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa------d~-~r~lIgDDe~~w~~~Gvf-n~EgGcyaK~~dLs~  387 (563)
                      ++|.-++|.|+|||||||+.-      .| +..+.-|++-+-+.+.+. .--.|+-..-++|=|
T Consensus        25 ~~gef~vliGpSGsGKTTtLkMINrLiept~G~I~i~g~~i~~~d~~~LRr~IGYviQqigLFP   88 (309)
T COG1125          25 EEGEFLVLIGPSGSGKTTTLKMINRLIEPTSGEILIDGEDISDLDPVELRRKIGYVIQQIGLFP   88 (309)
T ss_pred             cCCeEEEEECCCCCcHHHHHHHHhcccCCCCceEEECCeecccCCHHHHHHhhhhhhhhcccCC
Confidence            678899999999999999654      33 344555555444444432 344565555555543


No 38 
>COG4136 ABC-type uncharacterized transport system, ATPase component [General function prediction only]
Probab=93.02  E-value=0.048  Score=53.00  Aligned_cols=21  Identities=38%  Similarity=0.710  Sum_probs=18.8

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|+++-++|+||||||||.+
T Consensus        26 a~GeivtlMGPSGcGKSTLls   46 (213)
T COG4136          26 AKGEIVTLMGPSGCGKSTLLS   46 (213)
T ss_pred             cCCcEEEEECCCCccHHHHHH
Confidence            578999999999999999765


No 39 
>TIGR02868 CydC thiol reductant ABC exporter, CydC subunit. The gene pair cydCD encodes an ABC-family transporter in which each gene contains an N-terminal membrane-spanning domain (pfam00664) and a C-terminal ATP-binding domain (pfam00005). In E. coli these genes were discovered as mutants which caused the terminal heme-copper oxidase complex cytochrome bd to fail to assemble. Recent work has shown that the transporter is involved in export of redox-active thiol compounds such as cysteine and glutathione. The linkage to assembly of the cytochrome bd complex is further supported by the conserved operon structure found outside the gammaproteobacteria (cydABCD) containing both the transporter and oxidase genes components. The genes used as the seed members for this model are all either found in the gammproteobacterial context or the CydABCD context. All members of this family scoring above trusted at the time of its creation were from genomes which encode a cytochrome bd complex.
Probab=92.99  E-value=0.016  Score=64.14  Aligned_cols=21  Identities=38%  Similarity=0.597  Sum_probs=19.1

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      +.|+.+++.|+||+|||||..
T Consensus       359 ~~G~~vaIvG~SGsGKSTLl~  379 (529)
T TIGR02868       359 PPGERVAILGPSGSGKSTLLM  379 (529)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            678999999999999999775


No 40 
>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones]
Probab=92.90  E-value=0.03  Score=65.43  Aligned_cols=82  Identities=32%  Similarity=0.515  Sum_probs=44.1

Q ss_pred             EEEEEecCCCCcccccccCCCceeecCceeec-CCCc-----------------cccC-Cce---------e-EeecCCC
Q 008523          336 VALFFGLSGTGKTTLSTDHNRYLIGDDEHCWG-DNGV-----------------SNIE-GGC---------Y-AKCIDLS  386 (563)
Q Consensus       336 valfFGLSGTGKTTLsad~~r~lIgDDe~~w~-~~Gv-----------------fn~E-gGc---------y-aK~~dLs  386 (563)
                      +.+|.|+||.|||.|+-.-...|-+|+...+. |+.-                 -++| ||.         | +.+-|==
T Consensus       523 sFlF~GPTGVGKTELAkaLA~~Lfg~e~aliR~DMSEy~EkHsVSrLIGaPPGYVGyeeGG~LTEaVRr~PySViLlDEI  602 (786)
T COG0542         523 SFLFLGPTGVGKTELAKALAEALFGDEQALIRIDMSEYMEKHSVSRLIGAPPGYVGYEEGGQLTEAVRRKPYSVILLDEI  602 (786)
T ss_pred             EEEeeCCCcccHHHHHHHHHHHhcCCCccceeechHHHHHHHHHHHHhCCCCCCceeccccchhHhhhcCCCeEEEechh
Confidence            69999999999999875222333333322221 2222                 2333 222         2 2222211


Q ss_pred             CCCCchhhhhccccceeee-eEEcCCCCcccCCC
Q 008523          387 REKEPDIWNAIKFGAVLEN-VVFDEHTREVDYSD  419 (563)
Q Consensus       387 ~e~EP~I~~ai~f~ailEN-V~~d~~~~~vdf~d  419 (563)
                      +...|++++-  |-.|+.+ ..-|-.||+|||.+
T Consensus       603 EKAHpdV~ni--lLQVlDdGrLTD~~Gr~VdFrN  634 (786)
T COG0542         603 EKAHPDVFNL--LLQVLDDGRLTDGQGRTVDFRN  634 (786)
T ss_pred             hhcCHHHHHH--HHHHhcCCeeecCCCCEEecce
Confidence            3467888875  4444444 66677777788733


No 41 
>TIGR01313 therm_gnt_kin carbohydrate kinase, thermoresistant glucokinase family. This model represents a subfamily of proteins that includes thermoresistant and thermosensitve isozymes of gluconate kinase (gluconokinase) in E. coli and other related proteins; members of this family are often named by similarity to the thermostable isozyme. These proteins show homology to shikimate kinases and adenylate kinases but not to gluconate kinases from the FGGY family of carbohydrate kinases.
Probab=92.90  E-value=0.041  Score=51.11  Aligned_cols=27  Identities=26%  Similarity=0.594  Sum_probs=19.2

Q ss_pred             EEEEecCCCCccccccc----CCCceeecCc
Q 008523          337 ALFFGLSGTGKTTLSTD----HNRYLIGDDE  363 (563)
Q Consensus       337 alfFGLSGTGKTTLsad----~~r~lIgDDe  363 (563)
                      +++.|+|||||||++..    .+..+|..|.
T Consensus         1 i~l~G~~GsGKSTla~~l~~~l~~~~v~~D~   31 (163)
T TIGR01313         1 FVLMGVAGSGKSTIASALAHRLGAKFIEGDD   31 (163)
T ss_pred             CEEECCCCCCHHHHHHHHHHhcCCeEEeCcc
Confidence            46889999999998772    2344555554


No 42 
>PRK09825 idnK D-gluconate kinase; Provisional
Probab=92.82  E-value=0.046  Score=52.59  Aligned_cols=20  Identities=30%  Similarity=0.760  Sum_probs=17.6

Q ss_pred             CCCEEEEEecCCCCcccccc
Q 008523          333 DGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       333 ~G~valfFGLSGTGKTTLsa  352 (563)
                      .|.+++++|+||||||||..
T Consensus         2 ~ge~i~l~G~sGsGKSTl~~   21 (176)
T PRK09825          2 AGESYILMGVSGSGKSLIGS   21 (176)
T ss_pred             CCcEEEEECCCCCCHHHHHH
Confidence            36789999999999999775


No 43 
>PRK00300 gmk guanylate kinase; Provisional
Probab=92.76  E-value=0.053  Score=52.16  Aligned_cols=21  Identities=38%  Similarity=0.597  Sum_probs=18.5

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      +.|..+++.|+||||||||+.
T Consensus         3 ~~g~~i~i~G~sGsGKstl~~   23 (205)
T PRK00300          3 RRGLLIVLSGPSGAGKSTLVK   23 (205)
T ss_pred             CCCCEEEEECCCCCCHHHHHH
Confidence            357899999999999999876


No 44 
>KOG0055 consensus Multidrug/pheromone exporter, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism]
Probab=92.76  E-value=0.038  Score=67.01  Aligned_cols=19  Identities=37%  Similarity=0.643  Sum_probs=16.8

Q ss_pred             CCCEEEEEecCCCCccccc
Q 008523          333 DGDVALFFGLSGTGKTTLS  351 (563)
Q Consensus       333 ~G~valfFGLSGTGKTTLs  351 (563)
                      .|.++++.|+|||||||+-
T Consensus      1015 ~GqTvALVG~SGsGKSTvI 1033 (1228)
T KOG0055|consen 1015 AGQTVALVGPSGSGKSTVI 1033 (1228)
T ss_pred             CCCEEEEECCCCCCHHHHH
Confidence            4889999999999999943


No 45 
>COG4175 ProV ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism]
Probab=92.76  E-value=0.049  Score=58.04  Aligned_cols=21  Identities=43%  Similarity=0.887  Sum_probs=19.3

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      .+|...+++||||+|||||..
T Consensus        52 ~~GeIfViMGLSGSGKSTLvR   72 (386)
T COG4175          52 EEGEIFVIMGLSGSGKSTLVR   72 (386)
T ss_pred             cCCeEEEEEecCCCCHHHHHH
Confidence            678999999999999999875


No 46 
>COG4181 Predicted ABC-type transport system involved in lysophospholipase L1 biosynthesis, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism]
Probab=92.69  E-value=0.041  Score=54.42  Aligned_cols=41  Identities=32%  Similarity=0.503  Sum_probs=32.3

Q ss_pred             CCCCEEEEEecCCCCcccccc------cC-C--CceeecCceeecCCCcc
Q 008523          332 KDGDVALFFGLSGTGKTTLST------DH-N--RYLIGDDEHCWGDNGVS  372 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa------d~-~--r~lIgDDe~~w~~~Gvf  372 (563)
                      +.|.++.+.|+||+|||||.+      +| +  =+|.|.+-|..++|+..
T Consensus        34 ~~Ge~vaiVG~SGSGKSTLl~vlAGLd~~ssGeV~l~G~~L~~ldEd~rA   83 (228)
T COG4181          34 KRGETVAIVGPSGSGKSTLLAVLAGLDDPSSGEVRLLGQPLHKLDEDARA   83 (228)
T ss_pred             cCCceEEEEcCCCCcHHhHHHHHhcCCCCCCceEEEcCcchhhcCHHHHH
Confidence            668999999999999999776      33 1  24788888888887753


No 47 
>TIGR00235 udk uridine kinase. Model contains a number of longer eukaryotic proteins and starts bringing in phosphoribulokinase hits at scores of 160 and below
Probab=92.69  E-value=0.046  Score=53.28  Aligned_cols=21  Identities=38%  Similarity=0.420  Sum_probs=18.8

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      +.|.++++.|+||+|||||+.
T Consensus         4 ~~g~vi~I~G~sGsGKSTl~~   24 (207)
T TIGR00235         4 PKGIIIGIGGGSGSGKTTVAR   24 (207)
T ss_pred             CCeEEEEEECCCCCCHHHHHH
Confidence            467899999999999999886


No 48 
>COG3840 ThiQ ABC-type thiamine transport system, ATPase component [Coenzyme metabolism]
Probab=92.63  E-value=0.072  Score=53.17  Aligned_cols=32  Identities=28%  Similarity=0.416  Sum_probs=23.6

Q ss_pred             ceeeecccceecCCCCEEEEEecCCCCcccccc
Q 008523          320 QILSLHSGCNMGKDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       320 G~L~mH~sanvg~~G~valfFGLSGTGKTTLsa  352 (563)
                      +-++|+=.+ ....|+.+++.|+||+|||||..
T Consensus        12 ~~~~~~fdl-~v~~ge~vAi~GpSGaGKSTLLn   43 (231)
T COG3840          12 GHLPMRFDL-TVPAGEIVAILGPSGAGKSTLLN   43 (231)
T ss_pred             CcceEEEEE-eecCCcEEEEECCCCccHHHHHH
Confidence            345554333 23678899999999999999765


No 49 
>PRK05541 adenylylsulfate kinase; Provisional
Probab=92.52  E-value=0.059  Score=50.85  Aligned_cols=21  Identities=43%  Similarity=0.710  Sum_probs=18.5

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|..++|.|+||+||||++.
T Consensus         5 ~~~~~I~i~G~~GsGKst~a~   25 (176)
T PRK05541          5 PNGYVIWITGLAGSGKTTIAK   25 (176)
T ss_pred             CCCCEEEEEcCCCCCHHHHHH
Confidence            457799999999999999875


No 50 
>TIGR03263 guanyl_kin guanylate kinase. Members of this family are the enzyme guanylate kinase, also called GMP kinase. This enzyme transfers a phosphate from ATP to GMP, yielding ADP and GDP.
Probab=92.52  E-value=0.054  Score=50.89  Aligned_cols=19  Identities=42%  Similarity=0.590  Sum_probs=16.9

Q ss_pred             CCEEEEEecCCCCcccccc
Q 008523          334 GDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       334 G~valfFGLSGTGKTTLsa  352 (563)
                      |..+++.|+||+|||||+.
T Consensus         1 g~ii~l~G~~GsGKsTl~~   19 (180)
T TIGR03263         1 GLLIVISGPSGVGKSTLVK   19 (180)
T ss_pred             CcEEEEECCCCCCHHHHHH
Confidence            5689999999999999765


No 51 
>COG0396 sufC Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones]
Probab=92.47  E-value=0.11  Score=53.27  Aligned_cols=21  Identities=43%  Similarity=0.786  Sum_probs=19.5

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      +.|.+.+++|+.|+|||||+.
T Consensus        28 ~~GEvhaiMGPNGsGKSTLa~   48 (251)
T COG0396          28 KEGEVHAIMGPNGSGKSTLAY   48 (251)
T ss_pred             cCCcEEEEECCCCCCHHHHHH
Confidence            568999999999999999987


No 52 
>PRK08233 hypothetical protein; Provisional
Probab=92.44  E-value=0.059  Score=50.34  Aligned_cols=19  Identities=37%  Similarity=0.515  Sum_probs=16.8

Q ss_pred             CCEEEEEecCCCCcccccc
Q 008523          334 GDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       334 G~valfFGLSGTGKTTLsa  352 (563)
                      +.++++.|.||+|||||+.
T Consensus         3 ~~iI~I~G~~GsGKtTla~   21 (182)
T PRK08233          3 TKIITIAAVSGGGKTTLTE   21 (182)
T ss_pred             ceEEEEECCCCCCHHHHHH
Confidence            3578999999999999887


No 53 
>cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT). Cm-inactivating enzyme; modifies the primary (C-3) hydroxyl of the antibiotic. Related structurally to shikimate kinase II.
Probab=92.32  E-value=0.06  Score=51.02  Aligned_cols=19  Identities=26%  Similarity=0.566  Sum_probs=17.4

Q ss_pred             CCEEEEEecCCCCcccccc
Q 008523          334 GDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       334 G~valfFGLSGTGKTTLsa  352 (563)
                      |+.+++.|+||+||||++.
T Consensus         2 ~~~i~l~G~~gsGKst~a~   20 (175)
T cd00227           2 GRIIILNGGSSAGKSSIAR   20 (175)
T ss_pred             CCEEEEECCCCCCHHHHHH
Confidence            5789999999999999886


No 54 
>PRK11174 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed
Probab=92.23  E-value=0.023  Score=63.63  Aligned_cols=21  Identities=38%  Similarity=0.550  Sum_probs=19.3

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      +.|..+++.|.||+|||||..
T Consensus       374 ~~G~~vaIvG~SGsGKSTL~~  394 (588)
T PRK11174        374 PAGQRIALVGPSGAGKTSLLN  394 (588)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            678999999999999999776


No 55 
>COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism]
Probab=92.21  E-value=0.067  Score=57.48  Aligned_cols=21  Identities=48%  Similarity=0.714  Sum_probs=18.4

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      +.|..+.+.|+||||||||..
T Consensus        29 ~~Gef~~lLGPSGcGKTTlLR   49 (352)
T COG3842          29 KKGEFVTLLGPSGCGKTTLLR   49 (352)
T ss_pred             cCCcEEEEECCCCCCHHHHHH
Confidence            568889999999999999764


No 56 
>TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN. Members of this family resemble PhnN of phosphonate utilization operons, where different such operons confer the ability to use somewhat different profiles of C-P bond-containing compounds (see PubMed:15231805), including phosphites as well as phosphonates. PhnN in E. coli shows considerable homology to guanylate kinases (EC 2.7.4.8), and has actually been shown to act as a ribose 1,5-bisphosphokinase (PRPP forming). This suggests an analogous kinase reaction for phosphonate metabolism, converting 5-phosphoalpha-1-(methylphosphono)ribose to methylphosphono-PRPP.
Probab=92.10  E-value=0.064  Score=50.54  Aligned_cols=19  Identities=42%  Similarity=0.621  Sum_probs=16.6

Q ss_pred             CCEEEEEecCCCCcccccc
Q 008523          334 GDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       334 G~valfFGLSGTGKTTLsa  352 (563)
                      |..+++.|+||+|||||+.
T Consensus         1 ~~~~~i~G~sGsGKttl~~   19 (179)
T TIGR02322         1 GRLIYVVGPSGAGKDTLLD   19 (179)
T ss_pred             CcEEEEECCCCCCHHHHHH
Confidence            4578999999999999875


No 57 
>PRK00131 aroK shikimate kinase; Reviewed
Probab=91.89  E-value=0.08  Score=48.80  Aligned_cols=20  Identities=30%  Similarity=0.657  Sum_probs=17.5

Q ss_pred             CCCEEEEEecCCCCcccccc
Q 008523          333 DGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       333 ~G~valfFGLSGTGKTTLsa  352 (563)
                      .+..++|.|++||||||++.
T Consensus         3 ~~~~i~l~G~~GsGKstla~   22 (175)
T PRK00131          3 KGPNIVLIGFMGAGKSTIGR   22 (175)
T ss_pred             CCCeEEEEcCCCCCHHHHHH
Confidence            35689999999999999876


No 58 
>PRK00889 adenylylsulfate kinase; Provisional
Probab=91.84  E-value=0.075  Score=50.09  Aligned_cols=21  Identities=48%  Similarity=0.756  Sum_probs=18.3

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      +.|.+++|.|++|+||||++.
T Consensus         2 ~~g~~i~~~G~~GsGKST~a~   22 (175)
T PRK00889          2 QRGVTVWFTGLSGAGKTTIAR   22 (175)
T ss_pred             CCCeEEEEECCCCCCHHHHHH
Confidence            357799999999999999875


No 59 
>PF13238 AAA_18:  AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C ....
Probab=91.77  E-value=0.073  Score=46.34  Aligned_cols=16  Identities=38%  Similarity=0.619  Sum_probs=14.6

Q ss_pred             EEEEecCCCCcccccc
Q 008523          337 ALFFGLSGTGKTTLST  352 (563)
Q Consensus       337 alfFGLSGTGKTTLsa  352 (563)
                      +++.|.+|+|||||+.
T Consensus         1 I~i~G~~GsGKtTia~   16 (129)
T PF13238_consen    1 IGISGIPGSGKTTIAK   16 (129)
T ss_dssp             EEEEESTTSSHHHHHH
T ss_pred             CEEECCCCCCHHHHHH
Confidence            6899999999999887


No 60 
>cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion.  Recognition and cleavage of the damaged DNA is a multistep ATP-dependent reaction that requires the UvrA, UvrB, and UvrC proteins.  Both UvrA and UvrB are ATPases, with UvrA having two ATP binding sites, which have the characteristic signature of the family of ABC proteins, and UvrB having one ATP binding site that is structurally related to that of helicases.
Probab=91.69  E-value=0.09  Score=50.91  Aligned_cols=21  Identities=33%  Similarity=0.485  Sum_probs=18.9

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      +.|+.+++.|+||+|||||..
T Consensus        19 ~~G~~~~l~G~nG~GKSTLl~   39 (176)
T cd03238          19 PLNVLVVVTGVSGSGKSTLVN   39 (176)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            668999999999999999864


No 61 
>COG4525 TauB ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism]
Probab=91.67  E-value=0.1  Score=52.71  Aligned_cols=21  Identities=43%  Similarity=0.714  Sum_probs=18.8

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|+.+++.|+||||||||..
T Consensus        29 a~ge~vv~lGpSGcGKTTLLn   49 (259)
T COG4525          29 ASGELVVVLGPSGCGKTTLLN   49 (259)
T ss_pred             cCCCEEEEEcCCCccHHHHHH
Confidence            568999999999999999765


No 62 
>KOG0635 consensus Adenosine 5'-phosphosulfate kinase [Inorganic ion transport and metabolism]
Probab=91.65  E-value=0.086  Score=51.10  Aligned_cols=23  Identities=43%  Similarity=0.638  Sum_probs=20.2

Q ss_pred             cCCCCEEEEEecCCCCccccccc
Q 008523          331 GKDGDVALFFGLSGTGKTTLSTD  353 (563)
Q Consensus       331 g~~G~valfFGLSGTGKTTLsad  353 (563)
                      .+.|=++++.||||+|||||++.
T Consensus        28 ~qkGcviWiTGLSgSGKStlACa   50 (207)
T KOG0635|consen   28 KQKGCVIWITGLSGSGKSTLACA   50 (207)
T ss_pred             cCCCcEEEEeccCCCCchhHHHH
Confidence            35688999999999999999873


No 63 
>COG1118 CysA ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism]
Probab=91.37  E-value=0.13  Score=54.75  Aligned_cols=36  Identities=25%  Similarity=0.386  Sum_probs=26.1

Q ss_pred             CCCCEEEEEecCCCCcccccc------cC-CCceeecCceeec
Q 008523          332 KDGDVALFFGLSGTGKTTLST------DH-NRYLIGDDEHCWG  367 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa------d~-~r~lIgDDe~~w~  367 (563)
                      ++|..++++|+||+|||||..      .| ..+++-+++...+
T Consensus        26 ~~Ge~vaLlGpSGaGKsTlLRiIAGLe~p~~G~I~~~~~~l~D   68 (345)
T COG1118          26 KSGELVALLGPSGAGKSTLLRIIAGLETPDAGRIRLNGRVLFD   68 (345)
T ss_pred             cCCcEEEEECCCCCcHHHHHHHHhCcCCCCCceEEECCEeccc
Confidence            789999999999999999764      33 3445555554433


No 64 
>PRK10078 ribose 1,5-bisphosphokinase; Provisional
Probab=91.36  E-value=0.093  Score=50.30  Aligned_cols=19  Identities=37%  Similarity=0.691  Sum_probs=16.7

Q ss_pred             CCEEEEEecCCCCcccccc
Q 008523          334 GDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       334 G~valfFGLSGTGKTTLsa  352 (563)
                      |..+++.|+||+|||||..
T Consensus         2 g~~i~l~G~sGsGKsTl~~   20 (186)
T PRK10078          2 GKLIWLMGPSGSGKDSLLA   20 (186)
T ss_pred             CcEEEEECCCCCCHHHHHH
Confidence            5679999999999999765


No 65 
>PF00005 ABC_tran:  ABC transporter This structure is on hold until Dec 1999;  InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems. ABC transporters minimally consist of two conserved regions: a highly conserved ATP binding cassette (ABC) and a less conserved transmembrane domain (TMD). These can be found on the same protein or on two different ones. Most ABC transporters function as a dimer and therefore are constituted of four domains, two ABC modules and two TMDs. ABC transporters are involved in the export or import of a wide variety of substrates ranging from small ions to macromolecules. The major function of ABC import systems is to provide essential nutrients to bacteria. They are found only in prokaryotes and their four constitutive domains are usually encoded by independent polypeptides (two ABC proteins and two TMD proteins). Prokaryotic importers require additional extracytoplasmic binding proteins (one or more per systems) for function. In contrast, export systems are involved in the extrusion of noxious substances, the export of extracellular toxins and the targeting of membrane components. They are found in all living organisms and in general the TMD is fused to the ABC module in a variety of combinations. Some eukaryotic exporters encode the four domains on the same polypeptide chain [].  The ABC module (approximately two hundred amino acid residues) is known to bind and hydrolyse ATP, thereby coupling transport to ATP hydrolysis in a large number of biological processes. The cassette is duplicated in several subfamilies. Its primary sequence is highly conserved, displaying a typical phosphate-binding loop: Walker A, and a magnesium binding site: Walker B. Besides these two regions, three other conserved motifs are present in the ABC cassette: the switch region which contains a histidine loop, postulated to polarise the attaching water molecule for hydrolysis, the signature conserved motif (LSGGQ) specific to the ABC transporter, and the Q-motif (between Walker A and the signature), which interacts with the gamma phosphate through a water bond. The Walker A, Walker B, Q-loop and switch region form the nucleotide binding site [, , ]. The 3D structure of a monomeric ABC module adopts a stubby L-shape with two distinct arms. ArmI (mainly beta-strand) contains Walker A and Walker B. The important residues for ATP hydrolysis and/or binding are located in the P-loop. The ATP-binding pocket is located at the extremity of armI. The perpendicular armII contains mostly the alpha helical subdomain with the signature motif. It only seems to be required for structural integrity of the ABC module. ArmII is in direct contact with the TMD. The hinge between armI and armII contains both the histidine loop and the Q-loop, making contact with the gamma phosphate of the ATP molecule. ATP hydrolysis leads to a conformational change that could facilitate ADP release. In the dimer the two ABC cassettes contact each other through hydrophobic interactions at the antiparallel beta-sheet of armI by a two-fold axis [, , , , , ]. The ATP-Binding Cassette (ABC) superfamily forms one of the largest of all protein families with a diversity of physiological functions []. Several studies have shown that there is a correlation between the functional characterisation and the phylogenetic classification of the ABC cassette [, ]. More than 50 subfamilies have been described based on a phylogenetic and functional classification [, , ]; (for further information see http://www.tcdb.org/tcdb/index.php?tc=3.A.1). On the basis of sequence similarities a family of related ATP-binding proteins has been characterised [, , , , ].  The proteins belonging to this family also contain one or two copies of the 'A' consensus sequence [] or the 'P-loop' [] (see IPR001687 from INTERPRO).; GO: 0005524 ATP binding, 0016887 ATPase activity; PDB: 3NHB_A 3NH9_A 3NHA_A 3NH6_A 1VCI_A 1V43_A 2YZ2_B 2PMK_A 2FFA_A 1XEF_D ....
Probab=91.31  E-value=0.11  Score=46.56  Aligned_cols=21  Identities=38%  Similarity=0.699  Sum_probs=18.6

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      +.|..+++.|.+|+|||||..
T Consensus         9 ~~g~~~~i~G~nGsGKStLl~   29 (137)
T PF00005_consen    9 KPGEIVAIVGPNGSGKSTLLK   29 (137)
T ss_dssp             ETTSEEEEEESTTSSHHHHHH
T ss_pred             cCCCEEEEEccCCCcccccee
Confidence            568899999999999999765


No 66 
>TIGR03797 NHPM_micro_ABC2 NHPM bacteriocin system ABC transporter, ATP-binding protein. Members of this protein family are ABC transporter ATP-binding subunits, part of a three-gene putative bacteriocin transport operon. The other subunits include another ATP-binding subunit (TIGR03796), which has an N-terminal propeptide cleavage domain, and an HlyD homolog (TIGR03794). In a number of genomes, a conserved propeptide sequence with a classic Gly-Gly motif
Probab=91.25  E-value=0.035  Score=63.53  Aligned_cols=21  Identities=38%  Similarity=0.635  Sum_probs=18.9

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      +.|+.+++.|.||+|||||..
T Consensus       477 ~~Ge~vaIvG~sGsGKSTLlk  497 (686)
T TIGR03797       477 EPGEFVAIVGPSGSGKSTLLR  497 (686)
T ss_pred             CCCCEEEEECCCCCCHHHHHH
Confidence            568899999999999999765


No 67 
>PRK05480 uridine/cytidine kinase; Provisional
Probab=91.23  E-value=0.096  Score=50.89  Aligned_cols=21  Identities=38%  Similarity=0.423  Sum_probs=18.4

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..+.++++.|.||||||||+.
T Consensus         4 ~~~~iI~I~G~sGsGKTTl~~   24 (209)
T PRK05480          4 KKPIIIGIAGGSGSGKTTVAS   24 (209)
T ss_pred             CCCEEEEEECCCCCCHHHHHH
Confidence            356789999999999999887


No 68 
>cd03270 ABC_UvrA_I The excision repair protein UvrA domain I; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion.  Recognition and cleavage of the damaged DNA is a multistep ATP-dependent reaction that requires the UvrA, UvrB, and UvrC proteins.  Both UvrA and UvrB are ATPases, with UvrA having two ATP binding sites, which have the characteristic signature of the family of ABC proteins, and UvrB having one ATP binding site that is structurally related to that of helicases.
Probab=91.22  E-value=0.11  Score=51.76  Aligned_cols=20  Identities=30%  Similarity=0.652  Sum_probs=18.5

Q ss_pred             CCCCEEEEEecCCCCccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLS  351 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLs  351 (563)
                      ..|..+.+.|+||||||||.
T Consensus        19 ~~Ge~~~l~G~sGsGKSTL~   38 (226)
T cd03270          19 PRNKLVVITGVSGSGKSSLA   38 (226)
T ss_pred             CCCcEEEEEcCCCCCHHHHH
Confidence            56899999999999999985


No 69 
>cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota.  The transition metal cobalt is an essential component of many enzymes and must be transported into cells in appropriate amounts when needed.  This ABC transport system of the CbiMNQO family is involved in cobalt transport in association with the cobalamin (vitamin B12) biosynthetic pathways.  Most of cobalt (Cbi) transport systems possess a separate CbiN component, the cobalt-binding periplasmic protein, and they are encoded by the conserved gene cluster cbiMNQO.  Both the CbiM and CbiQ proteins are integral cytoplasmic membrane proteins, and the CbiO protein has the linker peptide and the Walker A and B motifs commonly found in the ATPase components of the ABC-type transport systems.
Probab=91.17  E-value=0.11  Score=50.38  Aligned_cols=21  Identities=43%  Similarity=0.748  Sum_probs=18.9

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|..+++.|+||+|||||..
T Consensus        25 ~~G~~~~l~G~nGsGKSTLl~   45 (211)
T cd03225          25 KKGEFVLIVGPNGSGKSTLLR   45 (211)
T ss_pred             cCCcEEEEECCCCCCHHHHHH
Confidence            578999999999999999765


No 70 
>PF03193 DUF258:  Protein of unknown function, DUF258;  InterPro: IPR004881 This entry contains Escherichia coli (strain K12) RsgA, which may play a role in 30S ribosomal subunit biogenesis. RsgA is an unusual circulary permuted GTPase that catalyzes rapid hydrolysis of GTP with a slow catalytic turnover. It is dispensible for viability, but important for overall fitness. The intrinsic GTPase activity is stimulated by the presence of 30S (160-fold increase in kcat) or 70S (96 fold increase in kcat) ribosomes []. The GTPase is inhibited by aminoglycoside antibiotics such as neomycin and paromycin [] streptomycin and spectinomycin []. This inhibition is not due to competition for binding sites on the 30S or 70S ribosome []. ; GO: 0003924 GTPase activity, 0005525 GTP binding; PDB: 2YKR_W 2YV5_A 1T9H_A 2RCN_A 4A2I_V 1U0L_B.
Probab=91.07  E-value=0.11  Score=49.98  Aligned_cols=19  Identities=37%  Similarity=0.760  Sum_probs=17.6

Q ss_pred             CCEEEEEecCCCCcccccc
Q 008523          334 GDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       334 G~valfFGLSGTGKTTLsa  352 (563)
                      +++++|+|.||+|||||..
T Consensus        35 ~k~~vl~G~SGvGKSSLiN   53 (161)
T PF03193_consen   35 GKTSVLLGQSGVGKSSLIN   53 (161)
T ss_dssp             TSEEEEECSTTSSHHHHHH
T ss_pred             CCEEEEECCCCCCHHHHHH
Confidence            5899999999999999876


No 71 
>cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE).  They are clustered together phylogenetically.  MacAB is an exporter that confers resistance to macrolides, while the LolCDE system is not a transporter at all.  An FtsE null mutants showed filamentous growth and appeared viable on high salt medium only, indicating a role for FtsE in cell division and/or salt transport.  The LolCDE complex catalyses the release of lipoproteins from the cytoplasmic membrane prior to their targeting to the outer membrane.
Probab=90.97  E-value=0.12  Score=50.36  Aligned_cols=21  Identities=38%  Similarity=0.665  Sum_probs=19.0

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|..+++.|+||+|||||..
T Consensus        28 ~~G~~~~l~G~nGsGKSTLl~   48 (218)
T cd03255          28 EKGEFVAIVGPSGSGKSTLLN   48 (218)
T ss_pred             cCCCEEEEEcCCCCCHHHHHH
Confidence            578999999999999999765


No 72 
>COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only]
Probab=90.96  E-value=0.1  Score=51.54  Aligned_cols=21  Identities=38%  Similarity=0.588  Sum_probs=18.1

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|+.+++.|+||||||||..
T Consensus        27 ~~Ge~iaitGPSG~GKStllk   47 (223)
T COG4619          27 RAGEFIAITGPSGCGKSTLLK   47 (223)
T ss_pred             cCCceEEEeCCCCccHHHHHH
Confidence            457899999999999999754


No 73 
>TIGR03375 type_I_sec_LssB type I secretion system ATPase, LssB family. Type I protein secretion is a system in some Gram-negative bacteria to export proteins (often proteases) across both inner and outer membranes to the extracellular medium. This is one of three proteins of the type I secretion apparatus. Targeted proteins are not cleaved at the N-terminus, but rather carry signals located toward the extreme C-terminus to direct type I secretion. This model is related to models TIGR01842 and TIGR01846, and to bacteriocin ABC transporters that cleave their substrates during export.
Probab=90.96  E-value=0.041  Score=63.05  Aligned_cols=21  Identities=33%  Similarity=0.588  Sum_probs=18.8

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      +.|+.+++.|.||+|||||..
T Consensus       489 ~~G~~iaIvG~sGsGKSTLlk  509 (694)
T TIGR03375       489 RPGEKVAIIGRIGSGKSTLLK  509 (694)
T ss_pred             CCCCEEEEECCCCCCHHHHHH
Confidence            568899999999999999765


No 74 
>TIGR01166 cbiO cobalt transport protein ATP-binding subunit. This model describes the ATP binding subunit of the multisubunit cobalt transporter in bacteria and its equivalents in archaea. The model is restricted to ATP subunit that is a part of the cobalt transporter, which belongs to the ABC transporter superfamily (ATP Binding Cassette). The model excludes ATP binding subunit that are associated with other transporters belonging to ABC transporter superfamily. This superfamily includes two groups, one which catalyze the uptake of small molecules, including ions from the external milieu and the other group which is engaged in the efflux of small molecular weight compounds and ions from within the cell. Energy derived from the hydrolysis of ATP drive the both the process of uptake and efflux.
Probab=90.95  E-value=0.12  Score=49.44  Aligned_cols=21  Identities=38%  Similarity=0.684  Sum_probs=18.8

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|..+++.|+||+|||||..
T Consensus        16 ~~Ge~~~i~G~nGsGKSTLl~   36 (190)
T TIGR01166        16 ERGEVLALLGANGAGKSTLLL   36 (190)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            568899999999999999764


No 75 
>PRK06762 hypothetical protein; Provisional
Probab=90.89  E-value=0.098  Score=48.71  Aligned_cols=18  Identities=39%  Similarity=0.636  Sum_probs=16.0

Q ss_pred             CEEEEEecCCCCcccccc
Q 008523          335 DVALFFGLSGTGKTTLST  352 (563)
Q Consensus       335 ~valfFGLSGTGKTTLsa  352 (563)
                      ..++|.|++||||||++.
T Consensus         3 ~li~i~G~~GsGKST~A~   20 (166)
T PRK06762          3 TLIIIRGNSGSGKTTIAK   20 (166)
T ss_pred             eEEEEECCCCCCHHHHHH
Confidence            468999999999999876


No 76 
>TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein.
Probab=90.87  E-value=0.12  Score=50.29  Aligned_cols=21  Identities=33%  Similarity=0.692  Sum_probs=18.9

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|..+++.|+||+|||||..
T Consensus        27 ~~Ge~~~i~G~nGsGKSTLl~   47 (216)
T TIGR00960        27 TKGEMVFLVGHSGAGKSTFLK   47 (216)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            578999999999999999765


No 77 
>TIGR02673 FtsE cell division ATP-binding protein FtsE. This model describes FtsE, a member of the ABC transporter ATP-binding protein family. This protein, and its permease partner FtsX, localize to the division site. In a number of species, the ftsEX gene pair is located next to FtsY, the signal recognition particle-docking protein.
Probab=90.87  E-value=0.12  Score=50.14  Aligned_cols=21  Identities=43%  Similarity=0.694  Sum_probs=18.8

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|+.+++.|+||+|||||..
T Consensus        26 ~~G~~~~l~G~nGsGKSTLl~   46 (214)
T TIGR02673        26 RKGEFLFLTGPSGAGKTTLLK   46 (214)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            568899999999999999765


No 78 
>COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism]
Probab=90.78  E-value=0.11  Score=53.40  Aligned_cols=21  Identities=38%  Similarity=0.612  Sum_probs=18.9

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|.+..++|.||||||||+.
T Consensus        31 ~~Ge~lgivGeSGsGKSTL~r   51 (252)
T COG1124          31 ERGETLGIVGESGSGKSTLAR   51 (252)
T ss_pred             cCCCEEEEEcCCCCCHHHHHH
Confidence            568899999999999999875


No 79 
>TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein. Phosphonates are a class of phosphorus-containing organic compound with a stable direct C-P bond rather than a C-O-P linkage. A number of bacterial species have operons, typically about 14 genes in size, with genes for ATP-dependent transport of phosphonates, degradation, and regulation of the expression of the system. Members of this protein family are the ATP-binding cassette component of tripartite ABC transporters of phosphonates.
Probab=90.77  E-value=0.12  Score=51.03  Aligned_cols=21  Identities=38%  Similarity=0.629  Sum_probs=18.8

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|..+++.|+||+|||||..
T Consensus        26 ~~Ge~~~l~G~nGsGKSTLl~   46 (243)
T TIGR02315        26 NPGEFVAIIGPSGAGKSTLLR   46 (243)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            568999999999999999765


No 80 
>cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively.  Histidine permease is a multisubunit complex containing the HisQ and HisM integral membrane subunits and two copies of HisP.  HisP has properties intermediate between those of integral and peripheral membrane proteins and is accessible from both sides of the membrane, presumably by its interaction with HisQ and HisM.  The two HisP subunits form a homodimer within the complex.  The domain structure of the amino acid uptake systems is typical for prokaryote extracellular solute binding protein-dependent uptake systems.  All of the amino acid uptake systems also have at least one, and in a few cases, two extracellular solute binding proteins located in the periplasm of Gram-negative bacteria, or attached to the cell membrane of Gram-positive bacteria.  The best-studied member of the PAAT (polar amino acid transport) family is the HisJQM
Probab=90.71  E-value=0.13  Score=49.81  Aligned_cols=21  Identities=48%  Similarity=0.800  Sum_probs=18.8

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|+.+++.|+||+|||||..
T Consensus        24 ~~G~~~~l~G~nGsGKSTLl~   44 (213)
T cd03262          24 KKGEVVVIIGPSGSGKSTLLR   44 (213)
T ss_pred             CCCCEEEEECCCCCCHHHHHH
Confidence            578999999999999999765


No 81 
>TIGR00958 3a01208 Conjugate Transporter-2 (CT2) Family protein.
Probab=90.67  E-value=0.036  Score=64.03  Aligned_cols=21  Identities=38%  Similarity=0.722  Sum_probs=18.9

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      +.|..+++.|+||+|||||..
T Consensus       505 ~~Ge~vaIvG~SGsGKSTLl~  525 (711)
T TIGR00958       505 HPGEVVALVGPSGSGKSTVAA  525 (711)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            568899999999999999765


No 82 
>TIGR03796 NHPM_micro_ABC1 NHPM bacteriocin system ABC transporter, peptidase/ATP-binding protein. This protein describes an multidomain ABC transporter subunit that is one of three protein families associated with some regularity with a distinctive family of putative bacteriocins. It includes a bacteriocin-processing peptidase domain at the N-terminus. Model TIGR03793 describes a conserved propeptide region for this bacteriocin family, unusual because it shows obvious homology a region of the enzyme nitrile hydratase up to the classic Gly-Gly cleavage motif. This family is therefore predicted to be a subunit of a bacteriocin processing and export system characteristic to this system that we designate NHPM, Nitrile Hydratase Propeptide Microcin.
Probab=90.67  E-value=0.043  Score=62.99  Aligned_cols=21  Identities=33%  Similarity=0.597  Sum_probs=18.9

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      +.|+.+++.|.||+|||||..
T Consensus       503 ~~Ge~vaIvG~sGsGKSTLlk  523 (710)
T TIGR03796       503 QPGQRVALVGGSGSGKSTIAK  523 (710)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            568999999999999999765


No 83 
>cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity.  In eubacteria and archaea, the typical organization consists of one ABC and one or two IMs.  Eukaryote systems of the ABCA subfamily display ABC domains strongly similar to this family.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region in addition to the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=90.65  E-value=0.13  Score=49.88  Aligned_cols=21  Identities=33%  Similarity=0.561  Sum_probs=18.9

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|+.+++.|+||+|||||..
T Consensus        24 ~~G~~~~i~G~nGsGKSTLl~   44 (210)
T cd03269          24 EKGEIFGLLGPNGAGKTTTIR   44 (210)
T ss_pred             cCCcEEEEECCCCCCHHHHHH
Confidence            578999999999999999765


No 84 
>COG4988 CydD ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones]
Probab=90.65  E-value=0.062  Score=60.66  Aligned_cols=72  Identities=24%  Similarity=0.386  Sum_probs=38.7

Q ss_pred             CCCCEEEEEecCCCCcccccccCCCce-eecCceeecCCCccccCCceeEeecCCCCCCCchhhhhccccceeeeeEE
Q 008523          332 KDGDVALFFGLSGTGKTTLSTDHNRYL-IGDDEHCWGDNGVSNIEGGCYAKCIDLSREKEPDIWNAIKFGAVLENVVF  408 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsad~~r~l-IgDDe~~w~~~Gvfn~EgGcyaK~~dLs~e~EP~I~~ai~f~ailENV~~  408 (563)
                      +.|+.+++.|.||||||||..--...+ -...+.-|++.-.-++....+-|.+.+=. +.|-|++    ++|-||+.|
T Consensus       345 ~~g~~talvG~SGaGKSTLl~lL~G~~~~~~G~I~vng~~l~~l~~~~~~k~i~~v~-Q~p~lf~----gTireNi~l  417 (559)
T COG4988         345 KAGQLTALVGASGAGKSTLLNLLLGFLAPTQGEIRVNGIDLRDLSPEAWRKQISWVS-QNPYLFA----GTIRENILL  417 (559)
T ss_pred             cCCcEEEEECCCCCCHHHHHHHHhCcCCCCCceEEECCccccccCHHHHHhHeeeeC-CCCcccc----ccHHHHhhc
Confidence            678999999999999999765111110 01122333322233333333334333322 4555554    477777666


No 85 
>cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient.  The Pst system of E. coli comprises four distinct subunits encoded by the pstS, pstA, pstB, and pstC genes.  The PstS protein is a phosphate-binding protein located in the periplasmic space. P stA and PstC are hydrophobic and they form the transmembrane portion of the Pst system.  PstB is the catalytic subunit, which couples the energy of ATP hydrolysis to the import of phosphate across cellular membranes through the Pst system, often referred as ABC-protein.  PstB belongs to one of the largest superfamilies of proteins characterized by a highly conserved adenosine triphosphate (ATP) binding cassette (ABC), which is also a nucleotide binding domain (NBD).
Probab=90.61  E-value=0.13  Score=50.42  Aligned_cols=21  Identities=38%  Similarity=0.680  Sum_probs=18.8

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|..+++.|+||+|||||..
T Consensus        24 ~~Ge~~~i~G~nGsGKSTLl~   44 (227)
T cd03260          24 PKGEITALIGPSGCGKSTLLR   44 (227)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            568999999999999999764


No 86 
>cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin.  In addition to DrrA, the complex includes an integral membrane protein called DrrB.  DrrA belongs to the ABC family of transporters and shares sequence and functional similarities with a protein found in cancer cells called  P-glycoprotein.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region in addition to the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=90.60  E-value=0.13  Score=50.24  Aligned_cols=21  Identities=33%  Similarity=0.577  Sum_probs=18.8

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|..+++.|+||+|||||..
T Consensus        24 ~~Ge~~~i~G~nGsGKSTLl~   44 (220)
T cd03265          24 RRGEIFGLLGPNGAGKTTTIK   44 (220)
T ss_pred             CCCCEEEEECCCCCCHHHHHH
Confidence            568999999999999999765


No 87 
>cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane.  The FtsE/X transporter is thought to be involved in cell division and is important for assembly or stability of the septal ring.
Probab=90.59  E-value=0.13  Score=49.77  Aligned_cols=21  Identities=38%  Similarity=0.681  Sum_probs=18.9

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|..+++.|+||+|||||..
T Consensus        25 ~~G~~~~i~G~nGsGKSTLl~   45 (214)
T cd03292          25 SAGEFVFLVGPSGAGKSTLLK   45 (214)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            568999999999999999765


No 88 
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold. The ASCE division also includes ABC, RecA-like, VirD4-like, PilT-like, and SF1/2 helicases. Members of the AAA+ ATPases function as molecular chaperons, ATPase subunits of proteases, helicases, or nucleic-acid stimulated ATPases. The AAA+ proteins contain several distinct features in addition to the conserved alpha-beta-alpha core domain structure and the Walker A and B motifs of the P-loop NTPases.
Probab=90.57  E-value=0.13  Score=44.35  Aligned_cols=20  Identities=45%  Similarity=0.657  Sum_probs=17.5

Q ss_pred             CCCEEEEEecCCCCcccccc
Q 008523          333 DGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       333 ~G~valfFGLSGTGKTTLsa  352 (563)
                      .+..+++.|++|||||||..
T Consensus        18 ~~~~v~i~G~~G~GKT~l~~   37 (151)
T cd00009          18 PPKNLLLYGPPGTGKTTLAR   37 (151)
T ss_pred             CCCeEEEECCCCCCHHHHHH
Confidence            45689999999999999876


No 89 
>cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars. Members of this family play a wide variety of essential roles in nucleotide metabolism, the biosynthesis of coenzymes and aromatic compounds, as well as the metabolism of sugar and sulfate.
Probab=90.54  E-value=0.095  Score=42.77  Aligned_cols=17  Identities=35%  Similarity=0.573  Sum_probs=15.0

Q ss_pred             EEEEEecCCCCcccccc
Q 008523          336 VALFFGLSGTGKTTLST  352 (563)
Q Consensus       336 valfFGLSGTGKTTLsa  352 (563)
                      ++++.|.+|+||||++.
T Consensus         1 ~i~i~G~~gsGKst~~~   17 (69)
T cd02019           1 IIAITGGSGSGKSTVAK   17 (69)
T ss_pred             CEEEECCCCCCHHHHHH
Confidence            36889999999999887


No 90 
>cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota.  The transition metal cobalt is an essential component of many enzymes and must be transported into cells in appropriate amounts when needed.  The CbiMNQO family ABC transport system is involved in cobalt transport in association with the cobalamin (vitamin B12) biosynthetic pathways.  Most cobalt (Cbi) transport systems possess a separate CbiN component, the cobalt-binding periplasmic protein, and they are encoded by the conserved gene cluster cbiMNQO.  Both the CbiM and CbiQ proteins are integral cytoplasmic membrane proteins, and the CbiO protein has the linker peptide and the Walker A and B motifs commonly found in the ATPase components of the ABC-type transport systems.
Probab=90.49  E-value=0.13  Score=49.63  Aligned_cols=21  Identities=38%  Similarity=0.642  Sum_probs=18.8

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|..+++.|+||+|||||..
T Consensus        24 ~~Ge~~~i~G~nGsGKSTLl~   44 (205)
T cd03226          24 YAGEIIALTGKNGAGKTTLAK   44 (205)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            578899999999999999765


No 91 
>cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine.  MJ1267 is a branched-chain amino acid transporter with 29% similarity to both the LivF and LivG components of the E. coli  branched-chain amino acid transporter.  MJ1267 contains an insertion from residues 114 to 123 characteristic of LivG (Leucine-Isoleucine-Valine) homologs.  The branched-chain amino acid transporter from E. coli comprises a heterodimer of ABCs (LivF and LivG), a heterodimer of six-helix TM domains (LivM and LivH), and one of two alternative soluble periplasmic substrate binding proteins (LivK or LivJ).
Probab=90.45  E-value=0.13  Score=50.57  Aligned_cols=21  Identities=38%  Similarity=0.653  Sum_probs=18.9

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|..+++.|+||+|||||..
T Consensus        24 ~~Ge~~~l~G~nGsGKSTLl~   44 (236)
T cd03219          24 RPGEIHGLIGPNGAGKTTLFN   44 (236)
T ss_pred             cCCcEEEEECCCCCCHHHHHH
Confidence            578999999999999999765


No 92 
>cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE).  The NikABCDE system of E. coli belongs to this family and is composed of the periplasmic binding protein NikA, two integral membrane components (NikB and NikC), and two ATPase (NikD and NikE).  The NikABCDE transporter is synthesized under anaerobic conditions to meet the increased demand for nickel resulting from hydrogenase synthesis.  The molecular mechanism of nickel uptake in many bacteria and most archaea is not known.  Many other members of this ABC family are also involved in the uptake of dipeptides and oligopeptides.  The oligopeptide transport system (Opp) is a five-component ABC transport composed of a membrane-anchored substrate binding proteins (SRP), OppA, two transmembrane proteins, OppB and OppC, and two ATP-binding domains, OppD and OppF.
Probab=90.39  E-value=0.14  Score=50.00  Aligned_cols=21  Identities=43%  Similarity=0.672  Sum_probs=19.0

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|..+++.|+||+|||||..
T Consensus        29 ~~Ge~~~i~G~nGsGKSTLl~   49 (228)
T cd03257          29 KKGETLGLVGESGSGKSTLAR   49 (228)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            578999999999999999765


No 93 
>PRK03846 adenylylsulfate kinase; Provisional
Probab=90.39  E-value=0.13  Score=49.90  Aligned_cols=21  Identities=48%  Similarity=0.756  Sum_probs=18.8

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..+.+++|.|+||+|||||+.
T Consensus        22 ~~~~~i~i~G~~GsGKSTla~   42 (198)
T PRK03846         22 HKGVVLWFTGLSGSGKSTVAG   42 (198)
T ss_pred             CCCEEEEEECCCCCCHHHHHH
Confidence            567899999999999999876


No 94 
>PF00004 AAA:  ATPase family associated with various cellular activities (AAA);  InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport. Some of them function as molecular chaperones, subunits of proteolytic complexes or independent proteases (FtsH, Lon). They also act as DNA helicases and transcription factors []. AAA ATPases belong to the AAA+ superfamily of ringshaped P-loop NTPases, which act via the energy-dependent unfolding of macromolecules [, ]. There are six major clades of AAA domains (proteasome subunits, metalloproteases, domains D1 and D2 of ATPases with two AAA domains, the MSP1/katanin/spastin group and BCS1 and it homologues), as well as a number of deeply branching minor clades []. They assemble into oligomeric assemblies (often hexamers) that form a ring-shaped structure with a central pore. These proteins produce a molecular motor that couples ATP binding and hydrolysis to changes in conformational states that act upon a target substrate, either translocating or remodelling it []. They are found in all living organisms and share the common feature of the presence of a highly conserved AAA domain called the AAA module. This domain is responsible for ATP binding and hydrolysis. It contains 200-250 residues, among them there are two classical motifs, Walker A (GX4GKT) and Walker B (HyDE) []. The functional variety seen between AAA ATPases is in part due to their extensive number of accessory domains and factors, and to their variable organisation within oligomeric assemblies, in addition to changes in key functional residues within the ATPase domain itself. More information about these proteins can be found at Protein of the Month: AAA ATPases [].; GO: 0005524 ATP binding; PDB: 3H4M_A 1NSF_A 1D2N_A 1HQY_E 1DO0_E 1DO2_C 1G4B_E 1HT1_F 1G4A_F 1HT2_G ....
Probab=90.38  E-value=0.11  Score=45.43  Aligned_cols=16  Identities=56%  Similarity=0.804  Sum_probs=14.3

Q ss_pred             EEEEecCCCCcccccc
Q 008523          337 ALFFGLSGTGKTTLST  352 (563)
Q Consensus       337 alfFGLSGTGKTTLsa  352 (563)
                      +++.|++|||||||+.
T Consensus         1 ill~G~~G~GKT~l~~   16 (132)
T PF00004_consen    1 ILLHGPPGTGKTTLAR   16 (132)
T ss_dssp             EEEESSTTSSHHHHHH
T ss_pred             CEEECcCCCCeeHHHH
Confidence            5899999999999875


No 95 
>cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=90.34  E-value=0.14  Score=50.53  Aligned_cols=21  Identities=38%  Similarity=0.707  Sum_probs=18.8

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|+.+++.|+||+|||||..
T Consensus        24 ~~Ge~~~l~G~nGsGKSTLl~   44 (235)
T cd03261          24 RRGEILAIIGPSGSGKSTLLR   44 (235)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            578999999999999999765


No 96 
>cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup.  This family is comprised of proteins involved in the transport of apparently unrelated solutes and proteins specific for di- and oligosaccharides and polyols.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides and more complex organic molecules.  The nucleotide-binding domain shows the highest similarity between all members of the family.   ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=90.34  E-value=0.14  Score=49.67  Aligned_cols=21  Identities=43%  Similarity=0.645  Sum_probs=18.9

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|..+++.|+||+|||||..
T Consensus        24 ~~Ge~~~i~G~nGsGKSTLl~   44 (213)
T cd03259          24 EPGEFLALLGPSGCGKTTLLR   44 (213)
T ss_pred             cCCcEEEEECCCCCCHHHHHH
Confidence            568999999999999999765


No 97 
>cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters.  This family includes transporters involved in the uptake of various metallic cations such as iron, manganese, and zinc.  The ATPases of this group of transporters are very similar to members of iron-siderophore uptake family suggesting that they share a common ancestor.  The best characterized metal-type ABC transporters are the YfeABCD system of Y. pestis, the SitABCD system of Salmonella enterica serovar Typhimurium, and the SitABCD transporter of Shigella flexneri.  Moreover other uncharacterized homologs of these metal-type transporters are mainly found in pathogens like Haemophilus or enteroinvasive E. coli isolates.
Probab=90.29  E-value=0.14  Score=49.64  Aligned_cols=21  Identities=38%  Similarity=0.616  Sum_probs=19.0

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|..+++.|+||+|||||..
T Consensus        23 ~~Ge~~~l~G~nGsGKSTLl~   43 (213)
T cd03235          23 KPGEFLAIVGPNGAGKSTLLK   43 (213)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            678999999999999999765


No 98 
>KOG4238 consensus Bifunctional ATP sulfurylase/adenosine 5'-phosphosulfate kinase [Nucleotide transport and metabolism]
Probab=90.27  E-value=0.11  Score=56.05  Aligned_cols=35  Identities=37%  Similarity=0.638  Sum_probs=26.7

Q ss_pred             CCCEEEEEecCCCCcccccccCCCceeecCceeec
Q 008523          333 DGDVALFFGLSGTGKTTLSTDHNRYLIGDDEHCWG  367 (563)
Q Consensus       333 ~G~valfFGLSGTGKTTLsad~~r~lIgDDe~~w~  367 (563)
                      .|-+++|.||||+||||+|..-+++|+.-..-+.+
T Consensus        49 rgctvw~tglsgagkttis~ale~~l~~~gipcy~   83 (627)
T KOG4238|consen   49 RGCTVWLTGLSGAGKTTISFALEEYLVSHGIPCYS   83 (627)
T ss_pred             cceeEEeeccCCCCcceeehHHHHHHHhcCCcccc
Confidence            45689999999999999998666766655544444


No 99 
>cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds.  Mutations of members of ABCA subfamily are associated with human genetic diseases, such as, familial high-density lipoprotein (HDL) deficiency, neonatal surfactant deficiency, degenerative retinopathies, and congenital keratinization disorders.  The ABCA1 protein is involved in disorders of cholesterol transport and high-density lipoprotein (HDL) biosynthesis.  The ABCA4 (ABCR) protein transports vitamin A derivatives in the outer segments of photoreceptor cells, and therefore, performs a crucial step in the visual cycle.  The ABCA genes are not present in yeast.  However, evolutionary studies of ABCA genes indicate that they arose as transporters that subsequently duplicated and that certain sets of ABCA genes were lost in different eukaryotic lineages.
Probab=90.22  E-value=0.15  Score=49.74  Aligned_cols=21  Identities=33%  Similarity=0.515  Sum_probs=18.9

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|+.+++.|+||+|||||..
T Consensus        26 ~~Ge~~~i~G~nGsGKSTLl~   46 (220)
T cd03263          26 YKGEIFGLLGHNGAGKTTTLK   46 (220)
T ss_pred             cCCcEEEEECCCCCCHHHHHH
Confidence            568999999999999999765


No 100
>TIGR02204 MsbA_rel ABC transporter, permease/ATP-binding protein. This protein is related to a Proteobacterial ATP transporter that exports lipid A and to eukaryotic P-glycoproteins.
Probab=90.20  E-value=0.041  Score=61.32  Aligned_cols=21  Identities=38%  Similarity=0.651  Sum_probs=19.1

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      +.|+.+++.|.||+|||||..
T Consensus       364 ~~Ge~i~IvG~sGsGKSTLlk  384 (576)
T TIGR02204       364 RPGETVALVGPSGAGKSTLFQ  384 (576)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            678999999999999999765


No 101
>COG3638 ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism]
Probab=90.18  E-value=0.18  Score=51.89  Aligned_cols=37  Identities=24%  Similarity=0.324  Sum_probs=26.7

Q ss_pred             CCCCEEEEEecCCCCcccccc------cC-CCceeecCceeecC
Q 008523          332 KDGDVALFFGLSGTGKTTLST------DH-NRYLIGDDEHCWGD  368 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa------d~-~r~lIgDDe~~w~~  368 (563)
                      ..|.-+++.|+||+|||||..      |+ ...++.+++-.|.-
T Consensus        28 ~~GE~VaiIG~SGaGKSTLLR~lngl~d~t~G~i~~~g~~i~~~   71 (258)
T COG3638          28 NQGEMVAIIGPSGAGKSTLLRSLNGLVDPTSGEILFNGVQITKL   71 (258)
T ss_pred             CCCcEEEEECCCCCcHHHHHHHHhcccCCCcceEEecccchhcc
Confidence            568889999999999999875      44 34456666555543


No 102
>COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism]
Probab=90.11  E-value=0.12  Score=50.28  Aligned_cols=17  Identities=41%  Similarity=0.688  Sum_probs=15.6

Q ss_pred             EEEEEecCCCCcccccc
Q 008523          336 VALFFGLSGTGKTTLST  352 (563)
Q Consensus       336 valfFGLSGTGKTTLsa  352 (563)
                      .++|+|+||+||||++.
T Consensus         2 riiilG~pGaGK~T~A~   18 (178)
T COG0563           2 RILILGPPGAGKSTLAK   18 (178)
T ss_pred             eEEEECCCCCCHHHHHH
Confidence            47999999999999887


No 103
>cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids.  The  E. coli branched-chain amino acid transporter comprises a heterodimer of ABC transporters (LivF and LivG), a heterodimer of six-helix TM domains (LivM and LivH), and one of two alternative soluble periplasmic substrate binding proteins (LivK or LivJ).  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.
Probab=90.11  E-value=0.14  Score=49.76  Aligned_cols=21  Identities=38%  Similarity=0.741  Sum_probs=18.9

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|..+++.|+||+|||||..
T Consensus        24 ~~Ge~~~i~G~nGsGKSTLl~   44 (222)
T cd03224          24 PEGEIVALLGRNGAGKTTLLK   44 (222)
T ss_pred             cCCeEEEEECCCCCCHHHHHH
Confidence            568999999999999999765


No 104
>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos).  The Carb_Monos family is involved in the uptake of monosaccharides, such as pentoses (such as xylose, arabinose, and ribose) and hexoses (such as xylose, arabinose, and ribose), that cannot be broken down to simple sugars by hydrolysis.  Pentoses include xylose, arabinose, and ribose.  Important hexoses include glucose, galactose, and fructose.  In members of the Carb_monos family, the single hydrophobic gene product forms a homodimer while the ABC protein represents a fusion of two nucleotide-binding domains.  However, it is assumed that two copies of the ABC domains are present in the assembled transporter.
Probab=90.09  E-value=0.15  Score=47.97  Aligned_cols=21  Identities=38%  Similarity=0.722  Sum_probs=18.9

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      +.|+.+++.|+||+|||||..
T Consensus        24 ~~Ge~~~l~G~nGsGKSTLl~   44 (163)
T cd03216          24 RRGEVHALLGENGAGKSTLMK   44 (163)
T ss_pred             eCCCEEEEECCCCCCHHHHHH
Confidence            678999999999999999765


No 105
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX. Proteins in this family are now designated CbbX. Some previously were CfxQ (carbon fixation Q). Its gene is often found immmediately downstream of the Rubisco large and small chain genes, and it is suggested to be necessary for Rubisco expression. CbbX has been shown to be necessary for photoautotrophic growth. This protein belongs to the larger family of pfam00004, ATPase family Associated with various cellular Activities. Within that larger family, members of this family are most closely related to the stage V sporulation protein K, or SpoVK, in endospore-forming bacteria such as Bacillus subtilis.
Probab=90.09  E-value=0.14  Score=52.98  Aligned_cols=48  Identities=25%  Similarity=0.232  Sum_probs=29.6

Q ss_pred             hhHHHHHHHHHHhcccCceeeecccceecCCCCEEEEEecCCCCcccccc
Q 008523          303 EMKKGLFSVMHYLMPKRQILSLHSGCNMGKDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       303 EiKK~iltl~n~~l~~~G~L~mH~sanvg~~G~valfFGLSGTGKTTLsa  352 (563)
                      +.|+.+..+..++..++-.. -+ +......+..++|+|++||||||++.
T Consensus        29 ~vk~~i~e~~~~~~~~~~r~-~~-g~~~~~~~~~vll~G~pGTGKT~lA~   76 (284)
T TIGR02880        29 PVKTRIREIAALLLVERLRQ-RL-GLASAAPTLHMSFTGNPGTGKTTVAL   76 (284)
T ss_pred             HHHHHHHHHHHHHHHHHHHH-Hh-CCCcCCCCceEEEEcCCCCCHHHHHH
Confidence            68888877776643321110 01 12122235579999999999999873


No 106
>TIGR01193 bacteriocin_ABC ABC-type bacteriocin transporter. This model describes ABC-type bacteriocin transporter. The amino terminal domain (pfam03412) processes the N-terminal leader peptide from the bacteriocin while C-terminal domains resemble ABC transporter membrane protein and ATP-binding cassette domain. In general, bacteriocins are agents which are responsible for killing or inhibiting the closely related species or even different strains of the same species. Bacteriocins are usually encoded by bacterial plasmids. Bacteriocins are named after the species and hence in literature one encounters various names e.g., leucocin from Leuconostic geldium; pedicocin from Pedicoccus acidilactici; sakacin from Lactobacillus sake etc.
Probab=90.07  E-value=0.044  Score=62.99  Aligned_cols=21  Identities=38%  Similarity=0.612  Sum_probs=18.7

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      +.|+.+++.|.||+|||||..
T Consensus       498 ~~G~~vaIvG~SGsGKSTLlk  518 (708)
T TIGR01193       498 KMNSKTTIVGMSGSGKSTLAK  518 (708)
T ss_pred             CCCCEEEEECCCCCCHHHHHH
Confidence            558899999999999999765


No 107
>cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system.  Phosphonates are a class of organophosphorus compounds characterized by a chemically stable carbon-to-phosphorus (C-P) bond.  Phosphonates are widespread among naturally occurring compounds in all kingdoms of wildlife, but only procaryotic microorganisms are able to cleave this bond.  Certain bacteria such as E. coli can use alkylphosphonates as a phosphorus source.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=90.04  E-value=0.16  Score=50.16  Aligned_cols=21  Identities=38%  Similarity=0.645  Sum_probs=18.9

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|..+++.|+||+|||||..
T Consensus        25 ~~Ge~~~i~G~nGsGKSTLl~   45 (241)
T cd03256          25 NPGEFVALIGPSGAGKSTLLR   45 (241)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            578999999999999999765


No 108
>PRK14527 adenylate kinase; Provisional
Probab=90.02  E-value=0.15  Score=49.05  Aligned_cols=20  Identities=35%  Similarity=0.654  Sum_probs=17.8

Q ss_pred             CCCEEEEEecCCCCcccccc
Q 008523          333 DGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       333 ~G~valfFGLSGTGKTTLsa  352 (563)
                      .+..++|+|++|+||||++.
T Consensus         5 ~~~~i~i~G~pGsGKsT~a~   24 (191)
T PRK14527          5 KNKVVIFLGPPGAGKGTQAE   24 (191)
T ss_pred             CCcEEEEECCCCCCHHHHHH
Confidence            46789999999999999875


No 109
>cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=90.00  E-value=0.15  Score=49.88  Aligned_cols=21  Identities=38%  Similarity=0.673  Sum_probs=18.8

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|..+++.|+||+|||||..
T Consensus        28 ~~G~~~~i~G~nGsGKSTLl~   48 (220)
T cd03293          28 EEGEFVALVGPSGCGKSTLLR   48 (220)
T ss_pred             eCCcEEEEECCCCCCHHHHHH
Confidence            568899999999999999765


No 110
>cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport.  Other members of this system include the MetP permease and  the MetQ substrate binding protein.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=90.00  E-value=0.16  Score=50.05  Aligned_cols=21  Identities=38%  Similarity=0.591  Sum_probs=18.9

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|+.+++.|+||+|||||..
T Consensus        29 ~~Ge~~~l~G~nGsGKSTLl~   49 (233)
T cd03258          29 PKGEIFGIIGRSGAGKSTLIR   49 (233)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            568999999999999999765


No 111
>TIGR03410 urea_trans_UrtE urea ABC transporter, ATP-binding protein UrtE. Members of this protein family are ABC transporter ATP-binding subunits associated with urea transport and metabolism. This protein is found in a conserved five-gene transport operon typically found adjacent to urease genes. It was shown in Cyanobacteria that disruption leads to the loss of high-affinity urea transport activity.
Probab=89.99  E-value=0.16  Score=49.93  Aligned_cols=21  Identities=43%  Similarity=0.675  Sum_probs=18.8

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|+.+++.|+||+|||||..
T Consensus        24 ~~Ge~~~l~G~nGsGKSTLl~   44 (230)
T TIGR03410        24 PKGEVTCVLGRNGVGKTTLLK   44 (230)
T ss_pred             CCCCEEEEECCCCCCHHHHHH
Confidence            568999999999999999765


No 112
>TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group. A gene pair with a fairly wide distribution consists of a polypeptide related to the lactococcin 972 (see TIGR01653) and multiple-membrane-spanning putative immunity protein (see TIGR01654). This model represents a small clade within the ABC transporters that regularly are found adjacent to these bacteriocin system gene pairs and are likely serve as export proteins.
Probab=89.95  E-value=0.15  Score=48.99  Aligned_cols=21  Identities=38%  Similarity=0.624  Sum_probs=18.8

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|..+++.|++|+|||||..
T Consensus        22 ~~Ge~~~i~G~nGsGKSTLl~   42 (206)
T TIGR03608        22 EKGKMYAIIGESGSGKSTLLN   42 (206)
T ss_pred             eCCcEEEEECCCCCCHHHHHH
Confidence            568999999999999999765


No 113
>cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance.  Bacitracin is a dodecapeptide antibiotic produced by B. licheniformis and B. subtilis.  The synthesis of bacitracin is non-ribosomally catalyzed by a multienzyme complex BcrABC.  Bacitracin has potent antibiotic activity against gram-positive bacteria.  The inhibition of peptidoglycan biosynthesis is the best characterized bacterial effect of bacitracin.  The bacitracin resistance of B. licheniformis is mediated by the ABC transporter Bcr which is composed of two identical BcrA ATP-binding subunits and one each of the integral membrane proteins, BcrB and BcrC.  B. subtilis cells carrying bcr genes on high-copy number plasmids develop collateral detergent sensitivity, a similar phenomenon in human cells with overexpressed multi-drug resistance P-glycoprotein.
Probab=89.95  E-value=0.16  Score=49.14  Aligned_cols=21  Identities=43%  Similarity=0.684  Sum_probs=18.8

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|+.+++.|+||+|||||..
T Consensus        24 ~~G~~~~i~G~nGsGKSTLl~   44 (208)
T cd03268          24 KKGEIYGFLGPNGAGKTTTMK   44 (208)
T ss_pred             cCCcEEEEECCCCCCHHHHHH
Confidence            568999999999999999765


No 114
>TIGR02857 CydD thiol reductant ABC exporter, CydD subunit. Unfortunately, the gene symbol nomenclature adopted based on this operon in B. subtilis assigns cydC to the third gene in the operon where this gene is actually homologous to the E. coli cydD gene. We have chosen to name all homologs in this family in accordance with the precedence of publication of the E. coli name, CydD
Probab=89.92  E-value=0.059  Score=59.59  Aligned_cols=21  Identities=38%  Similarity=0.586  Sum_probs=19.0

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      +.|+.+++.|.||+|||||..
T Consensus       346 ~~G~~~~ivG~sGsGKSTL~~  366 (529)
T TIGR02857       346 PPGERVALVGPSGAGKSTLLN  366 (529)
T ss_pred             CCCCEEEEECCCCCCHHHHHH
Confidence            678999999999999999765


No 115
>PRK11124 artP arginine transporter ATP-binding subunit; Provisional
Probab=89.91  E-value=0.16  Score=50.38  Aligned_cols=21  Identities=33%  Similarity=0.673  Sum_probs=18.8

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|..+++.|+||+|||||..
T Consensus        26 ~~Ge~~~i~G~nGsGKSTLl~   46 (242)
T PRK11124         26 PQGETLVLLGPSGAGKSSLLR   46 (242)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            578999999999999999765


No 116
>cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component.  The biological function of this family is not well characterized, but display ABC domains similar to members of ABCA subfamily.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=89.88  E-value=0.16  Score=49.31  Aligned_cols=19  Identities=42%  Similarity=0.606  Sum_probs=16.8

Q ss_pred             CCCEEEEEecCCCCcccccc
Q 008523          333 DGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       333 ~G~valfFGLSGTGKTTLsa  352 (563)
                      .| .+++.|+||+|||||..
T Consensus        25 ~g-~~~i~G~nGsGKSTLl~   43 (211)
T cd03264          25 PG-MYGLLGPNGAGKTTLMR   43 (211)
T ss_pred             CC-cEEEECCCCCCHHHHHH
Confidence            37 99999999999999764


No 117
>TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein. This model represents LolD, a member of the ABC transporter family (pfam00005). LolD is involved in localization of lipoproteins in some bacteria. It works with a transmembrane protein LolC, which in some species is a paralogous pair LolC and LolE. Depending on whether the residue immediately following the new, modified N-terminal Cys residue, the nascent lipoprotein may be carried further by LolA and LolB to the outer membrane, or remain at the inner membrane. The top scoring proteins excluded by this model include homologs from the archaeal genus Methanosarcina.
Probab=89.88  E-value=0.16  Score=49.45  Aligned_cols=21  Identities=38%  Similarity=0.667  Sum_probs=18.8

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|..+++.|+||+|||||..
T Consensus        29 ~~G~~~~i~G~nGsGKSTLl~   49 (221)
T TIGR02211        29 GKGEIVAIVGSSGSGKSTLLH   49 (221)
T ss_pred             cCCcEEEEECCCCCCHHHHHH
Confidence            568899999999999999765


No 118
>cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake.  NatB possess six putative membrane spanning regions at its C-terminus.  In B. subtilus, NatAB is inducible by agents such as ethanol and protonophores, which lower the protonmotive force across the membrane.  The closest sequence similarity to NatA is exhibited by DrrA of the two-component daunomycin- and doxorubicin-efflux system.  Hence, the functional NatAB is presumably assembled with two copies of a single ATP-binding protein and a single intergral membrane protein.
Probab=89.86  E-value=0.17  Score=49.29  Aligned_cols=21  Identities=43%  Similarity=0.619  Sum_probs=18.7

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|+.+++.|.||+|||||..
T Consensus        29 ~~Ge~~~i~G~nGsGKSTLl~   49 (218)
T cd03266          29 KPGEVTGLLGPNGAGKTTTLR   49 (218)
T ss_pred             cCCcEEEEECCCCCCHHHHHH
Confidence            568899999999999999765


No 119
>PRK10790 putative multidrug transporter membrane\ATP-binding components; Provisional
Probab=89.81  E-value=0.051  Score=61.04  Aligned_cols=21  Identities=29%  Similarity=0.553  Sum_probs=19.1

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      +.|+.+++.|.||+|||||..
T Consensus       365 ~~Ge~iaIvG~SGsGKSTLl~  385 (592)
T PRK10790        365 PSRGFVALVGHTGSGKSTLAS  385 (592)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            678999999999999999765


No 120
>COG1132 MdlB ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms]
Probab=89.80  E-value=0.051  Score=60.74  Aligned_cols=21  Identities=38%  Similarity=0.616  Sum_probs=18.8

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      +.|..+++.|.||+|||||..
T Consensus       353 ~~Ge~vaiVG~sGsGKSTl~~  373 (567)
T COG1132         353 EPGEKVAIVGPSGSGKSTLIK  373 (567)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            568899999999999999776


No 121
>TIGR01978 sufC FeS assembly ATPase SufC. SufC is part of the SUF system, shown in E. coli to consist of six proteins and believed to act in Fe-S cluster formation during oxidative stress. SufC forms a complex with SufB and SufD. SufC belongs to the ATP-binding cassette transporter family (pfam00005) but is no longer thought to be part of a transporter. The complex is reported as cytosolic (PubMed:12554644) or associated with the membrane (PubMed:11943156). The SUF system also includes a cysteine desulfurase (SufS, enhanced by SufE) and a probable iron-sulfur cluster assembly scaffold protein, SufA.
Probab=89.77  E-value=0.17  Score=49.96  Aligned_cols=21  Identities=43%  Similarity=0.795  Sum_probs=18.9

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|..+++.|+||+|||||..
T Consensus        24 ~~Ge~~~i~G~nGsGKSTLl~   44 (243)
T TIGR01978        24 KKGEIHAIMGPNGSGKSTLSK   44 (243)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            578999999999999999764


No 122
>TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily. Members of this family are adenylate kinase, EC 2.7.4.3. This clade is found only in eukaryotes and includes human adenylate kinase isozyme 1 (myokinase). Within the adenylate kinase superfamily, this set appears specifically closely related to a subfamily of eukaryotic UMP-CMP kinases (TIGR01359), rather than to the large clade of bacterial, archaeal, and eukaryotic adenylate kinase family members in TIGR01351.
Probab=89.73  E-value=0.16  Score=47.75  Aligned_cols=19  Identities=26%  Similarity=0.426  Sum_probs=16.5

Q ss_pred             CCEEEEEecCCCCcccccc
Q 008523          334 GDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       334 G~valfFGLSGTGKTTLsa  352 (563)
                      ...++++|++|+||||++.
T Consensus         3 ~~ii~i~G~~GsGKsTl~~   21 (188)
T TIGR01360         3 CKIIFIVGGPGSGKGTQCE   21 (188)
T ss_pred             CcEEEEECCCCCCHHHHHH
Confidence            3578999999999999875


No 123
>PF13479 AAA_24:  AAA domain
Probab=89.70  E-value=0.19  Score=49.62  Aligned_cols=33  Identities=33%  Similarity=0.418  Sum_probs=23.6

Q ss_pred             CCCEEEEEecCCCCcccccccCCCceeecCcee
Q 008523          333 DGDVALFFGLSGTGKTTLSTDHNRYLIGDDEHC  365 (563)
Q Consensus       333 ~G~valfFGLSGTGKTTLsad~~r~lIgDDe~~  365 (563)
                      .+-.++++|.||+||||++..-.+.|+-|=|.+
T Consensus         2 ~~~~~lIyG~~G~GKTt~a~~~~k~l~id~E~g   34 (213)
T PF13479_consen    2 KPIKILIYGPPGSGKTTLAASLPKPLFIDTENG   34 (213)
T ss_pred             CceEEEEECCCCCCHHHHHHhCCCeEEEEeCCC
Confidence            345699999999999998875555555444433


No 124
>cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea.  Only very few species lack representatives of the siderophore family transporters.  The E. coli BtuCD protein is an ABC transporter mediating vitamin B12 uptake.  The two ATP-binding cassettes (BtuD) are in close contact with each other, as are the two membrane-spanning subunits (BtuC); this arrangement is distinct from that observed for the E. coli lipid flippase MsbA.  The BtuC subunits provide 20 transmembrane helices grouped around a translocation pathway that is closed to the cytoplasm by a gate region, whereas the dimer arrangement of the BtuD subunits resembles the ATP-bound form of the Rad50 DNA repair enzyme.  A prominent cytoplasmic loop of BtuC forms the contact region with the ATP-binding cassette and represent a conserved motif among the ABC transporters.
Probab=89.70  E-value=0.18  Score=48.08  Aligned_cols=21  Identities=33%  Similarity=0.638  Sum_probs=18.8

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|+.+++.|+||+|||||..
T Consensus        23 ~~G~~~~l~G~nGsGKStLl~   43 (180)
T cd03214          23 EAGEIVGILGPNGAGKSTLLK   43 (180)
T ss_pred             CCCCEEEEECCCCCCHHHHHH
Confidence            578999999999999999754


No 125
>cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain.  They export degradative enzymes by using a type I protein secretion system and  lack an N-terminal signal peptide, but contain a C-terminal secretion signal.  The Type I secretion apparatus is made up of three components, an ABC transporter, a membrane fusion protein (MFP), and an outer membrane protein (OMP).  For the HlyA transporter complex, HlyB (ABC transporter) and HlyD (MFP) reside in the inner membrane of E. coli.  The OMP component is TolC, which is thought to interact with the MFP to form a continuous channel across the periplasm from the cytoplasm to the exterior.  HlyB belongs to the family of ABC transporters, which are ubiquitous, ATP-dependent transmembrane pumps or channels.  The spectrum of transport substra
Probab=89.68  E-value=0.18  Score=47.74  Aligned_cols=21  Identities=38%  Similarity=0.662  Sum_probs=18.9

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|+.+++.|++|+|||||..
T Consensus        26 ~~Ge~~~i~G~nGsGKStLl~   46 (173)
T cd03246          26 EPGESLAIIGPSGSGKSTLAR   46 (173)
T ss_pred             CCCCEEEEECCCCCCHHHHHH
Confidence            578999999999999999765


No 126
>PRK10070 glycine betaine transporter ATP-binding subunit; Provisional
Probab=89.68  E-value=0.14  Score=55.85  Aligned_cols=21  Identities=38%  Similarity=0.868  Sum_probs=19.1

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|..+++.|+||+|||||..
T Consensus        52 ~~Gei~~LvG~NGsGKSTLLr   72 (400)
T PRK10070         52 EEGEIFVIMGLSGSGKSTMVR   72 (400)
T ss_pred             cCCCEEEEECCCCchHHHHHH
Confidence            679999999999999999765


No 127
>TIGR02881 spore_V_K stage V sporulation protein K. Members of this protein family are the stage V sporulation protein K (SpoVK), a close homolog of the Rubisco expression protein CbbX (TIGR02880) and a members of the ATPase family associated with various cellular activities (pfam00004). Members are strictly limited to bacterial endospore-forming species, but are not universal in this group and are missing from the Clostridium group.
Probab=89.67  E-value=0.17  Score=51.26  Aligned_cols=43  Identities=26%  Similarity=0.319  Sum_probs=28.4

Q ss_pred             hhHHHHHHHHHHhcc-----cCceeeecccceecCCCCEEEEEecCCCCcccccc
Q 008523          303 EMKKGLFSVMHYLMP-----KRQILSLHSGCNMGKDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       303 EiKK~iltl~n~~l~-----~~G~L~mH~sanvg~~G~valfFGLSGTGKTTLsa  352 (563)
                      +.|+.+..+.+++..     ++|.-       ..+....++|+|++||||||++.
T Consensus        13 ~vk~~i~~~~~~~~~~~~~~~~g~~-------~~~~~~~vll~GppGtGKTtlA~   60 (261)
T TIGR02881        13 EVKALIKEIYAWIQINEKRKEEGLK-------TSKQVLHMIFKGNPGTGKTTVAR   60 (261)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHcCCC-------CCCCcceEEEEcCCCCCHHHHHH
Confidence            577777766655422     22221       22334579999999999999875


No 128
>COG1341 Predicted GTPase or GTP-binding protein [General function prediction only]
Probab=89.66  E-value=0.24  Score=53.99  Aligned_cols=17  Identities=41%  Similarity=0.651  Sum_probs=16.0

Q ss_pred             EEEEEecCCCCcccccc
Q 008523          336 VALFFGLSGTGKTTLST  352 (563)
Q Consensus       336 valfFGLSGTGKTTLsa  352 (563)
                      ++++.|+..+|||||++
T Consensus        75 ~vmvvG~vDSGKSTLt~   91 (398)
T COG1341          75 VVMVVGPVDSGKSTLTT   91 (398)
T ss_pred             EEEEECCcCcCHHHHHH
Confidence            69999999999999987


No 129
>PF00485 PRK:  Phosphoribulokinase / Uridine kinase family;  InterPro: IPR006083 Phosphoribulokinase (PRK) 2.7.1.19 from EC catalyses the ATP-dependent phosphorylation of ribulose-5-phosphate to ribulose-1,5-phosphate, a key step in the pentose phosphate pathway where carbon dioxide is assimilated by autotrophic organisms []. In general, plant enzymes are light-activated by the thioredoxin/ferredoxin system, while those from photosynthetic bacteria are regulated by a system that has an absolute requirement for NADH. Thioredoxin/ferredoxin regulation is mediated by the reversible oxidation/reduction of sulphydryl and disulphide groups.  Uridine kinase (pyrimidine ribonucleoside kinase) is the rate-limiting enzyme in the pyrimidine salvage pathway. It catalyzes the following reaction:  ATP + Uridine = ADP + UMP   Pantothenate kinase (2.7.1.33 from EC) catalyzes the rate-limiting step in the biosynthesis of coenzyme A, the conversion of pantothenate to D-4'-phosphopantothenate in the presence of ATP. ; GO: 0005524 ATP binding, 0016301 kinase activity, 0008152 metabolic process; PDB: 2ZSE_A 2ZS7_A 3AF0_A 3AVP_A 2ZS9_A 2ZS8_A 3AEZ_A 2ZSB_A 2ZSD_A 2GEV_A ....
Probab=89.63  E-value=0.16  Score=49.07  Aligned_cols=17  Identities=47%  Similarity=0.612  Sum_probs=15.3

Q ss_pred             EEEEEecCCCCcccccc
Q 008523          336 VALFFGLSGTGKTTLST  352 (563)
Q Consensus       336 valfFGLSGTGKTTLsa  352 (563)
                      ++.+.|+||+|||||+.
T Consensus         1 IIgI~G~sgSGKTTla~   17 (194)
T PF00485_consen    1 IIGIAGPSGSGKTTLAK   17 (194)
T ss_dssp             EEEEEESTTSSHHHHHH
T ss_pred             CEEEECCCCCCHHHHHH
Confidence            47899999999999887


No 130
>PF05496 RuvB_N:  Holliday junction DNA helicase ruvB N-terminus;  InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair. Branch migration is catalysed by the RuvB protein that is targeted to the Holliday junction by the structure specific RuvA protein []. This group of sequences contain this signature which is located in the N-terminal region of the proteins.; GO: 0009378 four-way junction helicase activity, 0006281 DNA repair, 0006310 DNA recombination; PDB: 1IQP_B 3PFI_B 1IXR_C 1HQC_B 1IXS_B.
Probab=89.62  E-value=0.14  Score=52.14  Aligned_cols=18  Identities=56%  Similarity=0.885  Sum_probs=15.8

Q ss_pred             CEEEEEecCCCCcccccc
Q 008523          335 DVALFFGLSGTGKTTLST  352 (563)
Q Consensus       335 ~valfFGLSGTGKTTLsa  352 (563)
                      +.++|+|+.|+|||||+.
T Consensus        51 ~h~lf~GPPG~GKTTLA~   68 (233)
T PF05496_consen   51 DHMLFYGPPGLGKTTLAR   68 (233)
T ss_dssp             -EEEEESSTTSSHHHHHH
T ss_pred             ceEEEECCCccchhHHHH
Confidence            458999999999999987


No 131
>cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity.  In bacteria and archaea, these transporters usually include an ATP-binding protein and one or two integral membrane proteins.  Eukaryote systems of the ABCA subfamily display ABC domains that are quite similar to this family.  The ATP-binding domain shows the highest similarity between all members of the ABC transporter family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=89.60  E-value=0.18  Score=47.76  Aligned_cols=21  Identities=38%  Similarity=0.651  Sum_probs=18.8

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|+.+++.|+||+|||||..
T Consensus        24 ~~Ge~~~i~G~nGsGKStLl~   44 (173)
T cd03230          24 EKGEIYGLLGPNGAGKTTLIK   44 (173)
T ss_pred             cCCcEEEEECCCCCCHHHHHH
Confidence            568999999999999999764


No 132
>TIGR00150 HI0065_YjeE ATPase, YjeE family. Members of this family have a conserved nucleotide-binding motif GXXGXGKT and a nucleotide-binding fold. Member protein YjeE of Haemophilus influenzae (HI0065) was shown to have ATPase activity.
Probab=89.49  E-value=0.18  Score=47.16  Aligned_cols=21  Identities=48%  Similarity=0.545  Sum_probs=19.0

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      +.|+++++.|+.|+|||||+.
T Consensus        20 ~~~~~i~l~G~lGaGKTtl~~   40 (133)
T TIGR00150        20 DFGTVVLLKGDLGAGKTTLVQ   40 (133)
T ss_pred             CCCCEEEEEcCCCCCHHHHHH
Confidence            568899999999999999876


No 133
>PRK10908 cell division protein FtsE; Provisional
Probab=89.48  E-value=0.18  Score=49.30  Aligned_cols=21  Identities=43%  Similarity=0.746  Sum_probs=19.0

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|+.+++.|+||+|||||..
T Consensus        26 ~~Ge~~~i~G~nGsGKSTLl~   46 (222)
T PRK10908         26 RPGEMAFLTGHSGAGKSTLLK   46 (222)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            678999999999999999765


No 134
>cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK.  ATP binding cassette (ABC) proteins function from bacteria to human, mediating the translocation of substances into and out of cells or organelles.  ABC transporters contain two transmembrane-spanning domains (TMDs) or subunits and two nucleotide binding domains (NBDs) or subunits that couple transport to the hydrolysis of ATP.  In the maltose transport system, the periplasmic maltose binding protein (MBP) stimulates the ATPase activity of the membrane-associated transporter, which consists of two transmembrane subunits, MalF and MalG, and two copies of the ATP binding subunit, MalK, and becomes tightly bound to the transporter in the catalytic transition state, ensuring that maltose is passed to the transporter as ATP is hydrolyzed.
Probab=89.47  E-value=0.18  Score=48.79  Aligned_cols=21  Identities=43%  Similarity=0.689  Sum_probs=18.9

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|+.+++.|++|+|||||..
T Consensus        24 ~~Ge~~~l~G~nGsGKSTLl~   44 (213)
T cd03301          24 ADGEFVVLLGPSGCGKTTTLR   44 (213)
T ss_pred             cCCcEEEEECCCCCCHHHHHH
Confidence            578999999999999999765


No 135
>TIGR03265 PhnT2 putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein. This ABC transporter ATP-binding protein is found in a number of genomes in operon-like contexts strongly suggesting a substrate specificity for 2-aminoethylphosphonate (2-AEP). The characterized PhnSTUV system is absent in the genomes in which this system is found. These genomes encode systems for the catabolism of 2-AEP, making the need for a 2-AEP-specific transporter likely.
Probab=89.46  E-value=0.18  Score=53.92  Aligned_cols=21  Identities=48%  Similarity=0.711  Sum_probs=18.8

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|..++++|+||||||||..
T Consensus        28 ~~Ge~~~l~GpsGsGKSTLLr   48 (353)
T TIGR03265        28 KKGEFVCLLGPSGCGKTTLLR   48 (353)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            568999999999999999764


No 136
>PRK13540 cytochrome c biogenesis protein CcmA; Provisional
Probab=89.44  E-value=0.19  Score=48.61  Aligned_cols=21  Identities=38%  Similarity=0.518  Sum_probs=18.9

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|+.+++.|+||+|||||..
T Consensus        25 ~~Ge~~~l~G~nGsGKSTLl~   45 (200)
T PRK13540         25 PAGGLLHLKGSNGAGKTTLLK   45 (200)
T ss_pred             CCCCEEEEECCCCCCHHHHHH
Confidence            578999999999999999765


No 137
>cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=89.43  E-value=0.19  Score=47.78  Aligned_cols=21  Identities=38%  Similarity=0.735  Sum_probs=18.8

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|..+.+.|++|+|||||..
T Consensus        24 ~~G~~~~i~G~nGsGKSTLl~   44 (178)
T cd03229          24 EAGEIVALLGPSGSGKSTLLR   44 (178)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            578999999999999999754


No 138
>cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids.  The genes yhbG and yhbN are located in a single operon and may function together in cell envelope during biogenesis.  YhbG is the putative ATP-binding cassette component and YhbN is the putative periplasmic-binding protein.  Depletion of each gene product leads to growth arrest, irreversible cell damage and loss of viability in E. coli.  The YhbG homolog (NtrA) is essential in Rhizobium meliloti, a symbiotic nitrogen-fixing bacterium.
Probab=89.42  E-value=0.18  Score=49.48  Aligned_cols=21  Identities=38%  Similarity=0.594  Sum_probs=18.7

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|..+++.|++|+|||||..
T Consensus        24 ~~Ge~~~l~G~nGsGKSTLl~   44 (232)
T cd03218          24 KQGEIVGLLGPNGAGKTTTFY   44 (232)
T ss_pred             cCCcEEEEECCCCCCHHHHHH
Confidence            568899999999999999764


No 139
>PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional
Probab=89.32  E-value=0.19  Score=49.69  Aligned_cols=21  Identities=38%  Similarity=0.665  Sum_probs=19.0

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|..+++.|+||+|||||..
T Consensus        33 ~~Ge~~~l~G~nGsGKSTLl~   53 (233)
T PRK11629         33 GEGEMMAIVGSSGSGKSTLLH   53 (233)
T ss_pred             cCCcEEEEECCCCCCHHHHHH
Confidence            568899999999999999765


No 140
>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids.  RLI's are not transport proteins, and thus cluster with a group of soluble proteins that lack the transmembrane components commonly found in other members of the family.  Structurally, RLI's have an N-terminal Fe-S domain and two nucleotide-binding domains, which are arranged to form two composite active sites in their interface cleft.  RLI is one of the most conserved enzymes between archaea and eukaryotes with a sequence identity more than 48%.  The high degree of evolutionary conservation suggests that RLI performs a central role in archaeal and eukaryotic physiology.
Probab=89.30  E-value=0.18  Score=48.84  Aligned_cols=21  Identities=48%  Similarity=0.659  Sum_probs=18.8

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      +.|..+++.|+||+|||||..
T Consensus        23 ~~Ge~~~l~G~nGsGKSTLl~   43 (177)
T cd03222          23 KEGEVIGIVGPNGTGKTTAVK   43 (177)
T ss_pred             CCCCEEEEECCCCChHHHHHH
Confidence            678899999999999999765


No 141
>cd03254 ABCC_Glucan_exporter_like Glucan exporter ATP-binding protein.  In A. tumefaciens cyclic beta-1, 2-glucan must be transported into the periplasmic space to exert its action as a virluence factor.  This subfamily belongs to the MRP-like family and is involved in drug, peptide, and lipid export.  The MRP-like family, similar to all ABC proteins, have a common four-domain core structure constituted by two membrane-spanning domains each composed of six transmembrane (TM) helices and two nucleotide-binding domains (NBD).  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=89.23  E-value=0.2  Score=49.15  Aligned_cols=21  Identities=43%  Similarity=0.672  Sum_probs=18.8

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|..+++.|+||+|||||..
T Consensus        27 ~~G~~~~i~G~nGsGKSTLl~   47 (229)
T cd03254          27 KPGETVAIVGPTGAGKTTLIN   47 (229)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            578899999999999999765


No 142
>PRK13539 cytochrome c biogenesis protein CcmA; Provisional
Probab=89.22  E-value=0.2  Score=48.81  Aligned_cols=21  Identities=38%  Similarity=0.618  Sum_probs=18.9

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|..+++.|+||+|||||..
T Consensus        26 ~~Ge~~~i~G~nGsGKSTLl~   46 (207)
T PRK13539         26 AAGEALVLTGPNGSGKTTLLR   46 (207)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            568999999999999999765


No 143
>PRK15177 Vi polysaccharide export ATP-binding protein VexC; Provisional
Probab=89.16  E-value=0.2  Score=49.31  Aligned_cols=21  Identities=29%  Similarity=0.336  Sum_probs=18.8

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|..+++.|+||+|||||..
T Consensus        11 ~~Ge~~~l~G~NGsGKSTLlk   31 (213)
T PRK15177         11 GYHEHIGILAAPGSGKTTLTR   31 (213)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            568999999999999999765


No 144
>PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional
Probab=89.15  E-value=0.2  Score=49.17  Aligned_cols=21  Identities=43%  Similarity=0.692  Sum_probs=18.9

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|+.+++.|++|+|||||..
T Consensus        34 ~~Ge~~~i~G~nGsGKSTLl~   54 (228)
T PRK10584         34 KRGETIALIGESGSGKSTLLA   54 (228)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            568999999999999999765


No 145
>cd03295 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment.  ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition, to the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=89.12  E-value=0.2  Score=49.74  Aligned_cols=21  Identities=38%  Similarity=0.634  Sum_probs=18.9

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|..+++.|+||+|||||..
T Consensus        25 ~~Ge~~~i~G~nGsGKSTLl~   45 (242)
T cd03295          25 AKGEFLVLIGPSGSGKTTTMK   45 (242)
T ss_pred             CCCCEEEEECCCCCCHHHHHH
Confidence            578899999999999999765


No 146
>TIGR03864 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system. Members of this protein family are the ATP-binding subunit of an ABC transporter system that is associated with PQQ biosynthesis and PQQ-dependent alcohol dehydrogenases. While this family shows homology to several efflux ABC transporter subunits, the presence of a periplasmic substrate-binding protein and association with systems for catabolism of alcohols suggests a role in import rather than detoxification.
Probab=89.10  E-value=0.2  Score=49.56  Aligned_cols=21  Identities=33%  Similarity=0.686  Sum_probs=18.9

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|..+++.|+||+|||||..
T Consensus        25 ~~Ge~~~i~G~nGsGKSTLl~   45 (236)
T TIGR03864        25 RPGEFVALLGPNGAGKSTLFS   45 (236)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            578999999999999999765


No 147
>PRK10895 lipopolysaccharide ABC transporter ATP-binding protein; Provisional
Probab=89.09  E-value=0.2  Score=49.66  Aligned_cols=21  Identities=33%  Similarity=0.550  Sum_probs=18.8

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|+.+++.|+||+|||||..
T Consensus        27 ~~Ge~~~l~G~nGsGKSTLl~   47 (241)
T PRK10895         27 NSGEIVGLLGPNGAGKTTTFY   47 (241)
T ss_pred             cCCcEEEEECCCCCCHHHHHH
Confidence            568999999999999999765


No 148
>COG0194 Gmk Guanylate kinase [Nucleotide transport and metabolism]
Probab=89.09  E-value=0.18  Score=49.98  Aligned_cols=20  Identities=40%  Similarity=0.586  Sum_probs=17.5

Q ss_pred             CCCEEEEEecCCCCcccccc
Q 008523          333 DGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       333 ~G~valfFGLSGTGKTTLsa  352 (563)
                      .|..++++|+||+|||||..
T Consensus         3 ~G~l~vlsgPSG~GKsTl~k   22 (191)
T COG0194           3 KGLLIVLSGPSGVGKSTLVK   22 (191)
T ss_pred             CceEEEEECCCCCCHHHHHH
Confidence            57789999999999999754


No 149
>cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome.  The peroxisomal membrane forms a permeability barrier for a wide variety of metabolites required for and formed during fatty acid beta-oxidation.  To communicate with the cytoplasm and mitochondria, peroxisomes need dedicated proteins to transport such hydrophilic molecules across their membranes.  X-linked adrenoleukodystrophy (X-ALD) is caused by mutations in the ALD gene, which encodes ALDP (adrenoleukodystrophy protein ), a peroxisomal integral membrane protein that is a member of the ATP-binding cassette (ABC) transporter protein family.  The disease is characterized by a striking and unpredictable variation in phenotypic expression.  Phenotypes include the rapidly progressive childhood cerebral form (CCALD), the milder adult form, adrenomyeloneuropathy (AMN), and variants without neurologic involvement (i.e. asympt
Probab=89.09  E-value=0.21  Score=47.18  Aligned_cols=21  Identities=52%  Similarity=0.680  Sum_probs=18.8

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|+.+++.|++|+|||||..
T Consensus        25 ~~Ge~~~i~G~nGsGKSTLl~   45 (166)
T cd03223          25 KPGDRLLITGPSGTGKSSLFR   45 (166)
T ss_pred             CCCCEEEEECCCCCCHHHHHH
Confidence            568999999999999999765


No 150
>PRK13538 cytochrome c biogenesis protein CcmA; Provisional
Probab=89.06  E-value=0.2  Score=48.50  Aligned_cols=21  Identities=33%  Similarity=0.558  Sum_probs=19.0

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|..+++.|++|+|||||..
T Consensus        25 ~~Ge~~~l~G~nGsGKSTLl~   45 (204)
T PRK13538         25 NAGELVQIEGPNGAGKTSLLR   45 (204)
T ss_pred             CCCcEEEEECCCCCCHHHHHH
Confidence            578999999999999999765


No 151
>cd02027 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyzes the phosphorylation of adenosine 5'-phosphosulfate to form 3'-phosphoadenosine 5'-phosphosulfate (PAPS). The end-product PAPS is a biologically "activated" sulfate form important for the assimilation of inorganic sulfate.
Probab=89.04  E-value=0.14  Score=47.66  Aligned_cols=17  Identities=47%  Similarity=0.786  Sum_probs=15.2

Q ss_pred             EEEEEecCCCCcccccc
Q 008523          336 VALFFGLSGTGKTTLST  352 (563)
Q Consensus       336 valfFGLSGTGKTTLsa  352 (563)
                      +++|.|+||+|||||+.
T Consensus         1 ~i~i~G~~GsGKSTla~   17 (149)
T cd02027           1 VIWLTGLSGSGKSTIAR   17 (149)
T ss_pred             CEEEEcCCCCCHHHHHH
Confidence            47899999999999887


No 152
>TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family. This subfamily of the adenylate kinase superfamily contains examples of UMP-CMP kinase, as well as others proteins with unknown specificity, some currently designated adenylate kinase. All known members are eukaryotic.
Probab=89.04  E-value=0.14  Score=48.19  Aligned_cols=17  Identities=35%  Similarity=0.561  Sum_probs=15.1

Q ss_pred             EEEEEecCCCCcccccc
Q 008523          336 VALFFGLSGTGKTTLST  352 (563)
Q Consensus       336 valfFGLSGTGKTTLsa  352 (563)
                      +++++|++||||||++.
T Consensus         1 ~i~i~G~pGsGKst~a~   17 (183)
T TIGR01359         1 VVFVLGGPGSGKGTQCA   17 (183)
T ss_pred             CEEEECCCCCCHHHHHH
Confidence            47899999999999876


No 153
>TIGR02323 CP_lyasePhnK phosphonate C-P lyase system protein PhnK. Members of this family are the PhnK protein of C-P lyase systems for utilization of phosphonates. These systems resemble phosphonatase-based systems in having a three component ABC transporter, where TIGR01097 is the permease, TIGR01098 is the phosphonates binding protein, and TIGR02315 is the ATP-binding cassette (ABC) protein. They differ, however, in having, typically, ten or more additional genes, many of which are believed to form a membrane-associated complex. This protein (PhnK) and the adjacent-encoded PhnL resemble transporter ATP-binding proteins but are suggested, based on mutatgenesis studies, to be part of this complex rather than part of a transporter per se.
Probab=89.03  E-value=0.19  Score=50.10  Aligned_cols=21  Identities=43%  Similarity=0.542  Sum_probs=18.7

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|+.+++.|+||+|||||..
T Consensus        27 ~~Ge~~~i~G~nGsGKSTLl~   47 (253)
T TIGR02323        27 YPGEVLGIVGESGSGKSTLLG   47 (253)
T ss_pred             eCCcEEEEECCCCCCHHHHHH
Confidence            568999999999999999765


No 154
>cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import.  Responsible for energy coupling to the transport system.  The complex is composed of two ATP-binding proteins (cysA), two transmembrane proteins (cysT and cysW), and a solute-binding protein (cysP).  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=89.01  E-value=0.21  Score=49.59  Aligned_cols=21  Identities=43%  Similarity=0.714  Sum_probs=18.9

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|..+++.|+||+|||||..
T Consensus        26 ~~Ge~~~i~G~nGsGKSTLl~   46 (239)
T cd03296          26 PSGELVALLGPSGSGKTTLLR   46 (239)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            568999999999999999765


No 155
>PRK14267 phosphate ABC transporter ATP-binding protein; Provisional
Probab=88.97  E-value=0.21  Score=49.92  Aligned_cols=21  Identities=38%  Similarity=0.515  Sum_probs=18.8

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|..+++.|+||+|||||..
T Consensus        28 ~~Ge~~~l~G~nGsGKSTLl~   48 (253)
T PRK14267         28 PQNGVFALMGPSGCGKSTLLR   48 (253)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            568999999999999999765


No 156
>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis.  The CydC and CydD proteins are important for the formation of cytochrome bd terminal oxidase of E. coli and it has been proposed that they were necessary for biosynthesis of the cytochrome bd quinol oxidase and for periplasmic c-type cytochromes.  CydCD were proposed to determine a heterooligomeric complex important for heme export into the periplasm or to be involved in the maintenance of the proper redox state of the periplasmic space.  In Bacillus subtilius, the absence of CydCD does not affect the presence of halo-cytochrome c in the membrane and this observation suggests that CydCD proteins are not involved in the export of heme in this organism.
Probab=88.95  E-value=0.22  Score=47.30  Aligned_cols=21  Identities=43%  Similarity=0.700  Sum_probs=19.0

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|+.+++.|++|+|||||..
T Consensus        26 ~~Ge~~~i~G~nGsGKStLl~   46 (178)
T cd03247          26 KQGEKIALLGRSGSGKSTLLQ   46 (178)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            678999999999999999765


No 157
>PRK14247 phosphate ABC transporter ATP-binding protein; Provisional
Probab=88.94  E-value=0.21  Score=49.79  Aligned_cols=21  Identities=38%  Similarity=0.646  Sum_probs=18.9

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|..+++.|+||+|||||..
T Consensus        27 ~~Ge~~~i~G~nGsGKSTLl~   47 (250)
T PRK14247         27 PDNTITALMGPSGSGKSTLLR   47 (250)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            568999999999999999765


No 158
>TIGR00972 3a0107s01c2 phosphate ABC transporter, ATP-binding protein. This model represents the ATP-binding protein of a family of ABC transporters for inorganic phosphate. In the model species Escherichia coli, a constitutive transporter for inorganic phosphate, with low affinity, is also present. The high affinity transporter that includes this polypeptide is induced when extracellular phosphate concentrations are low. The proteins most similar to the members of this family but not included appear to be amino acid transporters.
Probab=88.93  E-value=0.21  Score=49.76  Aligned_cols=21  Identities=38%  Similarity=0.558  Sum_probs=19.0

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|..+++.|+||+|||||..
T Consensus        25 ~~Ge~~~i~G~nGsGKSTLl~   45 (247)
T TIGR00972        25 PKNQVTALIGPSGCGKSTLLR   45 (247)
T ss_pred             CCCCEEEEECCCCCCHHHHHH
Confidence            578999999999999999765


No 159
>cd02024 NRK1 Nicotinamide riboside kinase (NRK) is an enzyme involved in the metabolism of nicotinamide adenine dinucleotide (NAD+). This enzyme catalyzes the phosphorylation of nicotinamide riboside (NR) to form nicotinamide mononucleotide (NMN). It defines the NR salvage pathway of NAD+ biosynthesis in addition to the pathways through nicotinic acid mononucleotide (NaMN). This enzyme can also phosphorylate the anticancer drug tiazofurin, which is an analog of nicotinamide riboside.
Probab=88.91  E-value=0.23  Score=48.82  Aligned_cols=16  Identities=38%  Similarity=0.536  Sum_probs=14.5

Q ss_pred             EEEEecCCCCcccccc
Q 008523          337 ALFFGLSGTGKTTLST  352 (563)
Q Consensus       337 alfFGLSGTGKTTLsa  352 (563)
                      +++.|.||||||||+.
T Consensus         2 i~i~G~sgsGKTtla~   17 (187)
T cd02024           2 VGISGVTNSGKTTLAK   17 (187)
T ss_pred             EEEECCCCCCHHHHHH
Confidence            6788999999999886


No 160
>cd03221 ABCF_EF-3 ABCF_EF-3  Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth.  EF-3 stimulates the binding of the EF-1: GTP: aa-tRNA ternary complex to the ribosomal A site by facilitated release of the deacylated tRNA from the E site.  The reaction requires ATP hydrolysis.  EF-3 contains two ATP nucleotide binding sequence (NBS) motifs.  NBSI is sufficient for the intrinsic ATPase activity. NBSII is essential for the ribosome-stimulated functions.
Probab=88.88  E-value=0.22  Score=46.05  Aligned_cols=21  Identities=38%  Similarity=0.550  Sum_probs=18.9

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      +.|..+++.|.+|+|||||..
T Consensus        24 ~~Ge~~~i~G~nGsGKStLl~   44 (144)
T cd03221          24 NPGDRIGLVGRNGAGKSTLLK   44 (144)
T ss_pred             CCCCEEEEECCCCCCHHHHHH
Confidence            678999999999999999765


No 161
>PRK11248 tauB taurine transporter ATP-binding subunit; Provisional
Probab=88.84  E-value=0.21  Score=50.41  Aligned_cols=21  Identities=43%  Similarity=0.719  Sum_probs=18.8

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|..+++.|+||+|||||..
T Consensus        25 ~~Ge~~~i~G~nGsGKSTLl~   45 (255)
T PRK11248         25 ESGELLVVLGPSGCGKTTLLN   45 (255)
T ss_pred             CCCCEEEEECCCCCCHHHHHH
Confidence            568999999999999999765


No 162
>PRK14738 gmk guanylate kinase; Provisional
Probab=88.81  E-value=0.21  Score=49.03  Aligned_cols=20  Identities=25%  Similarity=0.345  Sum_probs=17.3

Q ss_pred             CCCEEEEEecCCCCcccccc
Q 008523          333 DGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       333 ~G~valfFGLSGTGKTTLsa  352 (563)
                      .+..++|.|+||+|||||..
T Consensus        12 ~~~~ivi~GpsG~GK~tl~~   31 (206)
T PRK14738         12 KPLLVVISGPSGVGKDAVLA   31 (206)
T ss_pred             CCeEEEEECcCCCCHHHHHH
Confidence            46789999999999999764


No 163
>cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos).  The Carb_Monos family is involved in the uptake of monosaccharides, such as pentoses (such as xylose, arabinose, and ribose) and hexoses (such as xylose, arabinose, and ribose), that cannot be broken down to simple sugars by hydrolysis.  In members of Carb_Monos family the single hydrophobic gene product forms a homodimer, while the ABC protein represents a fusion of two nucleotide-binding domains.  However, it is assumed that two copies of the ABC domains are present in the assembled transporter.
Probab=88.80  E-value=0.22  Score=47.53  Aligned_cols=21  Identities=33%  Similarity=0.658  Sum_probs=18.9

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      +.|..+++.|++|+|||||..
T Consensus        24 ~~G~~~~i~G~nGsGKSTLl~   44 (182)
T cd03215          24 RAGEIVGIAGLVGNGQTELAE   44 (182)
T ss_pred             cCCcEEEEECCCCCCHHHHHH
Confidence            578899999999999999765


No 164
>cd03245 ABCC_bacteriocin_exporters ABC-type bacteriocin exporters. Many non-lantibiotic bacteriocins of lactic acid bacteria are produced as precursors which have N-terminal leader peptides that share similarities in amino acid sequence and contain a conserved processing site of two glycine residues in positions -1 and -2.  A dedicated ATP-binding cassette (ABC) transporter is responsible for the proteolytic cleavage of the leader peptides and subsequent translocation of the bacteriocins across the cytoplasmic membrane.
Probab=88.79  E-value=0.22  Score=48.48  Aligned_cols=21  Identities=33%  Similarity=0.607  Sum_probs=18.8

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|+.+++.|+||+|||||..
T Consensus        28 ~~G~~~~i~G~nGsGKSTLl~   48 (220)
T cd03245          28 RAGEKVAIIGRVGSGKSTLLK   48 (220)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            568999999999999999765


No 165
>PRK09452 potA putrescine/spermidine ABC transporter ATPase protein; Reviewed
Probab=88.78  E-value=0.2  Score=54.00  Aligned_cols=21  Identities=38%  Similarity=0.648  Sum_probs=18.6

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|..++++|+||||||||..
T Consensus        38 ~~Ge~~~LlGpsGsGKSTLLr   58 (375)
T PRK09452         38 NNGEFLTLLGPSGCGKTTVLR   58 (375)
T ss_pred             eCCCEEEEECCCCCcHHHHHH
Confidence            568899999999999999664


No 166
>PRK10744 pstB phosphate transporter ATP-binding protein; Provisional
Probab=88.76  E-value=0.21  Score=50.24  Aligned_cols=21  Identities=43%  Similarity=0.640  Sum_probs=18.7

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|..+++.|+||+|||||..
T Consensus        37 ~~Ge~~~i~G~nGsGKSTLl~   57 (260)
T PRK10744         37 AKNQVTAFIGPSGCGKSTLLR   57 (260)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            568999999999999999765


No 167
>PRK11432 fbpC ferric transporter ATP-binding subunit; Provisional
Probab=88.73  E-value=0.21  Score=53.30  Aligned_cols=21  Identities=43%  Similarity=0.667  Sum_probs=18.7

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|..++++|+||||||||..
T Consensus        30 ~~Ge~~~llGpsGsGKSTLLr   50 (351)
T PRK11432         30 KQGTMVTLLGPSGCGKTTVLR   50 (351)
T ss_pred             cCCCEEEEECCCCCcHHHHHH
Confidence            568899999999999999765


No 168
>TIGR03771 anch_rpt_ABC anchored repeat-type ABC transporter, ATP-binding subunit. This protein family is the ATP-binding cassette subunit of binding protein-dependent ABC transporter complex that strictly co-occurs with TIGR03769. TIGRFAMs model TIGR03769 describes a protein domain that occurs singly or as one of up to three repeats in proteins of a number of Actinobacteria, including Propionibacterium acnes KPA171202. The TIGR03769 domain occurs both in an adjacent gene for the substrate-binding protein and in additional (often nearby) proteins, often with LPXTG-like sortase recognition signals. Homologous ATP-binding subunits outside the scope of this family include manganese transporter MntA in Synechocystis sp. PCC 6803 and chelated iron transporter subunits. The function of this transporter complex is unknown.
Probab=88.70  E-value=0.22  Score=49.10  Aligned_cols=21  Identities=38%  Similarity=0.626  Sum_probs=18.6

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|..+++.|+||+|||||..
T Consensus         4 ~~Ge~~~l~G~nGsGKSTLl~   24 (223)
T TIGR03771         4 DKGELLGLLGPNGAGKTTLLR   24 (223)
T ss_pred             CCCcEEEEECCCCCCHHHHHH
Confidence            468899999999999999765


No 169
>PRK14241 phosphate transporter ATP-binding protein; Provisional
Probab=88.67  E-value=0.22  Score=50.10  Aligned_cols=21  Identities=38%  Similarity=0.583  Sum_probs=18.8

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|..+++.|+||+|||||..
T Consensus        28 ~~Ge~~~i~G~nGsGKSTLl~   48 (258)
T PRK14241         28 EPRSVTAFIGPSGCGKSTVLR   48 (258)
T ss_pred             cCCcEEEEECCCCCCHHHHHH
Confidence            568999999999999999765


No 170
>cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1.48), also known as uridine kinase or uridine-cytidine kinase (UCK), catalyzes the reversible phosphoryl transfer from ATP to uridine or cytidine to yield UMP or CMP. In the primidine nucleotide-salvage pathway, this enzyme combined with nucleoside diphosphate kinases further phosphorylates UMP and CMP to form UTP and CTP. This kinase also catalyzes the phosphorylation of several cytotoxic ribonucleoside analogs such as 5-flurrouridine and cyclopentenyl-cytidine.
Probab=88.66  E-value=0.16  Score=48.91  Aligned_cols=16  Identities=44%  Similarity=0.493  Sum_probs=14.6

Q ss_pred             EEEEecCCCCcccccc
Q 008523          337 ALFFGLSGTGKTTLST  352 (563)
Q Consensus       337 alfFGLSGTGKTTLsa  352 (563)
                      +.+.|+||||||||+.
T Consensus         2 igi~G~~GsGKSTl~~   17 (198)
T cd02023           2 IGIAGGSGSGKTTVAE   17 (198)
T ss_pred             EEEECCCCCCHHHHHH
Confidence            6789999999999886


No 171
>PRK06547 hypothetical protein; Provisional
Probab=88.58  E-value=0.19  Score=48.46  Aligned_cols=18  Identities=50%  Similarity=0.562  Sum_probs=15.7

Q ss_pred             CEEEEEecCCCCcccccc
Q 008523          335 DVALFFGLSGTGKTTLST  352 (563)
Q Consensus       335 ~valfFGLSGTGKTTLsa  352 (563)
                      ..+++.|.||||||||+.
T Consensus        16 ~~i~i~G~~GsGKTt~a~   33 (172)
T PRK06547         16 ITVLIDGRSGSGKTTLAG   33 (172)
T ss_pred             EEEEEECCCCCCHHHHHH
Confidence            368888999999999876


No 172
>PRK11264 putative amino-acid ABC transporter ATP-binding protein YecC; Provisional
Probab=88.58  E-value=0.23  Score=49.44  Aligned_cols=21  Identities=52%  Similarity=0.749  Sum_probs=18.7

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|..+++.|+||+|||||..
T Consensus        27 ~~Ge~~~i~G~nGsGKSTLl~   47 (250)
T PRK11264         27 KPGEVVAIIGPSGSGKTTLLR   47 (250)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            568899999999999999765


No 173
>PRK14255 phosphate ABC transporter ATP-binding protein; Provisional
Probab=88.54  E-value=0.23  Score=49.55  Aligned_cols=21  Identities=29%  Similarity=0.547  Sum_probs=18.8

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|..+++.|+||+|||||..
T Consensus        29 ~~Ge~~~l~G~nGsGKSTLl~   49 (252)
T PRK14255         29 NQNEITALIGPSGCGKSTYLR   49 (252)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            568999999999999999765


No 174
>PRK13543 cytochrome c biogenesis protein CcmA; Provisional
Probab=88.53  E-value=0.24  Score=48.49  Aligned_cols=21  Identities=43%  Similarity=0.590  Sum_probs=18.8

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|+.+++.|+||+|||||..
T Consensus        35 ~~Ge~~~i~G~nGsGKSTLl~   55 (214)
T PRK13543         35 DAGEALLVQGDNGAGKTTLLR   55 (214)
T ss_pred             CCCCEEEEEcCCCCCHHHHHH
Confidence            568999999999999999764


No 175
>cd02021 GntK Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate. The resulting product gluconate-6-phoshate is an important precursor of gluconate metabolism. GntK acts as a dimmer composed of two identical subunits.
Probab=88.53  E-value=0.18  Score=46.04  Aligned_cols=16  Identities=38%  Similarity=0.781  Sum_probs=14.6

Q ss_pred             EEEEecCCCCcccccc
Q 008523          337 ALFFGLSGTGKTTLST  352 (563)
Q Consensus       337 alfFGLSGTGKTTLsa  352 (563)
                      ++|.|++|+||||++.
T Consensus         2 i~l~G~~GsGKST~a~   17 (150)
T cd02021           2 IVVMGVSGSGKSTVGK   17 (150)
T ss_pred             EEEEcCCCCCHHHHHH
Confidence            6899999999999876


No 176
>TIGR03005 ectoine_ehuA ectoine/hydroxyectoine ABC transporter, ATP-binding protein. Members of this family are the ATP-binding protein of a conserved four gene ABC transporter operon found next to ectoine unilization operons and ectoine biosynthesis operons. Ectoine is a compatible solute that protects enzymes from high osmolarity. It is released by some species in response to hypoosmotic shock, and it is taken up by a number of bacteria as a compatible solute or for consumption. This family shows strong sequence similiarity to a number of amino acid ABC transporter ATP-binding proteins.
Probab=88.50  E-value=0.23  Score=49.60  Aligned_cols=21  Identities=33%  Similarity=0.599  Sum_probs=18.9

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|..+++.|+||+|||||..
T Consensus        24 ~~Ge~~~i~G~nGsGKSTLl~   44 (252)
T TIGR03005        24 AAGEKVALIGPSGSGKSTILR   44 (252)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            578999999999999999765


No 177
>PRK14242 phosphate transporter ATP-binding protein; Provisional
Probab=88.49  E-value=0.23  Score=49.64  Aligned_cols=21  Identities=33%  Similarity=0.561  Sum_probs=18.8

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|..+++.|++|+|||||..
T Consensus        30 ~~Ge~~~i~G~nGsGKSTLl~   50 (253)
T PRK14242         30 EQNQVTALIGPSGCGKSTFLR   50 (253)
T ss_pred             eCCCEEEEECCCCCCHHHHHH
Confidence            568899999999999999765


No 178
>PRK11650 ugpC glycerol-3-phosphate transporter ATP-binding subunit; Provisional
Probab=88.48  E-value=0.22  Score=53.22  Aligned_cols=21  Identities=43%  Similarity=0.713  Sum_probs=18.6

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|..++++|+||||||||..
T Consensus        28 ~~Ge~~~llG~sGsGKSTLLr   48 (356)
T PRK11650         28 ADGEFIVLVGPSGCGKSTLLR   48 (356)
T ss_pred             cCCCEEEEECCCCCcHHHHHH
Confidence            568899999999999999764


No 179
>PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional
Probab=88.47  E-value=0.23  Score=50.48  Aligned_cols=21  Identities=38%  Similarity=0.540  Sum_probs=18.7

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|..+++.|+||+|||||..
T Consensus        36 ~~Ge~~~I~G~NGsGKSTLlk   56 (257)
T PRK11247         36 PAGQFVAVVGRSGCGKSTLLR   56 (257)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            568899999999999999765


No 180
>cd03231 ABC_CcmA_heme_exporter CcmA, the ATP-binding component of the bacterial CcmAB transporter.  The CCM family is involved in bacterial cytochrome c biogenesis.  Cytochrome c maturation in E. coli requires the ccm operon, which encodes eight membrane proteins (CcmABCDEFGH).  CcmE is a periplasmic heme chaperone that binds heme covalently and transfers it onto apocytochrome c in the presence of CcmF, CcmG, and CcmH.  The CcmAB proteins represent an ABC transporter and the CcmCD proteins participate in heme transfer to CcmE.
Probab=88.45  E-value=0.24  Score=48.04  Aligned_cols=21  Identities=38%  Similarity=0.534  Sum_probs=18.9

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      +.|..+++.|.+|+|||||..
T Consensus        24 ~~Ge~~~i~G~nGsGKSTLl~   44 (201)
T cd03231          24 AAGEALQVTGPNGSGKTTLLR   44 (201)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            568999999999999999765


No 181
>cd03298 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranport system; part of the binding-protein-dependent transport system tbpA-thiPQ for thiamine and TPP.  Probably responsible for the translocation of thiamine across the membrane. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=88.43  E-value=0.24  Score=48.02  Aligned_cols=21  Identities=38%  Similarity=0.702  Sum_probs=18.8

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|..+++.|++|+|||||..
T Consensus        22 ~~Ge~~~l~G~nGsGKSTLl~   42 (211)
T cd03298          22 AQGEITAIVGPSGSGKSTLLN   42 (211)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            578999999999999999765


No 182
>TIGR01189 ccmA heme ABC exporter, ATP-binding protein CcmA. This model describes the cyt c biogenesis protein encoded by ccmA in bacteria. An exception is, an arabidopsis protein. Quite likely this is encoded by an organelle. Bacterial c-type cytocromes are located on the periplasmic side of the cytoplasmic membrane. Several gene products encoded in a locus designated as 'ccm' are implicated in the transport and assembly of the functional cytochrome C. This cluster includes genes: ccmA;B;C;D;E;F;G and H. The posttranslational pathway includes the transport of heme moiety, the secretion of the apoprotein and the covalent attachment of the heme with the apoprotein. The proteins ccmA and B represent an ABC transporter; ccmC and D participate in heme transfer to ccmE, which function as a periplasmic heme chaperone. The presence of ccmF, G and H is suggested to be obligatory for the final functional assembly of cytochrome c.
Probab=88.43  E-value=0.24  Score=47.73  Aligned_cols=21  Identities=38%  Similarity=0.520  Sum_probs=18.9

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|..+++.|++|+|||||..
T Consensus        24 ~~Ge~~~i~G~nGsGKSTLl~   44 (198)
T TIGR01189        24 NAGEALQVTGPNGIGKTTLLR   44 (198)
T ss_pred             cCCcEEEEECCCCCCHHHHHH
Confidence            568999999999999999765


No 183
>TIGR03415 ABC_choXWV_ATP choline ABC transporter, ATP-binding protein. Members of this protein family are the ATP-binding subunit of a three-protein transporter. This family belongs, more broadly, to the family of proline and glycine-betaine transporters, but members have been identified by direct characterization and by bioinformatic means as choline transporters. Many species have several closely-related members of this family, probably with variable abilities to act additionally on related quaternary amines.
Probab=88.43  E-value=0.19  Score=54.42  Aligned_cols=21  Identities=38%  Similarity=0.914  Sum_probs=19.0

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|..+++.|+||+|||||..
T Consensus        48 ~~Gei~~I~G~nGsGKSTLlr   68 (382)
T TIGR03415        48 EEGEICVLMGLSGSGKSSLLR   68 (382)
T ss_pred             cCCCEEEEECCCCCcHHHHHH
Confidence            678999999999999999765


No 184
>PRK13648 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=88.38  E-value=0.24  Score=50.25  Aligned_cols=21  Identities=29%  Similarity=0.571  Sum_probs=19.0

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|..+++.|+||+|||||..
T Consensus        33 ~~Ge~~~I~G~nGsGKSTLl~   53 (269)
T PRK13648         33 PKGQWTSIVGHNGSGKSTIAK   53 (269)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            578999999999999999765


No 185
>TIGR02237 recomb_radB DNA repair and recombination protein RadB. This family consists exclusively of archaeal RadB protein, a homolog of bacterial RecA (TIGR02012), eukaryotic RAD51 (TIGR02239) and DMC1 (TIGR02238), and archaeal RadA (TIGR02236).
Probab=88.35  E-value=0.23  Score=48.01  Aligned_cols=21  Identities=29%  Similarity=0.692  Sum_probs=18.8

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      +.|.++.++|++|||||+++.
T Consensus        10 ~~g~i~~i~G~~GsGKT~l~~   30 (209)
T TIGR02237        10 ERGTITQIYGPPGSGKTNICM   30 (209)
T ss_pred             CCCeEEEEECCCCCCHHHHHH
Confidence            457899999999999999876


No 186
>PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional
Probab=88.33  E-value=0.24  Score=48.77  Aligned_cols=21  Identities=43%  Similarity=0.676  Sum_probs=18.9

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|..+++.|++|+|||||..
T Consensus        31 ~~Ge~~~i~G~nGsGKSTLl~   51 (225)
T PRK10247         31 RAGEFKLITGPSGCGKSTLLK   51 (225)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            578999999999999999765


No 187
>TIGR01184 ntrCD nitrate transport ATP-binding subunits C and D. This model describes the ATP binding subunits of nitrate transport in bacteria and archaea. This protein belongs to the ATP-binding cassette (ABC) superfamily. It is thought that the two subunits encoded by ntrC and ntrD form the binding surface for interaction with ATP. This model is restricted in identifying ATP binding subunit associated with the nitrate transport. Nitrate assimilation is aided by other proteins derived from the operon which among others include products of ntrA - a regulatory protein; ntrB - a hydropbobic transmembrane permease and narB - a reductase.
Probab=88.31  E-value=0.24  Score=49.05  Aligned_cols=21  Identities=38%  Similarity=0.653  Sum_probs=18.7

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|..+++.|.||+|||||..
T Consensus         9 ~~Ge~~~i~G~nGsGKSTLl~   29 (230)
T TIGR01184         9 QQGEFISLIGHSGCGKSTLLN   29 (230)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            568899999999999999765


No 188
>PRK14273 phosphate ABC transporter ATP-binding protein; Provisional
Probab=88.31  E-value=0.24  Score=49.54  Aligned_cols=21  Identities=29%  Similarity=0.491  Sum_probs=18.7

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|..+++.|.||+|||||..
T Consensus        31 ~~Ge~~~i~G~nGsGKSTLl~   51 (254)
T PRK14273         31 LKNSITALIGPSGCGKSTFLR   51 (254)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            568999999999999999765


No 189
>PRK10771 thiQ thiamine transporter ATP-binding subunit; Provisional
Probab=88.26  E-value=0.25  Score=48.80  Aligned_cols=21  Identities=38%  Similarity=0.635  Sum_probs=18.8

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|..+++.|+||+|||||..
T Consensus        23 ~~Ge~~~l~G~nGsGKSTLl~   43 (232)
T PRK10771         23 ERGERVAILGPSGAGKSTLLN   43 (232)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            568999999999999999765


No 190
>PRK14274 phosphate ABC transporter ATP-binding protein; Provisional
Probab=88.26  E-value=0.24  Score=49.74  Aligned_cols=21  Identities=33%  Similarity=0.583  Sum_probs=18.9

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|..+++.|++|+|||||..
T Consensus        36 ~~Ge~~~l~G~nGsGKSTLl~   56 (259)
T PRK14274         36 PENEVTAIIGPSGCGKSTFIK   56 (259)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            568999999999999999765


No 191
>PF13191 AAA_16:  AAA ATPase domain; PDB: 2V1U_A.
Probab=88.22  E-value=0.18  Score=46.79  Aligned_cols=21  Identities=38%  Similarity=0.438  Sum_probs=13.0

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..+..+++.|.+|+|||+|..
T Consensus        22 ~~~~~~ll~G~~G~GKT~ll~   42 (185)
T PF13191_consen   22 GSPRNLLLTGESGSGKTSLLR   42 (185)
T ss_dssp             -----EEE-B-TTSSHHHHHH
T ss_pred             CCCcEEEEECCCCCCHHHHHH
Confidence            445789999999999999766


No 192
>PRK09493 glnQ glutamine ABC transporter ATP-binding protein; Reviewed
Probab=88.21  E-value=0.25  Score=48.94  Aligned_cols=21  Identities=43%  Similarity=0.764  Sum_probs=18.7

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|..+++.|+||+|||||..
T Consensus        25 ~~Ge~~~l~G~nGsGKSTLl~   45 (240)
T PRK09493         25 DQGEVVVIIGPSGSGKSTLLR   45 (240)
T ss_pred             cCCcEEEEECCCCCCHHHHHH
Confidence            568899999999999999765


No 193
>PRK11607 potG putrescine transporter ATP-binding subunit; Provisional
Probab=88.21  E-value=0.24  Score=53.48  Aligned_cols=21  Identities=38%  Similarity=0.643  Sum_probs=18.5

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|..++++|+||||||||..
T Consensus        43 ~~Ge~~~llGpsGsGKSTLLr   63 (377)
T PRK11607         43 YKGEIFALLGASGCGKSTLLR   63 (377)
T ss_pred             cCCCEEEEECCCCCcHHHHHH
Confidence            568899999999999999754


No 194
>cd03249 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a mitochondrial ATP-binding cassette protein involved in iron homeostasis and one of four ABC transporters expressed in the mitochondrial inner membrane, the other three being MDL1(ABC7), MDL2, and ATM1.  In fact, the yeast MDL1 (multidrug resistance-like protein 1) and MDL2 (multidrug resistance-like protein 2) transporters are also included in this CD.  MDL1 is an ATP-dependent permease that acts as a high-copy suppressor of ATM1 and is thought to have a role in resistance to oxidative stress. Interestingly, subfamily B is more closely related to the carboxyl-terminal component of subfamily C than the two halves of ABCC molecules are with one another.
Probab=88.20  E-value=0.26  Score=48.63  Aligned_cols=21  Identities=33%  Similarity=0.567  Sum_probs=19.0

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      +.|..+++.|.+|+|||||..
T Consensus        27 ~~Ge~~~l~G~nGsGKSTLl~   47 (238)
T cd03249          27 PPGKTVALVGSSGCGKSTVVS   47 (238)
T ss_pred             cCCCEEEEEeCCCCCHHHHHH
Confidence            578999999999999999765


No 195
>cd03252 ABCC_Hemolysin The ABC-transporter hemolysin B is a central component of the secretion machinery that translocates the toxin, hemolysin A, in a Sec-independent fashion across both membranes of E. coli.  The hemolysin A (HlyA) transport machinery is composed of the ATP-binding cassette (ABC) transporter HlyB located in the inner membrane, hemolysin D (HlyD), also anchored in the inner membrane, and TolC, which resides in the outer membrane.  HlyD apparently forms a continuous channel that bridges the entire periplasm, interacting with TolC and HlyB.  This arrangement prevents the appearance of periplasmic intermediates of HlyA during substrate transport.  Little is known about the molecular details of HlyA transport, but it is evident that ATP-hydrolysis by the ABC-transporter HlyB is a necessary source of energy.
Probab=88.18  E-value=0.25  Score=48.72  Aligned_cols=21  Identities=48%  Similarity=0.732  Sum_probs=18.8

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|..+++.|+||+|||||..
T Consensus        26 ~~Ge~~~i~G~nGsGKSTLl~   46 (237)
T cd03252          26 KPGEVVGIVGRSGSGKSTLTK   46 (237)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            578999999999999999764


No 196
>CHL00131 ycf16 sulfate ABC transporter protein; Validated
Probab=88.16  E-value=0.25  Score=49.22  Aligned_cols=21  Identities=38%  Similarity=0.757  Sum_probs=18.8

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|..+++.|.||+|||||..
T Consensus        31 ~~Ge~~~i~G~nGsGKSTLl~   51 (252)
T CHL00131         31 NKGEIHAIMGPNGSGKSTLSK   51 (252)
T ss_pred             cCCcEEEEECCCCCCHHHHHH
Confidence            568999999999999999764


No 197
>TIGR03740 galliderm_ABC gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit. Model TIGR03731 represents the family of all lantibiotics related to gallidermin, including epidermin, mutatin, and nisin. This protein family describes the ATP-binding subunit of a gallidermin/epidermin class lantibiotic protection transporter. It is largely restricted to gallidermin-family lantibiotic biosynthesis and export cassettes, but also occurs in orphan transporter cassettes in species that lack candidate lantibiotic precursor and synthetase genes.
Probab=88.15  E-value=0.25  Score=48.34  Aligned_cols=21  Identities=33%  Similarity=0.474  Sum_probs=18.8

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|..+++.|++|+|||||..
T Consensus        24 ~~Ge~~~i~G~nGsGKSTLl~   44 (223)
T TIGR03740        24 PKNSVYGLLGPNGAGKSTLLK   44 (223)
T ss_pred             cCCcEEEEECCCCCCHHHHHH
Confidence            568999999999999999764


No 198
>PRK14239 phosphate transporter ATP-binding protein; Provisional
Probab=88.14  E-value=0.25  Score=49.21  Aligned_cols=21  Identities=33%  Similarity=0.570  Sum_probs=18.6

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|..+++.|+||+|||||..
T Consensus        29 ~~Ge~~~i~G~nGsGKSTLl~   49 (252)
T PRK14239         29 YPNEITALIGPSGSGKSTLLR   49 (252)
T ss_pred             cCCcEEEEECCCCCCHHHHHH
Confidence            568899999999999999765


No 199
>TIGR02770 nickel_nikD nickel import ATP-binding protein NikD. This family represents the NikD subunit of a multisubunit nickel import ABC transporter complex. Nickel, once imported, may be used in urease and in certain classes of hydrogenase and superoxide dismutase. NikD and NikE are homologous.
Probab=88.14  E-value=0.25  Score=48.73  Aligned_cols=21  Identities=38%  Similarity=0.586  Sum_probs=18.9

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      +.|..+++.|++|+|||||..
T Consensus        10 ~~Ge~~~i~G~nGsGKSTLl~   30 (230)
T TIGR02770        10 KRGEVLALVGESGSGKSLTCL   30 (230)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            578999999999999999765


No 200
>PTZ00301 uridine kinase; Provisional
Probab=88.13  E-value=0.2  Score=49.85  Aligned_cols=18  Identities=50%  Similarity=0.623  Sum_probs=16.2

Q ss_pred             CEEEEEecCCCCcccccc
Q 008523          335 DVALFFGLSGTGKTTLST  352 (563)
Q Consensus       335 ~valfFGLSGTGKTTLsa  352 (563)
                      ..+.+-|.||+|||||+.
T Consensus         4 ~iIgIaG~SgSGKTTla~   21 (210)
T PTZ00301          4 TVIGISGASGSGKSSLST   21 (210)
T ss_pred             EEEEEECCCcCCHHHHHH
Confidence            468999999999999985


No 201
>PRK10575 iron-hydroxamate transporter ATP-binding subunit; Provisional
Probab=88.12  E-value=0.25  Score=49.93  Aligned_cols=21  Identities=38%  Similarity=0.608  Sum_probs=18.8

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|..+++.|+||+|||||..
T Consensus        35 ~~Ge~~~i~G~nGsGKSTLl~   55 (265)
T PRK10575         35 PAGKVTGLIGHNGSGKSTLLK   55 (265)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            568999999999999999765


No 202
>PRK09183 transposase/IS protein; Provisional
Probab=88.08  E-value=0.22  Score=50.87  Aligned_cols=20  Identities=35%  Similarity=0.587  Sum_probs=17.8

Q ss_pred             CCCEEEEEecCCCCcccccc
Q 008523          333 DGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       333 ~G~valfFGLSGTGKTTLsa  352 (563)
                      .|..++|+|++|||||+|+.
T Consensus       101 ~~~~v~l~Gp~GtGKThLa~  120 (259)
T PRK09183        101 RNENIVLLGPSGVGKTHLAI  120 (259)
T ss_pred             cCCeEEEEeCCCCCHHHHHH
Confidence            46789999999999999876


No 203
>TIGR03411 urea_trans_UrtD urea ABC transporter, ATP-binding protein UrtD. Members of this protein family are ABC transporter ATP-binding subunits associated with urea transport and metabolism. This protein is found in a conserved five-gene transport operon typically found adjacent to urease genes. It was shown in Cyanobacteria that disruption leads to the loss of high-affinity urea transport activity.
Probab=88.07  E-value=0.26  Score=48.85  Aligned_cols=21  Identities=33%  Similarity=0.678  Sum_probs=18.7

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|..+++.|++|+|||||..
T Consensus        26 ~~Ge~~~l~G~nGsGKSTLl~   46 (242)
T TIGR03411        26 DPGELRVIIGPNGAGKTTMMD   46 (242)
T ss_pred             cCCcEEEEECCCCCCHHHHHH
Confidence            578899999999999999754


No 204
>cd03237 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNase L inhibitor.  The ABC ATPase, RNase L inhibitor (RLI), is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids.  RLI's are not transport proteins and thus cluster with a group of soluble proteins that lack the transmembrane components commonly found in other members of the family.  Structurally, RLI's have an N-terminal Fe-S domain and two nucleotide-binding domains which are arranged to form two composite active sites in their interface cleft.  RLI is one of the most conserved enzymes between archaea and eukaryotes with a sequence identity of more than 48%.  The high degree of evolutionary conservation suggests that RLI performs a central role in archaeal and eukaryotic physiology.
Probab=88.02  E-value=0.26  Score=49.80  Aligned_cols=21  Identities=33%  Similarity=0.531  Sum_probs=18.7

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|..+++.|++|+|||||..
T Consensus        23 ~~Ge~~~i~G~NGsGKSTLlk   43 (246)
T cd03237          23 SESEVIGILGPNGIGKTTFIK   43 (246)
T ss_pred             CCCCEEEEECCCCCCHHHHHH
Confidence            468999999999999999765


No 205
>TIGR02324 CP_lyasePhnL phosphonate C-P lyase system protein PhnL. Members of this family are the PhnL protein of C-P lyase systems for utilization of phosphonates. These systems resemble phosphonatase-based systems in having a three component ABC transporter, where TIGR01097 is the permease, TIGR01098 is the phosphonates binding protein, and TIGR02315 is the ATP-binding cassette (ABC) protein. They differ, however, in having, typically, ten or more additional genes, many of which are believed to form a membrane-associated C-P lysase complex. This protein (PhnL) and the adjacent-encoded PhnK (TIGR02323) resemble transporter ATP-binding proteins but are suggested, based on mutatgenesis studies, to be part of this C-P lyase complex rather than part of a transporter per se.
Probab=88.02  E-value=0.26  Score=48.16  Aligned_cols=21  Identities=38%  Similarity=0.594  Sum_probs=19.0

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|..+++.|+||+|||||..
T Consensus        32 ~~Ge~~~l~G~nGsGKSTLl~   52 (224)
T TIGR02324        32 NAGECVALSGPSGAGKSTLLK   52 (224)
T ss_pred             CCCCEEEEECCCCCCHHHHHH
Confidence            578999999999999999765


No 206
>PRK00698 tmk thymidylate kinase; Validated
Probab=88.01  E-value=0.22  Score=47.49  Aligned_cols=19  Identities=32%  Similarity=0.459  Sum_probs=17.1

Q ss_pred             CCEEEEEecCCCCcccccc
Q 008523          334 GDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       334 G~valfFGLSGTGKTTLsa  352 (563)
                      |..++|.|++|+||||++.
T Consensus         3 ~~~I~ieG~~gsGKsT~~~   21 (205)
T PRK00698          3 GMFITIEGIDGAGKSTQIE   21 (205)
T ss_pred             ceEEEEECCCCCCHHHHHH
Confidence            5679999999999999876


No 207
>PRK11300 livG leucine/isoleucine/valine transporter ATP-binding subunit; Provisional
Probab=87.98  E-value=0.25  Score=49.29  Aligned_cols=21  Identities=29%  Similarity=0.602  Sum_probs=18.7

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|..+++.|+||+|||||..
T Consensus        29 ~~Ge~~~l~G~nGsGKSTLl~   49 (255)
T PRK11300         29 REQEIVSLIGPNGAGKTTVFN   49 (255)
T ss_pred             cCCeEEEEECCCCCCHHHHHH
Confidence            568899999999999999765


No 208
>cd03250 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C.  This family is also known as MRP (mulrtidrug resisitance-associated protein).  Some of the MRP members have five additional transmembrane segments in their N-terminas, but the function of these additional membrane-spanning domains is not clear.  The MRP was found in the multidrug-resisting lung cancer cell in which p-glycoprotein was not overexpressed. MRP exports glutathione by drug stimulation, as well as, certain substrates in conjugated forms with anions, such as glutathione, glucuronate, and sulfate.
Probab=87.96  E-value=0.27  Score=47.44  Aligned_cols=21  Identities=29%  Similarity=0.613  Sum_probs=18.9

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      +.|..+++.|++|+|||||..
T Consensus        29 ~~G~~~~i~G~nG~GKSTLl~   49 (204)
T cd03250          29 PKGELVAIVGPVGSGKSSLLS   49 (204)
T ss_pred             CCCCEEEEECCCCCCHHHHHH
Confidence            678999999999999999765


No 209
>PRK14250 phosphate ABC transporter ATP-binding protein; Provisional
Probab=87.96  E-value=0.27  Score=49.03  Aligned_cols=21  Identities=38%  Similarity=0.605  Sum_probs=18.7

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|..+++.|+||+|||||..
T Consensus        27 ~~Ge~~~i~G~nGsGKSTLl~   47 (241)
T PRK14250         27 EGGAIYTIVGPSGAGKSTLIK   47 (241)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            468899999999999999765


No 210
>TIGR03238 dnd_assoc_3 dnd system-associated protein 3. cereus E33L, Hahella chejuensis KCTC 2396, Pseudoalteromonas haloplanktis TAC12, and Escherichia coli B7A.
Probab=87.96  E-value=0.25  Score=55.26  Aligned_cols=21  Identities=24%  Similarity=0.483  Sum_probs=18.9

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|..+++.|.||||||||..
T Consensus        30 ~~GEiv~L~G~SGsGKSTLLr   50 (504)
T TIGR03238        30 PSSSLLFLCGSSGDGKSEILA   50 (504)
T ss_pred             cCCCEEEEECCCCCCHHHHHh
Confidence            568999999999999999766


No 211
>PRK14248 phosphate ABC transporter ATP-binding protein; Provisional
Probab=87.95  E-value=0.26  Score=49.85  Aligned_cols=21  Identities=33%  Similarity=0.507  Sum_probs=18.7

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|..+++.|.||+|||||..
T Consensus        45 ~~Ge~~~i~G~nGsGKSTLl~   65 (268)
T PRK14248         45 EKHAVTALIGPSGCGKSTFLR   65 (268)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            568999999999999999764


No 212
>PRK13649 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=87.94  E-value=0.26  Score=50.22  Aligned_cols=21  Identities=38%  Similarity=0.775  Sum_probs=18.9

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      +.|..+++.|+||+|||||..
T Consensus        31 ~~Ge~~~l~G~nGsGKSTLl~   51 (280)
T PRK13649         31 EDGSYTAFIGHTGSGKSTIMQ   51 (280)
T ss_pred             cCCcEEEEECCCCCCHHHHHH
Confidence            578999999999999999765


No 213
>cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters. PDR is a well-described phenomenon occurring in fungi and shares several similarities with processes in bacteria and higher eukaryotes.  This PDR subfamily represents domain I of its (ABC-IM)2 organization.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds including sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=87.91  E-value=0.26  Score=47.51  Aligned_cols=21  Identities=48%  Similarity=0.695  Sum_probs=18.7

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      +.|..+++.|+||+|||||..
T Consensus        31 ~~Ge~~~l~G~nGsGKSTLl~   51 (192)
T cd03232          31 KPGTLTALMGESGAGKTTLLD   51 (192)
T ss_pred             eCCcEEEEECCCCCCHHHHHH
Confidence            568999999999999999765


No 214
>PF13401 AAA_22:  AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B.
Probab=87.91  E-value=0.24  Score=43.64  Aligned_cols=20  Identities=35%  Similarity=0.517  Sum_probs=13.7

Q ss_pred             CCCEEEEEecCCCCcccccc
Q 008523          333 DGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       333 ~G~valfFGLSGTGKTTLsa  352 (563)
                      ++..+++.|.+|+|||++..
T Consensus         3 ~~~~~~i~G~~G~GKT~~~~   22 (131)
T PF13401_consen    3 SQRILVISGPPGSGKTTLIK   22 (131)
T ss_dssp             ----EEEEE-TTSSHHHHHH
T ss_pred             CCcccEEEcCCCCCHHHHHH
Confidence            45679999999999999765


No 215
>PRK13645 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=87.90  E-value=0.25  Score=50.65  Aligned_cols=21  Identities=33%  Similarity=0.602  Sum_probs=18.9

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|..+++.|+||+|||||..
T Consensus        35 ~~Ge~~~l~G~nGsGKSTLl~   55 (289)
T PRK13645         35 KKNKVTCVIGTTGSGKSTMIQ   55 (289)
T ss_pred             eCCCEEEEECCCCCCHHHHHH
Confidence            568999999999999999765


No 216
>PRK11144 modC molybdate transporter ATP-binding protein; Provisional
Probab=87.90  E-value=0.26  Score=52.41  Aligned_cols=21  Identities=38%  Similarity=0.619  Sum_probs=18.7

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|..++++|+||+|||||..
T Consensus        22 ~~Ge~~~l~G~nGsGKSTLl~   42 (352)
T PRK11144         22 PAQGITAIFGRSGAGKTSLIN   42 (352)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            568899999999999999765


No 217
>cd00464 SK Shikimate kinase (SK) is the fifth enzyme in the shikimate pathway, a seven-step biosynthetic pathway which converts erythrose-4-phosphate to chorismic acid, found in bacteria, fungi and plants. Chorismic acid is a important intermediate in the synthesis of aromatic compounds, such as aromatic amino acids, p-aminobenzoic acid, folate and ubiquinone. Shikimate kinase catalyses the phosphorylation of the 3-hydroxyl group of shikimic acid using ATP.
Probab=87.89  E-value=0.19  Score=45.58  Aligned_cols=17  Identities=35%  Similarity=0.663  Sum_probs=15.1

Q ss_pred             EEEEEecCCCCcccccc
Q 008523          336 VALFFGLSGTGKTTLST  352 (563)
Q Consensus       336 valfFGLSGTGKTTLsa  352 (563)
                      ++++.|++||||||++.
T Consensus         1 ~i~l~G~~GsGKstla~   17 (154)
T cd00464           1 NIVLIGMMGAGKTTVGR   17 (154)
T ss_pred             CEEEEcCCCCCHHHHHH
Confidence            37899999999999876


No 218
>PRK11831 putative ABC transporter ATP-binding protein YrbF; Provisional
Probab=87.88  E-value=0.27  Score=49.98  Aligned_cols=21  Identities=43%  Similarity=0.640  Sum_probs=18.8

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|..+++.|+||+|||||..
T Consensus        31 ~~Ge~~~i~G~nGsGKSTLl~   51 (269)
T PRK11831         31 PRGKITAIMGPSGIGKTTLLR   51 (269)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            568999999999999999765


No 219
>PRK14262 phosphate ABC transporter ATP-binding protein; Provisional
Probab=87.87  E-value=0.27  Score=49.02  Aligned_cols=21  Identities=38%  Similarity=0.510  Sum_probs=18.7

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|..+++.|++|+|||||..
T Consensus        27 ~~Ge~~~i~G~nGsGKSTLl~   47 (250)
T PRK14262         27 FKNQITAIIGPSGCGKTTLLR   47 (250)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            568899999999999999764


No 220
>PRK10851 sulfate/thiosulfate transporter subunit; Provisional
Probab=87.85  E-value=0.26  Score=52.64  Aligned_cols=21  Identities=43%  Similarity=0.683  Sum_probs=18.9

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|..+++.|+||||||||..
T Consensus        26 ~~Ge~~~llGpsGsGKSTLLr   46 (353)
T PRK10851         26 PSGQMVALLGPSGSGKTTLLR   46 (353)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            578999999999999999765


No 221
>PRK14240 phosphate transporter ATP-binding protein; Provisional
Probab=87.77  E-value=0.27  Score=48.95  Aligned_cols=21  Identities=33%  Similarity=0.589  Sum_probs=18.8

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|..+++.|+||+|||||..
T Consensus        27 ~~Ge~~~i~G~nGsGKSTLl~   47 (250)
T PRK14240         27 EENQVTALIGPSGCGKSTFLR   47 (250)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            568899999999999999765


No 222
>PF00910 RNA_helicase:  RNA helicase;  InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5). All of the proteins bind ATP and, consequently, all of them carry the classical Walker A (phosphate-binding loop or P-loop) and Walker B (Mg2+-binding aspartic acid) motifs. Superfamily 3 consists of helicases encoded mainly by small DNA viruses and some large nucleocytoplasmic DNA viruses [, ]. Small viruses are very dependent on the host-cell machinery to replicate. SF3 helicase in small viruses is associated with an origin-binding domain. By pairing a domain that recognises the ori with a helicase, the virus can bypass the host-cell-based regulation pathway and initiate its own replication. The protein binds to the viral ori leading to origin unwinding. Cellular replication proteins are then recruited to the ori and the viral DNA is replicated. In SF3 helicases the Walker A and Walker B motifs are separated by spacers of rather uniform, and relatively short, length. In addition to the A and B motifs this family is characterised by a third motif (C) which resides between the B motif and the C terminus of the conserved region. This motif consists of an Asn residue preceded by a run of hydrophobic residues []. Several structures of SF3 helicases have been solved []. They all possess the same core alpha/beta fold, consisting of a five-stranded parallel beta sheet flanked on both sides by several alpha helices. In contrast to SF1 and SF2 helicases, which have RecA-like core folds, the strand connectivity within the alpha/beta core domain is that of AAA+ proteins []. The SF3 helicase proteins assemble into a hexameric ring. Some proteins known to contain an SF3 helicase domain are listed below:  Polyomavirus large T antigen. It initiates DNA unwinding and replication via interactions with the viral origin of replication. Papillomavirus E1 protein. An ATP-dependent DNA helicase required for initiation of viral DNA replication. Parvovirus Rep/NS1 protein, which is also required for the initiation of viral replication. Poxviridae and other large DNA viruses D5 protein. Bacteriophage DNA primase/helicase protein. Bacterial prophage DNA primase/helicase protein.   The entry represents the core alpha/beta fold of the SF3 helicase domain found predominantly in DNA viruses.; GO: 0003723 RNA binding, 0003724 RNA helicase activity
Probab=87.72  E-value=0.18  Score=44.40  Aligned_cols=16  Identities=38%  Similarity=0.715  Sum_probs=14.4

Q ss_pred             EEEEecCCCCcccccc
Q 008523          337 ALFFGLSGTGKTTLST  352 (563)
Q Consensus       337 alfFGLSGTGKTTLsa  352 (563)
                      ++|+|.+|+|||+|+.
T Consensus         1 I~i~G~~G~GKS~l~~   16 (107)
T PF00910_consen    1 IWIYGPPGIGKSTLAK   16 (107)
T ss_pred             CEEECCCCCCHHHHHH
Confidence            4799999999999877


No 223
>cd03369 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type transporter 1).  NFT1 belongs to the MRP (mulrtidrug resisitance-associated protein) family of ABC transporters.  Some of the MRP members have five additional transmembrane segments in their N-terminas, but the function of these additional membrane-spanning domains is not clear.  The MRP was found in the multidrug-resisting lung cancer cell in which p-glycoprotein was not overexpressed.  MRP exports glutathione by drug stimulation, as well as, certain substrates in conjugated forms with anions such as glutathione, glucuronate, and sulfate.
Probab=87.71  E-value=0.29  Score=47.43  Aligned_cols=21  Identities=38%  Similarity=0.544  Sum_probs=18.9

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|..+++.|++|+|||||..
T Consensus        32 ~~G~~~~i~G~nGsGKSTLl~   52 (207)
T cd03369          32 KAGEKIGIVGRTGAGKSTLIL   52 (207)
T ss_pred             CCCCEEEEECCCCCCHHHHHH
Confidence            578999999999999999765


No 224
>PRK03839 putative kinase; Provisional
Probab=87.70  E-value=0.21  Score=47.25  Aligned_cols=17  Identities=41%  Similarity=0.610  Sum_probs=15.1

Q ss_pred             EEEEEecCCCCcccccc
Q 008523          336 VALFFGLSGTGKTTLST  352 (563)
Q Consensus       336 valfFGLSGTGKTTLsa  352 (563)
                      .++++|++|+||||++.
T Consensus         2 ~I~l~G~pGsGKsT~~~   18 (180)
T PRK03839          2 IIAITGTPGVGKTTVSK   18 (180)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            47899999999999876


No 225
>PRK15056 manganese/iron transporter ATP-binding protein; Provisional
Probab=87.67  E-value=0.28  Score=49.91  Aligned_cols=21  Identities=38%  Similarity=0.722  Sum_probs=18.8

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|..+++.|+||+|||||..
T Consensus        31 ~~Ge~~~l~G~nGsGKSTLl~   51 (272)
T PRK15056         31 PGGSIAALVGVNGSGKSTLFK   51 (272)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            578999999999999999764


No 226
>PRK11000 maltose/maltodextrin transporter ATP-binding protein; Provisional
Probab=87.66  E-value=0.27  Score=52.77  Aligned_cols=21  Identities=43%  Similarity=0.790  Sum_probs=18.7

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|..++++|+||||||||..
T Consensus        27 ~~Ge~~~l~G~nGsGKSTLL~   47 (369)
T PRK11000         27 HEGEFVVFVGPSGCGKSTLLR   47 (369)
T ss_pred             cCCCEEEEECCCCCcHHHHHH
Confidence            568899999999999999765


No 227
>PRK13548 hmuV hemin importer ATP-binding subunit; Provisional
Probab=87.62  E-value=0.28  Score=49.53  Aligned_cols=21  Identities=38%  Similarity=0.707  Sum_probs=18.8

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|..+++.|+||+|||||..
T Consensus        26 ~~Ge~~~i~G~nGsGKSTLl~   46 (258)
T PRK13548         26 RPGEVVAILGPNGAGKSTLLR   46 (258)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            568999999999999999765


No 228
>cd03244 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C.  This family is also known as MRP (mulrtidrug resisitance-associated protein).  Some of the MRP members have five additional transmembrane segments in their N-terminus, but the function of these additional membrane-spanning domains is not clear.  The MRP was found in the multidrug-resistance lung cancer cell in which p-glycoprotein was not overexpressed.  MRP exports glutathione by drug stimulation, as well as, certain substrates in conjugated forms with anions, such as glutathione, glucuronate, and sulfate.
Probab=87.61  E-value=0.29  Score=47.68  Aligned_cols=21  Identities=33%  Similarity=0.545  Sum_probs=18.7

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      +.|..+++.|++|+|||||..
T Consensus        28 ~~Ge~~~i~G~nGsGKSTLl~   48 (221)
T cd03244          28 KPGEKVGIVGRTGSGKSSLLL   48 (221)
T ss_pred             CCCCEEEEECCCCCCHHHHHH
Confidence            568899999999999999764


No 229
>PF05673 DUF815:  Protein of unknown function (DUF815);  InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function.
Probab=87.61  E-value=0.16  Score=52.27  Aligned_cols=131  Identities=28%  Similarity=0.321  Sum_probs=63.5

Q ss_pred             CEEEEEecCCCCcccccc-------cCCCceeecC-ceeecCCCcc----ccCCceeEeecCCCCCCCchhhhhccccce
Q 008523          335 DVALFFGLSGTGKTTLST-------DHNRYLIGDD-EHCWGDNGVS----NIEGGCYAKCIDLSREKEPDIWNAIKFGAV  402 (563)
Q Consensus       335 ~valfFGLSGTGKTTLsa-------d~~r~lIgDD-e~~w~~~Gvf----n~EgGcyaK~~dLs~e~EP~I~~ai~f~ai  402 (563)
                      ..++++|..|||||+|..       +.+=+||-=+ +..-+-..++    +..-=+-.=||||+=+..-.-|+++|  ++
T Consensus        53 nnvLL~G~rGtGKSSlVkall~~y~~~GLRlIev~k~~L~~l~~l~~~l~~~~~kFIlf~DDLsFe~~d~~yk~LK--s~  130 (249)
T PF05673_consen   53 NNVLLWGARGTGKSSLVKALLNEYADQGLRLIEVSKEDLGDLPELLDLLRDRPYKFILFCDDLSFEEGDTEYKALK--SV  130 (249)
T ss_pred             cceEEecCCCCCHHHHHHHHHHHHhhcCceEEEECHHHhccHHHHHHHHhcCCCCEEEEecCCCCCCCcHHHHHHH--HH
Confidence            358999999999998764       2222222111 0000000011    12222334578888555555666654  55


Q ss_pred             eeeeEE-cCCCCcccCCCCCcccceeEEEecccccCCcCCCCCCCcceEEE--EE-eccCCCCCCeeecCHHHHHH
Q 008523          403 LENVVF-DEHTREVDYSDKSVTENTRAAYPIEYIPNAKIPCVGPHPKNVIL--LA-CDAFGVLPPVSKLNLAQTMY  474 (563)
Q Consensus       403 lENV~~-d~~~~~vdf~d~s~t~NtR~~yPi~~i~N~~~~~~~g~P~~iIf--lt-~Da~gvLPPVskLt~eQA~~  474 (563)
                      ||.-+. -|+ +.+-|    .|.|-|-.+|-.+.+|...+.-.-||.+.+=  ++ .|+||.-  |....++|..|
T Consensus       131 LeGgle~~P~-Nvliy----ATSNRRHLv~E~~~d~~~~~~~eih~~d~~eEklSLsDRFGL~--l~F~~~~q~~Y  199 (249)
T PF05673_consen  131 LEGGLEARPD-NVLIY----ATSNRRHLVPESFSDREDIQDDEIHPSDTIEEKLSLSDRFGLW--LSFYPPDQEEY  199 (249)
T ss_pred             hcCccccCCC-cEEEE----EecchhhccchhhhhccCCCccccCcchHHHHHHhHHHhCCcE--EEecCCCHHHH
Confidence            544222 121 22222    3567777777777776542221234444332  22 5667643  44444555554


No 230
>cd01120 RecA-like_NTPases RecA-like NTPases. This family includes the NTP binding domain of F1 and V1 H+ATPases, DnaB and related helicases as well as bacterial RecA and related eukaryotic and archaeal recombinases. This group also includes bacterial conjugation proteins and related DNA transfer proteins involved in type II and type IV secretion.
Probab=87.60  E-value=0.22  Score=44.53  Aligned_cols=16  Identities=56%  Similarity=0.891  Sum_probs=14.5

Q ss_pred             EEEEecCCCCcccccc
Q 008523          337 ALFFGLSGTGKTTLST  352 (563)
Q Consensus       337 alfFGLSGTGKTTLsa  352 (563)
                      ++++|.+|+|||||+.
T Consensus         2 ~~i~G~~G~GKT~l~~   17 (165)
T cd01120           2 ILVFGPTGSGKTTLAL   17 (165)
T ss_pred             eeEeCCCCCCHHHHHH
Confidence            6899999999999776


No 231
>CHL00181 cbbX CbbX; Provisional
Probab=87.56  E-value=0.28  Score=50.96  Aligned_cols=48  Identities=29%  Similarity=0.367  Sum_probs=29.0

Q ss_pred             hhHHHHHHHHHHhcccCceeeecccceecCCCCEEEEEecCCCCcccccc
Q 008523          303 EMKKGLFSVMHYLMPKRQILSLHSGCNMGKDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       303 EiKK~iltl~n~~l~~~G~L~mH~sanvg~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|+-+..+..++...+  +-.+.+......|..++|.|++||||||++.
T Consensus        30 ~vK~~i~e~~~~~~~~~--~~~~~g~~~~~~~~~ill~G~pGtGKT~lAr   77 (287)
T CHL00181         30 PVKTRIREIAALLLIDR--LRKNLGLTSSNPGLHMSFTGSPGTGKTTVAL   77 (287)
T ss_pred             HHHHHHHHHHHHHHHHH--HHHHcCCCCCCCCceEEEECCCCCCHHHHHH
Confidence            57887776665433211  0011122222346679999999999999876


No 232
>PF00448 SRP54:  SRP54-type protein, GTPase domain;  InterPro: IPR000897  The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ]. SRP recognises the signal sequence of the nascent polypeptide on the ribosome, retards its elongation, and docks the SRP-ribosome-polypeptide complex to the RER membrane via the SR receptor. Eukaryotic SRP consists of six polypeptides (SRP9, SRP14, SRP19, SRP54, SRP68 and SRP72) and a single 300 nucleotide 7S RNA molecule. The RNA component catalyses the interaction of SRP with its SR receptor []. In higher eukaryotes, the SRP complex consists of the Alu domain and the S domain linked by the SRP RNA. The Alu domain consists of a heterodimer of SRP9 and SRP14 bound to the 5' and 3' terminal sequences of SRP RNA. This domain is necessary for retarding the elongation of the nascent polypeptide chain, which gives SRP time to dock the ribosome-polypeptide complex to the RER membrane. In archaea, the SRP complex contains 7S RNA like its eukaryotic counterpart, yet only includes two of the six protein subunits found in the eukarytic complex: SRP19 and SRP54 []. This entry represents the GTPase domain of the 54 kDa SRP54 component, a GTP-binding protein that interacts with the signal sequence when it emerges from the ribosome. SRP54 of the signal recognition particle has a three-domain structure: an N-terminal helical bundle domain, a GTPase domain, and the M-domain that binds the 7s RNA and also binds the signal sequence. The extreme C-terminal region is glycine-rich and lower in complexity and poorly conserved between species. The GTPase domain is evolutionary related to P-loop NTPase domains found in a variety of other proteins []. These proteins include Escherichia coli and Bacillus subtilis ffh protein (P48), which seems to be the prokaryotic counterpart of SRP54; signal recognition particle receptor alpha subunit (docking protein), an integral membrane GTP-binding protein which ensures, in conjunction with SRP, the correct targeting of nascent secretory proteins to the endoplasmic reticulum membrane; bacterial FtsY protein, which is believed to play a similar role to that of the docking protein in eukaryotes; the pilA protein from Neisseria gonorrhoeae, the homologue of ftsY; and bacterial flagellar biosynthesis protein flhF.; GO: 0005525 GTP binding, 0006614 SRP-dependent cotranslational protein targeting to membrane; PDB: 2OG2_A 3B9Q_A 3DM9_B 3DMD_B 3E70_C 3DM5_B 2XXA_C 2J28_9 1ZU5_B 1ZU4_A ....
Probab=87.52  E-value=0.23  Score=48.87  Aligned_cols=18  Identities=39%  Similarity=0.532  Sum_probs=16.0

Q ss_pred             CEEEEEecCCCCcccccc
Q 008523          335 DVALFFGLSGTGKTTLST  352 (563)
Q Consensus       335 ~valfFGLSGTGKTTLsa  352 (563)
                      ++++|.|++|+||||+.+
T Consensus         2 ~vi~lvGptGvGKTTt~a   19 (196)
T PF00448_consen    2 KVIALVGPTGVGKTTTIA   19 (196)
T ss_dssp             EEEEEEESTTSSHHHHHH
T ss_pred             EEEEEECCCCCchHhHHH
Confidence            478999999999999776


No 233
>PRK14259 phosphate ABC transporter ATP-binding protein; Provisional
Probab=87.51  E-value=0.29  Score=49.80  Aligned_cols=21  Identities=38%  Similarity=0.602  Sum_probs=18.9

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|..+++.|+||+|||||..
T Consensus        37 ~~Ge~~~l~G~nGsGKSTLl~   57 (269)
T PRK14259         37 PRGKVTALIGPSGCGKSTVLR   57 (269)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            578999999999999999765


No 234
>PRK11701 phnK phosphonate C-P lyase system protein PhnK; Provisional
Probab=87.50  E-value=0.28  Score=49.26  Aligned_cols=21  Identities=48%  Similarity=0.583  Sum_probs=18.9

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      +.|..+++.|+||+|||||..
T Consensus        30 ~~Ge~~~i~G~nGsGKSTLl~   50 (258)
T PRK11701         30 YPGEVLGIVGESGSGKTTLLN   50 (258)
T ss_pred             eCCCEEEEECCCCCCHHHHHH
Confidence            578999999999999999765


No 235
>PRK14256 phosphate ABC transporter ATP-binding protein; Provisional
Probab=87.50  E-value=0.29  Score=48.92  Aligned_cols=21  Identities=33%  Similarity=0.536  Sum_probs=18.9

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|..+++.|.||+|||||..
T Consensus        28 ~~Ge~~~i~G~nGsGKSTLl~   48 (252)
T PRK14256         28 PENSVTAIIGPSGCGKSTVLR   48 (252)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            568999999999999999765


No 236
>PRK15093 antimicrobial peptide ABC transporter ATP-binding protein; Provisional
Probab=87.49  E-value=0.29  Score=51.59  Aligned_cols=21  Identities=29%  Similarity=0.642  Sum_probs=19.0

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|+++++.|.||+|||||..
T Consensus        31 ~~Ge~~~ivG~sGsGKSTLl~   51 (330)
T PRK15093         31 TEGEIRGLVGESGSGKSLIAK   51 (330)
T ss_pred             CCCCEEEEECCCCCCHHHHHH
Confidence            678999999999999999765


No 237
>PRK14530 adenylate kinase; Provisional
Probab=87.47  E-value=0.26  Score=48.34  Aligned_cols=19  Identities=37%  Similarity=0.524  Sum_probs=16.8

Q ss_pred             CCEEEEEecCCCCcccccc
Q 008523          334 GDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       334 G~valfFGLSGTGKTTLsa  352 (563)
                      +..++|+|++|+||||++.
T Consensus         3 ~~~I~i~G~pGsGKsT~~~   21 (215)
T PRK14530          3 QPRILLLGAPGAGKGTQSS   21 (215)
T ss_pred             CCEEEEECCCCCCHHHHHH
Confidence            4579999999999999876


No 238
>TIGR01277 thiQ thiamine ABC transporter, ATP-binding protein. This model describes the energy-transducing ATPase subunit ThiQ of the ThiBPQ thiamine (and thiamine pyrophosphate) ABC transporter in several Proteobacteria. This protein is found so far only in Proteobacteria, and is found in complete genomes only if the ThiB and ThiP subunits are also found.
Probab=87.45  E-value=0.28  Score=47.76  Aligned_cols=21  Identities=43%  Similarity=0.764  Sum_probs=18.9

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|+.+++.|+||+|||||..
T Consensus        22 ~~Ge~~~i~G~nGsGKSTLl~   42 (213)
T TIGR01277        22 ADGEIVAIMGPSGAGKSTLLN   42 (213)
T ss_pred             eCCcEEEEECCCCCCHHHHHH
Confidence            578999999999999999765


No 239
>cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export.  They belong to the subfamily C of the ATP-binding cassette (ABC) superfamily of transport proteins.  The ABCC subfamily contains transporters with a diverse functional spectrum that includes ion transport, cell surface receptor, and toxin secretion activities.  The MRP-like family, simlar to all ABC proteins, have a common four-domain core structure constituted by two membrane-spanning domains, each composed of six transmembrane (TM) helices, and two nucleotide-binding domains (NBD).  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=87.42  E-value=0.31  Score=46.02  Aligned_cols=21  Identities=43%  Similarity=0.643  Sum_probs=18.9

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|..+++.|++|+|||||..
T Consensus        26 ~~G~~~~l~G~nGsGKstLl~   46 (171)
T cd03228          26 KPGEKVAIVGPSGSGKSTLLK   46 (171)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            568999999999999999765


No 240
>PRK13638 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=87.42  E-value=0.29  Score=49.66  Aligned_cols=21  Identities=33%  Similarity=0.387  Sum_probs=18.6

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|..+++.|+||+|||||..
T Consensus        25 ~~Ge~~~i~G~nGsGKSTLl~   45 (271)
T PRK13638         25 SLSPVTGLVGANGCGKSTLFM   45 (271)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            468899999999999999765


No 241
>PRK06696 uridine kinase; Validated
Probab=87.41  E-value=0.25  Score=48.92  Aligned_cols=18  Identities=28%  Similarity=0.375  Sum_probs=16.4

Q ss_pred             CEEEEEecCCCCcccccc
Q 008523          335 DVALFFGLSGTGKTTLST  352 (563)
Q Consensus       335 ~valfFGLSGTGKTTLsa  352 (563)
                      ..+++-|.||||||||+.
T Consensus        23 ~iI~I~G~sgsGKSTlA~   40 (223)
T PRK06696         23 LRVAIDGITASGKTTFAD   40 (223)
T ss_pred             eEEEEECCCCCCHHHHHH
Confidence            479999999999999887


No 242
>TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit. This model describes the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea. This transport system belong to the larger ATP-Binding Cassette (ABC) transporter superfamily. The characteristic feature of these transporter is the obligatory coupling of ATP hydrolysis to substrate translocation. The minimal configuration of bacterial ABC transport system: an ATPase or ATP binding subunit; An integral membrane protein; a hydrophilic polypetpide, which likely functions as substrate binding protein. Functionally, this transport system is involved in osmoregulation. Under conditions of stress, the organism recruits these transport system to accumulate glycine betaine and other solutes which offer osmo-protection. It has been demonstrated that glycine betaine uptake is accompanied by symport with sodium ions. The locus has been named variously as proU or opuA. A gene library from L.lact
Probab=87.39  E-value=0.28  Score=52.83  Aligned_cols=21  Identities=38%  Similarity=0.743  Sum_probs=18.9

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|..+++.|+||||||||..
T Consensus        17 ~~Gei~~l~G~sGsGKSTLLr   37 (363)
T TIGR01186        17 AKGEIFVIMGLSGSGKSTTVR   37 (363)
T ss_pred             cCCCEEEEECCCCChHHHHHH
Confidence            678999999999999999764


No 243
>PRK14261 phosphate ABC transporter ATP-binding protein; Provisional
Probab=87.37  E-value=0.3  Score=48.86  Aligned_cols=21  Identities=38%  Similarity=0.539  Sum_probs=18.7

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|..+++.|+||+|||||..
T Consensus        30 ~~Ge~~~i~G~nGsGKSTLl~   50 (253)
T PRK14261         30 PKNRVTALIGPSGCGKSTLLR   50 (253)
T ss_pred             CCCcEEEEECCCCCCHHHHHH
Confidence            568899999999999999765


No 244
>PRK13547 hmuV hemin importer ATP-binding subunit; Provisional
Probab=87.37  E-value=0.3  Score=50.11  Aligned_cols=21  Identities=38%  Similarity=0.665  Sum_probs=18.8

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|..+++.|+||+|||||..
T Consensus        25 ~~Ge~~~l~G~nGsGKSTLl~   45 (272)
T PRK13547         25 EPGRVTALLGRNGAGKSTLLK   45 (272)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            568999999999999999765


No 245
>cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters.  PDR is a well-described phenomenon occurring in fungi and shares several similarities with processes in bacteria and higher eukaryotes.  This PDR subfamily represents domain I of its (ABC-IM)2 organization.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds including sugars, ions, peptides, and more complex organic molecules.  The nucleotide-binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=87.34  E-value=0.3  Score=47.50  Aligned_cols=21  Identities=38%  Similarity=0.672  Sum_probs=18.8

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|..+++.|.+|+|||||..
T Consensus        31 ~~Ge~~~i~G~nGsGKSTLl~   51 (202)
T cd03233          31 KPGEMVLVLGRPGSGCSTLLK   51 (202)
T ss_pred             CCCcEEEEECCCCCCHHHHHH
Confidence            578899999999999999765


No 246
>cd03248 ABCC_TAP TAP, the Transporter Associated with Antigen Processing; TAP is essential for peptide delivery from the cytosol into the lumen of the endoplasmic reticulum (ER), where these peptides are loaded on major histocompatibility complex (MHC) I molecules.  Loaded MHC I leave the ER and display their antigenic cargo on the cell surface to cytotoxic T cells.  Subsequently, virus-infected or malignantly transformed cells can be eliminated.  TAP belongs to the large family of ATP-binding cassette (ABC) transporters, which translocate a vast variety of solutes across membranes.
Probab=87.34  E-value=0.31  Score=47.78  Aligned_cols=21  Identities=38%  Similarity=0.697  Sum_probs=18.9

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|..+++.|++|+|||||..
T Consensus        38 ~~Ge~~~i~G~nGsGKSTLl~   58 (226)
T cd03248          38 HPGEVTALVGPSGSGKSTVVA   58 (226)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            568999999999999999765


No 247
>cd03251 ABCC_MsbA MsbA is an essential ABC transporter, closely related to eukaryotic MDR proteins.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=87.33  E-value=0.31  Score=47.94  Aligned_cols=21  Identities=38%  Similarity=0.656  Sum_probs=18.8

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|..+++.|++|+|||||..
T Consensus        26 ~~Ge~~~i~G~nGsGKSTLl~   46 (234)
T cd03251          26 PAGETVALVGPSGSGKSTLVN   46 (234)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            568999999999999999765


No 248
>TIGR02769 nickel_nikE nickel import ATP-binding protein NikE. This family represents the NikE subunit of a multisubunit nickel import ABC transporter complex. Nickel, once imported, may be used in urease and in certain classes of hydrogenase and superoxide dismutase.
Probab=87.31  E-value=0.3  Score=49.40  Aligned_cols=21  Identities=38%  Similarity=0.703  Sum_probs=19.0

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|+.+++.|+||+|||||..
T Consensus        35 ~~Ge~~~i~G~nGsGKSTLl~   55 (265)
T TIGR02769        35 EEGETVGLLGRSGCGKSTLAR   55 (265)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            678999999999999999765


No 249
>PRK15112 antimicrobial peptide ABC system ATP-binding protein SapF; Provisional
Probab=87.31  E-value=0.3  Score=49.54  Aligned_cols=21  Identities=33%  Similarity=0.703  Sum_probs=18.8

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      +.|+.+++.|+||+|||||..
T Consensus        37 ~~Ge~~~i~G~NGsGKSTLl~   57 (267)
T PRK15112         37 REGQTLAIIGENGSGKSTLAK   57 (267)
T ss_pred             cCCCEEEEEcCCCCCHHHHHH
Confidence            578999999999999999765


No 250
>PRK13632 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=87.30  E-value=0.3  Score=49.62  Aligned_cols=21  Identities=33%  Similarity=0.733  Sum_probs=18.7

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|..+++.|+||+|||||..
T Consensus        33 ~~Ge~~~l~G~nGsGKSTLl~   53 (271)
T PRK13632         33 NEGEYVAILGHNGSGKSTISK   53 (271)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            568999999999999999764


No 251
>PRK10619 histidine/lysine/arginine/ornithine transporter subunit; Provisional
Probab=87.29  E-value=0.3  Score=49.00  Aligned_cols=21  Identities=43%  Similarity=0.676  Sum_probs=19.0

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|+.+++.|.||+|||||..
T Consensus        29 ~~Ge~~~l~G~nGsGKSTLl~   49 (257)
T PRK10619         29 NAGDVISIIGSSGSGKSTFLR   49 (257)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            578999999999999999765


No 252
>cd03267 ABC_NatA_like Similar in sequence to NatA, this is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled to proton or K+ uptake.  NatB possess six putative membrane spanning regions at its C-terminus.  In B. subtilis, NatAB is inducible by agents such as ethanol and protonophores, which lower the protonmotive force across the membrane.  The closest sequence similarity to NatA is exhibited by DrrA of the two-component daunomycin- and doxorubicin-efflux system.  Hence, the functional NatAB is presumably assembled with two copies of the single ATP-binding protein and the single intergral membrane protein.
Probab=87.25  E-value=0.3  Score=48.54  Aligned_cols=21  Identities=38%  Similarity=0.662  Sum_probs=18.8

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|..+++.|.+|+|||||..
T Consensus        45 ~~Ge~~~i~G~NGsGKSTLl~   65 (236)
T cd03267          45 EKGEIVGFIGPNGAGKTTTLK   65 (236)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            678999999999999999754


No 253
>TIGR00455 apsK adenylylsulfate kinase (apsK). Important residue (active site in E.coli) is residue 100 of the seed alignment.
Probab=87.24  E-value=0.26  Score=46.89  Aligned_cols=21  Identities=43%  Similarity=0.711  Sum_probs=18.5

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|..+++.|+||+||||++.
T Consensus        16 ~~~~~i~i~G~~GsGKstla~   36 (184)
T TIGR00455        16 HRGVVIWLTGLSGSGKSTIAN   36 (184)
T ss_pred             CCCeEEEEECCCCCCHHHHHH
Confidence            457899999999999999876


No 254
>PRK13541 cytochrome c biogenesis protein CcmA; Provisional
Probab=87.23  E-value=0.31  Score=46.89  Aligned_cols=21  Identities=24%  Similarity=0.408  Sum_probs=18.7

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|..+++.|.+|+|||||..
T Consensus        24 ~~Ge~~~l~G~nGsGKSTLl~   44 (195)
T PRK13541         24 LPSAITYIKGANGCGKSSLLR   44 (195)
T ss_pred             cCCcEEEEECCCCCCHHHHHH
Confidence            568899999999999999764


No 255
>PRK09984 phosphonate/organophosphate ester transporter subunit; Provisional
Probab=87.21  E-value=0.31  Score=49.13  Aligned_cols=21  Identities=38%  Similarity=0.713  Sum_probs=18.8

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|..+++.|+||+|||||..
T Consensus        28 ~~Ge~~~i~G~nGsGKSTLl~   48 (262)
T PRK09984         28 HHGEMVALLGPSGSGKSTLLR   48 (262)
T ss_pred             cCCcEEEEECCCCCCHHHHHH
Confidence            568999999999999999765


No 256
>cd03234 ABCG_White The White subfamily represents ABC transporters homologous to the Drosophila white gene, which acts as a dimeric importer for eye pigment precursors.  The eye pigmentation of Drosophila is developed from the synthesis and deposition in the cells of red pigments, which are synthesized from guanine, and brown pigments, which are synthesized from tryptophan.  The pigment precursors are encoded by the white, brown, and scarlet genes, respectively.  Evidence from genetic and biochemical studies suggest that the White and Brown proteins function as heterodimers to import guanine, while the White and Scarlet proteins function to import tryptophan.  However, a recent study also suggests that White may be involved in the transport of a metabolite, such as 3-hydroxykynurenine, across intracellular membranes.  Mammalian ABC transporters belonging to the White subfamily (ABCG1, ABCG5, and ABCG8) have been shown to be involved in the regulation of lipid-trafficking mechanisms in 
Probab=87.20  E-value=0.3  Score=48.02  Aligned_cols=21  Identities=48%  Similarity=0.718  Sum_probs=18.7

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|..+++.|+||+|||||..
T Consensus        31 ~~Ge~~~l~G~nGsGKSTLlk   51 (226)
T cd03234          31 ESGQVMAILGSSGSGKTTLLD   51 (226)
T ss_pred             cCCeEEEEECCCCCCHHHHHH
Confidence            568899999999999999765


No 257
>TIGR03499 FlhF flagellar biosynthetic protein FlhF.
Probab=87.19  E-value=0.26  Score=50.90  Aligned_cols=21  Identities=38%  Similarity=0.583  Sum_probs=18.4

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..+.+++|.|++|+||||+.+
T Consensus       192 ~~~~vi~~vGptGvGKTTt~~  212 (282)
T TIGR03499       192 EQGGVIALVGPTGVGKTTTLA  212 (282)
T ss_pred             CCCeEEEEECCCCCCHHHHHH
Confidence            457799999999999999776


No 258
>cd03290 ABCC_SUR1_N The SUR domain 1.  The sulfonylurea receptor SUR is an ATP transporter of the ABCC/MRP family with tandem ATPase binding domains.  Unlike other ABC proteins, it has no intrinsic transport function, neither active nor passive, but associates with the potassium channel proteins Kir6.1 or Kir6.2 to form the ATP-sensitive potassium (K(ATP)) channel.  Within the channel complex, SUR serves as a regulatory subunit that fine-tunes the gating of Kir6.x in response to alterations in cellular metabolism.  It constitutes a major pharmaceutical target as it binds numerous drugs, K(ATP) channel openers and blockers, capable of up- or down-regulating channel activity.
Probab=87.17  E-value=0.32  Score=47.49  Aligned_cols=21  Identities=29%  Similarity=0.583  Sum_probs=18.6

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|..+++.|+||+|||||..
T Consensus        25 ~~Ge~~~i~G~nGsGKSTLl~   45 (218)
T cd03290          25 PTGQLTMIVGQVGCGKSSLLL   45 (218)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            568899999999999999654


No 259
>PF01926 MMR_HSR1:  50S ribosome-binding GTPase;  InterPro: IPR002917 Human HSR1, has been localized to the human MHC class I region and is highly homologous to a putative GTP-binding protein, MMR1 from mouse. These proteins represent a new subfamily of GTP-binding proteins that has both prokaryote and eukaryote members [].; GO: 0005525 GTP binding, 0005622 intracellular; PDB: 2DWQ_B 2DBY_A 3CNN_A 3CNO_A 3CNL_A 3IBY_A 1PUI_B 1WXQ_A 1LNZ_A 3GEE_A ....
Probab=87.14  E-value=0.29  Score=42.72  Aligned_cols=16  Identities=31%  Similarity=0.472  Sum_probs=14.4

Q ss_pred             EEEEecCCCCcccccc
Q 008523          337 ALFFGLSGTGKTTLST  352 (563)
Q Consensus       337 alfFGLSGTGKTTLsa  352 (563)
                      ++|+|.+|+|||||-.
T Consensus         2 V~iiG~~~~GKSTlin   17 (116)
T PF01926_consen    2 VAIIGRPNVGKSTLIN   17 (116)
T ss_dssp             EEEEESTTSSHHHHHH
T ss_pred             EEEECCCCCCHHHHHH
Confidence            7899999999999765


No 260
>cd04164 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein found in bacteria and eukaryotes.  It controls modification of the uridine at the wobble position (U34) of tRNAs that read codons ending with A or G in the mixed codon family boxes.  TrmE contains a GTPase domain that forms a canonical Ras-like fold.  It functions a molecular switch GTPase, and apparently uses a conformational change associated with GTP hydrolysis to promote the tRNA modification reaction, in which the conserved cysteine in the C-terminal domain is thought to function as a catalytic residue.  In bacteria that are able to survive in extremely low pH conditions, TrmE regulates glutamate-dependent acid resistance.
Probab=87.07  E-value=0.31  Score=43.29  Aligned_cols=19  Identities=26%  Similarity=0.433  Sum_probs=16.5

Q ss_pred             CCEEEEEecCCCCcccccc
Q 008523          334 GDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       334 G~valfFGLSGTGKTTLsa  352 (563)
                      |-.++++|++|+|||||..
T Consensus         1 ~~~i~l~G~~~~GKstli~   19 (157)
T cd04164           1 GIKVVIVGKPNVGKSSLLN   19 (157)
T ss_pred             CcEEEEECCCCCCHHHHHH
Confidence            4578999999999999765


No 261
>PRK09544 znuC high-affinity zinc transporter ATPase; Reviewed
Probab=87.06  E-value=0.32  Score=49.19  Aligned_cols=21  Identities=38%  Similarity=0.686  Sum_probs=18.9

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|..+++.|++|+|||||..
T Consensus        28 ~~Ge~~~I~G~NGsGKSTLl~   48 (251)
T PRK09544         28 KPGKILTLLGPNGAGKSTLVR   48 (251)
T ss_pred             cCCcEEEEECCCCCCHHHHHH
Confidence            578999999999999999765


No 262
>TIGR03258 PhnT 2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT. This ATP-binding component of an ABC transport system is found in Salmonella and Burkholderia lineages in the vicinity of enzymes for the breakdown of 2-aminoethylphosphonate.
Probab=87.06  E-value=0.31  Score=52.31  Aligned_cols=21  Identities=43%  Similarity=0.665  Sum_probs=18.6

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|..++++|+||||||||..
T Consensus        29 ~~Ge~~~llGpsGsGKSTLLr   49 (362)
T TIGR03258        29 EAGELLALIGKSGCGKTTLLR   49 (362)
T ss_pred             CCCCEEEEECCCCCCHHHHHH
Confidence            568899999999999999654


No 263
>PRK14253 phosphate ABC transporter ATP-binding protein; Provisional
Probab=87.04  E-value=0.32  Score=48.43  Aligned_cols=21  Identities=38%  Similarity=0.523  Sum_probs=18.8

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|.++++.|++|+|||||..
T Consensus        27 ~~Ge~~~i~G~nGsGKSTLl~   47 (249)
T PRK14253         27 PARQVTALIGPSGCGKSTLLR   47 (249)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            568999999999999999764


No 264
>PRK14270 phosphate ABC transporter ATP-binding protein; Provisional
Probab=87.03  E-value=0.32  Score=48.56  Aligned_cols=21  Identities=29%  Similarity=0.526  Sum_probs=18.9

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|+.+++.|.+|+|||||..
T Consensus        28 ~~Ge~~~i~G~nGsGKSTLl~   48 (251)
T PRK14270         28 YENKITALIGPSGCGKSTFLR   48 (251)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            578999999999999999765


No 265
>PRK14238 phosphate transporter ATP-binding protein; Provisional
Probab=87.03  E-value=0.32  Score=49.52  Aligned_cols=21  Identities=33%  Similarity=0.571  Sum_probs=18.7

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|..+++.|+||+|||||..
T Consensus        48 ~~Ge~~~I~G~nGsGKSTLl~   68 (271)
T PRK14238         48 HENEVTAIIGPSGCGKSTYIK   68 (271)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            468999999999999999765


No 266
>PRK14245 phosphate ABC transporter ATP-binding protein; Provisional
Probab=87.02  E-value=0.31  Score=48.62  Aligned_cols=21  Identities=38%  Similarity=0.631  Sum_probs=18.7

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|..+++.|+||+|||||..
T Consensus        27 ~~Ge~~~i~G~nGsGKSTLl~   47 (250)
T PRK14245         27 EEKSVVAFIGPSGCGKSTFLR   47 (250)
T ss_pred             eCCCEEEEECCCCCCHHHHHH
Confidence            568999999999999999754


No 267
>cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide-binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=87.02  E-value=0.33  Score=44.90  Aligned_cols=21  Identities=38%  Similarity=0.716  Sum_probs=18.7

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|+..++.|.+|+|||||..
T Consensus        23 ~~g~~~~i~G~nGsGKStll~   43 (157)
T cd00267          23 KAGEIVALVGPNGSGKSTLLR   43 (157)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            578999999999999999754


No 268
>PRK11614 livF leucine/isoleucine/valine transporter ATP-binding subunit; Provisional
Probab=87.00  E-value=0.31  Score=48.14  Aligned_cols=21  Identities=38%  Similarity=0.714  Sum_probs=18.8

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|..+++.|+||+|||||..
T Consensus        29 ~~Ge~~~i~G~nGsGKSTLl~   49 (237)
T PRK11614         29 NQGEIVTLIGANGAGKTTLLG   49 (237)
T ss_pred             cCCcEEEEECCCCCCHHHHHH
Confidence            568999999999999999765


No 269
>PRK14237 phosphate transporter ATP-binding protein; Provisional
Probab=86.99  E-value=0.32  Score=49.32  Aligned_cols=21  Identities=29%  Similarity=0.544  Sum_probs=18.8

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|+.+++.|+||+|||||..
T Consensus        44 ~~Ge~~~I~G~nGsGKSTLl~   64 (267)
T PRK14237         44 EKNKITALIGPSGSGKSTYLR   64 (267)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            568999999999999999765


No 270
>PRK10418 nikD nickel transporter ATP-binding protein NikD; Provisional
Probab=86.97  E-value=0.33  Score=48.77  Aligned_cols=21  Identities=33%  Similarity=0.517  Sum_probs=18.8

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|+.+++.|+||+|||||..
T Consensus        27 ~~Ge~~~l~G~nGsGKSTLl~   47 (254)
T PRK10418         27 QRGRVLALVGGSGSGKSLTCA   47 (254)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            568899999999999999765


No 271
>cd03294 ABC_Pro_Gly_Bertaine This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea.  This transport system belong to the larger ATP-Binding Cassette (ABC) transporter superfamily.  The characteristic feature of these transporters is the obligatory coupling of ATP hydrolysis to substrate translocation.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=86.97  E-value=0.32  Score=49.43  Aligned_cols=21  Identities=43%  Similarity=0.893  Sum_probs=19.0

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|..+++.|+||+|||||..
T Consensus        48 ~~Ge~~~l~G~nGsGKSTLl~   68 (269)
T cd03294          48 REGEIFVIMGLSGSGKSTLLR   68 (269)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            678999999999999999765


No 272
>PRK11545 gntK gluconate kinase 1; Provisional
Probab=86.97  E-value=0.16  Score=48.04  Aligned_cols=13  Identities=38%  Similarity=0.938  Sum_probs=11.6

Q ss_pred             EecCCCCcccccc
Q 008523          340 FGLSGTGKTTLST  352 (563)
Q Consensus       340 FGLSGTGKTTLsa  352 (563)
                      +|+||||||||+.
T Consensus         1 ~G~sGsGKSTla~   13 (163)
T PRK11545          1 MGVSGSGKSAVAS   13 (163)
T ss_pred             CCCCCCcHHHHHH
Confidence            5999999999876


No 273
>cd00071 GMPK Guanosine monophosphate kinase (GMPK, EC 2.7.4.8), also known as guanylate kinase (GKase), catalyzes the reversible phosphoryl transfer from adenosine triphosphate (ATP) to guanosine monophosphate (GMP) to yield adenosine diphosphate (ADP) and guanosine diphosphate (GDP). It plays an essential role in the biosynthesis of guanosine triphosphate (GTP). This enzyme is also important for the activation of some antiviral and anticancer agents, such as acyclovir, ganciclovir, carbovir, and thiopurines.
Probab=86.95  E-value=0.25  Score=45.49  Aligned_cols=16  Identities=44%  Similarity=0.607  Sum_probs=14.2

Q ss_pred             EEEEecCCCCcccccc
Q 008523          337 ALFFGLSGTGKTTLST  352 (563)
Q Consensus       337 alfFGLSGTGKTTLsa  352 (563)
                      +++.|+||+|||||..
T Consensus         2 i~i~GpsGsGKstl~~   17 (137)
T cd00071           2 IVLSGPSGVGKSTLLK   17 (137)
T ss_pred             EEEECCCCCCHHHHHH
Confidence            6789999999999765


No 274
>PRK10253 iron-enterobactin transporter ATP-binding protein; Provisional
Probab=86.94  E-value=0.33  Score=49.14  Aligned_cols=21  Identities=38%  Similarity=0.626  Sum_probs=18.7

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|..+++.|+||+|||||..
T Consensus        31 ~~Ge~~~i~G~nGsGKSTLl~   51 (265)
T PRK10253         31 PDGHFTAIIGPNGCGKSTLLR   51 (265)
T ss_pred             CCCCEEEEECCCCCCHHHHHH
Confidence            468999999999999999765


No 275
>TIGR02142 modC_ABC molybdenum ABC transporter, ATP-binding protein. This model represents the ATP-binding cassette (ABC) protein of the three subunit molybdate ABC transporter. The three proteins of this complex are homologous to proteins of the sulfate ABC transporter. Molybdenum may be used in nitrogenases of nitrogen-fixing bacteria and in molybdopterin cofactors. In some cases, molybdate may be transported by a sulfate transporter rather than by a specific molybdate transporter.
Probab=86.94  E-value=0.32  Score=51.72  Aligned_cols=21  Identities=48%  Similarity=0.650  Sum_probs=18.8

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|..+++.|+||+|||||..
T Consensus        21 ~~Gei~~l~G~nGsGKSTLl~   41 (354)
T TIGR02142        21 PGQGVTAIFGRSGSGKTTLIR   41 (354)
T ss_pred             CCCCEEEEECCCCCCHHHHHH
Confidence            568899999999999999765


No 276
>PF07724 AAA_2:  AAA domain (Cdc48 subfamily);  InterPro: IPR013093 ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids []. The highly conserved nature of this module across taxa suggests that it has a key cellular role. Members of the family are involved in diverse cellular functions including gene expression, peroxisome assembly and vesicle mediated transport. Although the role of ATPase AAA-2 domain is not, as yet, clear, the AAA+ superfamily of proteins to which the AAA ATPases belong has a chaperone-like function in the assembly, operation or disassembly of proteins []. Some of these ATPases function as a chaperone subunit of a proteasome-like degradation complex. This ATPase family includes some proteins not detected by IPR003959 from INTERPRO.; GO: 0005524 ATP binding; PDB: 1R6B_X 1KSF_X 3PXI_C 1KYI_T 1G3I_S 1OFH_B 1OFI_A 1G41_A 1IM2_A 1HQY_E ....
Probab=86.94  E-value=0.27  Score=47.33  Aligned_cols=17  Identities=47%  Similarity=0.583  Sum_probs=15.2

Q ss_pred             EEEEEecCCCCcccccc
Q 008523          336 VALFFGLSGTGKTTLST  352 (563)
Q Consensus       336 valfFGLSGTGKTTLsa  352 (563)
                      +++|.|+||+|||+|+.
T Consensus         5 ~~ll~GpsGvGKT~la~   21 (171)
T PF07724_consen    5 NFLLAGPSGVGKTELAK   21 (171)
T ss_dssp             EEEEESSTTSSHHHHHH
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            68999999999998765


No 277
>PRK14531 adenylate kinase; Provisional
Probab=86.91  E-value=0.26  Score=47.24  Aligned_cols=17  Identities=41%  Similarity=0.647  Sum_probs=15.5

Q ss_pred             EEEEEecCCCCcccccc
Q 008523          336 VALFFGLSGTGKTTLST  352 (563)
Q Consensus       336 valfFGLSGTGKTTLsa  352 (563)
                      .++++|++||||||++.
T Consensus         4 ~i~i~G~pGsGKsT~~~   20 (183)
T PRK14531          4 RLLFLGPPGAGKGTQAA   20 (183)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            58999999999999876


No 278
>PF07728 AAA_5:  AAA domain (dynein-related subfamily);  InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids []. The highly conserved nature of this module across taxa suggests that it has a key cellular role. Members of the family are involved in diverse cellular functions including gene expression, peroxisome assembly and vesicle mediated transport. Although the role of this ATPase AAA domain is not, as yet, clear, the AAA+ superfamily of proteins to which the AAA ATPases belong has a chaperone-like function in the assembly, operation or disassembly of proteins []. This ATPase domain includes some proteins not detected by the IPR003959 from INTERPRO model.; GO: 0005524 ATP binding, 0016887 ATPase activity; PDB: 3NBX_X 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A.
Probab=86.90  E-value=0.28  Score=44.20  Aligned_cols=16  Identities=56%  Similarity=0.827  Sum_probs=14.5

Q ss_pred             EEEEecCCCCcccccc
Q 008523          337 ALFFGLSGTGKTTLST  352 (563)
Q Consensus       337 alfFGLSGTGKTTLsa  352 (563)
                      +++.|++|||||+|..
T Consensus         2 vlL~G~~G~GKt~l~~   17 (139)
T PF07728_consen    2 VLLVGPPGTGKTTLAR   17 (139)
T ss_dssp             EEEEESSSSSHHHHHH
T ss_pred             EEEECCCCCCHHHHHH
Confidence            6899999999999775


No 279
>PRK13647 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=86.87  E-value=0.32  Score=49.63  Aligned_cols=21  Identities=33%  Similarity=0.599  Sum_probs=18.8

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|..+++.|.||+|||||..
T Consensus        29 ~~Ge~~~i~G~nGsGKSTLl~   49 (274)
T PRK13647         29 PEGSKTALLGPNGAGKSTLLL   49 (274)
T ss_pred             cCCCEEEEECCCCCcHHHHHH
Confidence            568999999999999999765


No 280
>TIGR00968 3a0106s01 sulfate ABC transporter, ATP-binding protein.
Probab=86.84  E-value=0.34  Score=48.18  Aligned_cols=21  Identities=38%  Similarity=0.656  Sum_probs=18.7

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|.++++.|+||+|||||..
T Consensus        24 ~~Ge~~~l~G~nGsGKSTLl~   44 (237)
T TIGR00968        24 PTGSLVALLGPSGSGKSTLLR   44 (237)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            578999999999999999754


No 281
>PRK14272 phosphate ABC transporter ATP-binding protein; Provisional
Probab=86.83  E-value=0.34  Score=48.29  Aligned_cols=21  Identities=43%  Similarity=0.632  Sum_probs=18.7

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|+.+++.|.||+|||||..
T Consensus        28 ~~Ge~~~i~G~nGsGKSTLl~   48 (252)
T PRK14272         28 QRGTVNALIGPSGCGKTTFLR   48 (252)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            568899999999999999765


No 282
>PRK11231 fecE iron-dicitrate transporter ATP-binding subunit; Provisional
Probab=86.78  E-value=0.34  Score=48.64  Aligned_cols=21  Identities=33%  Similarity=0.621  Sum_probs=18.9

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|+.+++.|.+|+|||||..
T Consensus        26 ~~Ge~~~l~G~nGsGKSTLl~   46 (255)
T PRK11231         26 PTGKITALIGPNGCGKSTLLK   46 (255)
T ss_pred             cCCcEEEEECCCCCCHHHHHH
Confidence            568999999999999999765


No 283
>PRK09580 sufC cysteine desulfurase ATPase component; Reviewed
Probab=86.75  E-value=0.34  Score=48.08  Aligned_cols=21  Identities=43%  Similarity=0.781  Sum_probs=18.9

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      +.|..+++.|.+|+|||||..
T Consensus        25 ~~Ge~~~i~G~nGsGKSTLl~   45 (248)
T PRK09580         25 RPGEVHAIMGPNGSGKSTLSA   45 (248)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            578999999999999999765


No 284
>PRK10419 nikE nickel transporter ATP-binding protein NikE; Provisional
Probab=86.74  E-value=0.34  Score=49.24  Aligned_cols=21  Identities=43%  Similarity=0.751  Sum_probs=18.9

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|..+++.|+||+|||||..
T Consensus        36 ~~Ge~~~i~G~nGsGKSTLl~   56 (268)
T PRK10419         36 KSGETVALLGRSGCGKSTLAR   56 (268)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            568999999999999999765


No 285
>PRK14244 phosphate ABC transporter ATP-binding protein; Provisional
Probab=86.72  E-value=0.34  Score=48.36  Aligned_cols=21  Identities=38%  Similarity=0.588  Sum_probs=18.7

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|..+++.|.||+|||||..
T Consensus        29 ~~Ge~~~I~G~nGsGKSTLl~   49 (251)
T PRK14244         29 YKREVTAFIGPSGCGKSTFLR   49 (251)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            468899999999999999765


No 286
>TIGR01188 drrA daunorubicin resistance ABC transporter ATP-binding subunit. This model describes daunorubicin resistance ABC transporter, ATP binding subunit in bacteria and archaea. This model is restricted in its scope to preferentially recognize the ATP binding subunit associated with effux of the drug, daunorubicin. This transport system belong to the larger ATP-Binding Cassette (ABC) transporter superfamily. The characteristic feature of these transporter is the obligatory coupling of ATP hydrolysis to substrate translocation. The minimal configuration of bacterial ABC transport system: an ATPase or ATP binding subunit; An integral membrane protein; a hydrophilic polypetpide, which likely functions as substrate binding protein. In eukaryotes proteins of similar function include p-gyco proteins, multidrug resistance protein etc.
Probab=86.71  E-value=0.34  Score=50.20  Aligned_cols=21  Identities=43%  Similarity=0.703  Sum_probs=18.8

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|..+++.|++|+|||||..
T Consensus        17 ~~Ge~~~l~G~NGaGKSTLl~   37 (302)
T TIGR01188        17 REGEVFGFLGPNGAGKTTTIR   37 (302)
T ss_pred             cCCcEEEEECCCCCCHHHHHH
Confidence            578999999999999999764


No 287
>PRK14268 phosphate ABC transporter ATP-binding protein; Provisional
Probab=86.71  E-value=0.34  Score=48.73  Aligned_cols=21  Identities=33%  Similarity=0.525  Sum_probs=18.7

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|..+++.|.||+|||||..
T Consensus        36 ~~Ge~~~i~G~nGsGKSTLl~   56 (258)
T PRK14268         36 PKNSVTALIGPSGCGKSTFIR   56 (258)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            468899999999999999765


No 288
>PRK14249 phosphate ABC transporter ATP-binding protein; Provisional
Probab=86.69  E-value=0.35  Score=48.34  Aligned_cols=21  Identities=33%  Similarity=0.550  Sum_probs=18.8

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|..+++.|+||+|||||..
T Consensus        28 ~~G~~~~i~G~nGsGKSTLl~   48 (251)
T PRK14249         28 PERQITAIIGPSGCGKSTLLR   48 (251)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            568999999999999999765


No 289
>PRK14235 phosphate transporter ATP-binding protein; Provisional
Probab=86.69  E-value=0.34  Score=49.11  Aligned_cols=21  Identities=38%  Similarity=0.602  Sum_probs=18.8

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|..+++.|+||+|||||..
T Consensus        43 ~~Ge~~~i~G~nGsGKSTLl~   63 (267)
T PRK14235         43 PEKTVTAFIGPSGCGKSTFLR   63 (267)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            568999999999999999765


No 290
>cd03300 ABC_PotA_N PotA is an ABC-type transporter and the ATPase component of the spermidine/putrescine-preferential uptake system consisting of PotA, -B, -C, and -D.  PotA has two domains with the N-terminal domain containing the ATPase activity and the residues required for homodimerization with PotA and heterdimerization with PotB.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=86.68  E-value=0.35  Score=47.81  Aligned_cols=21  Identities=48%  Similarity=0.711  Sum_probs=18.7

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|..+++.|.||+|||||..
T Consensus        24 ~~Ge~~~i~G~nGsGKSTLl~   44 (232)
T cd03300          24 KEGEFFTLLGPSGCGKTTLLR   44 (232)
T ss_pred             CCCCEEEEECCCCCCHHHHHH
Confidence            568999999999999999764


No 291
>PRK14251 phosphate ABC transporter ATP-binding protein; Provisional
Probab=86.63  E-value=0.35  Score=48.23  Aligned_cols=21  Identities=29%  Similarity=0.569  Sum_probs=18.6

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|..+++.|.||+|||||..
T Consensus        28 ~~Ge~~~i~G~nGsGKSTLl~   48 (251)
T PRK14251         28 EEKELTALIGPSGCGKSTFLR   48 (251)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            568899999999999999764


No 292
>COG1127 Ttg2A ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism]
Probab=86.58  E-value=0.43  Score=49.24  Aligned_cols=21  Identities=38%  Similarity=0.637  Sum_probs=18.9

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      +.|.+..|.|.||||||||..
T Consensus        32 ~~Gei~~iiGgSGsGKStlLr   52 (263)
T COG1127          32 PRGEILAILGGSGSGKSTLLR   52 (263)
T ss_pred             cCCcEEEEECCCCcCHHHHHH
Confidence            568999999999999999765


No 293
>PRK14269 phosphate ABC transporter ATP-binding protein; Provisional
Probab=86.55  E-value=0.35  Score=48.21  Aligned_cols=21  Identities=29%  Similarity=0.567  Sum_probs=18.8

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|..+++.|+||+|||||..
T Consensus        26 ~~Ge~~~i~G~nGsGKSTLl~   46 (246)
T PRK14269         26 EQNKITALIGASGCGKSTFLR   46 (246)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            568999999999999999765


No 294
>cd03213 ABCG_EPDR ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR).  DR is a well-described phenomenon occurring in fungi and shares several similarities with processes in bacteria and higher eukaryotes.  Compared to other members of the ABC transporter subfamilies, the ABCG transporter family is composed of proteins that have an ATP-binding cassette domain at the N-terminus and a TM (transmembrane) domain at the C-terminus.
Probab=86.54  E-value=0.36  Score=46.66  Aligned_cols=21  Identities=43%  Similarity=0.722  Sum_probs=18.7

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|+.+++.|++|+|||||..
T Consensus        33 ~~Ge~~~l~G~nGsGKStLl~   53 (194)
T cd03213          33 KPGELTAIMGPSGAGKSTLLN   53 (194)
T ss_pred             cCCcEEEEECCCCCCHHHHHH
Confidence            568899999999999999764


No 295
>PRK11022 dppD dipeptide transporter ATP-binding subunit; Provisional
Probab=86.54  E-value=0.34  Score=51.09  Aligned_cols=21  Identities=43%  Similarity=0.601  Sum_probs=18.9

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|.++.+.|.||+|||||..
T Consensus        31 ~~Ge~~~lvG~sGsGKSTL~~   51 (326)
T PRK11022         31 KQGEVVGIVGESGSGKSVSSL   51 (326)
T ss_pred             CCCCEEEEECCCCChHHHHHH
Confidence            678999999999999999754


No 296
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA.
Probab=86.47  E-value=0.6  Score=54.49  Aligned_cols=17  Identities=47%  Similarity=0.692  Sum_probs=15.1

Q ss_pred             EEEEEecCCCCcccccc
Q 008523          336 VALFFGLSGTGKTTLST  352 (563)
Q Consensus       336 valfFGLSGTGKTTLsa  352 (563)
                      +.+|.|++|||||+|+.
T Consensus       486 ~~lf~Gp~GvGKT~lA~  502 (731)
T TIGR02639       486 SFLFTGPTGVGKTELAK  502 (731)
T ss_pred             eEEEECCCCccHHHHHH
Confidence            57999999999999775


No 297
>PRK08533 flagellar accessory protein FlaH; Reviewed
Probab=86.47  E-value=0.35  Score=48.52  Aligned_cols=21  Identities=38%  Similarity=0.491  Sum_probs=18.5

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      +.|..+++.|++|||||||+.
T Consensus        22 ~~g~~~~i~G~~G~GKTtl~~   42 (230)
T PRK08533         22 PAGSLILIEGDESTGKSILSQ   42 (230)
T ss_pred             CCCcEEEEECCCCCCHHHHHH
Confidence            457799999999999999964


No 298
>PRK14243 phosphate transporter ATP-binding protein; Provisional
Probab=86.44  E-value=0.36  Score=48.88  Aligned_cols=21  Identities=33%  Similarity=0.613  Sum_probs=18.9

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|..+++.|+||+|||||..
T Consensus        34 ~~Ge~~~i~G~nGsGKSTLl~   54 (264)
T PRK14243         34 PKNQITAFIGPSGCGKSTILR   54 (264)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            578999999999999999765


No 299
>cd03253 ABCC_ATM1_transporter ATM1 is an ABC transporter that is expressed in the mitochondria.  Although the specific function of ATM1 is unknown, its disruption results in the accumulation of excess mitochondrial iron, loss of mitochondrial cytochromes, oxidative damage to mitochondrial DNA, and decreased levels of cytosolic heme proteins.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=86.42  E-value=0.37  Score=47.46  Aligned_cols=21  Identities=33%  Similarity=0.531  Sum_probs=18.8

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|..+++.|++|+|||||..
T Consensus        25 ~~Ge~~~l~G~nGsGKSTLl~   45 (236)
T cd03253          25 PAGKKVAIVGPSGSGKSTILR   45 (236)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            568999999999999999765


No 300
>TIGR01288 nodI ATP-binding ABC transporter family nodulation protein NodI. This model does not recognize the highly divergent NodI from Azorhizobium caulinodans.
Probab=86.37  E-value=0.36  Score=50.03  Aligned_cols=21  Identities=29%  Similarity=0.569  Sum_probs=18.7

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|..+++.|++|+|||||..
T Consensus        28 ~~Ge~~~l~G~NGaGKSTLl~   48 (303)
T TIGR01288        28 ARGECFGLLGPNGAGKSTIAR   48 (303)
T ss_pred             cCCcEEEEECCCCCCHHHHHH
Confidence            568999999999999999754


No 301
>cd03217 ABC_FeS_Assembly ABC-type transport system involved in Fe-S cluster assembly, ATPase component.  Biosynthesis of iron-sulfur clusters (Fe-S) depends on multiprotein systems.  The SUF system of E. coli and Erwinia chrysanthemi is important for Fe-S biogenesis under stressful conditions.  The SUF system is made of six proteins: SufC is an atypical cytoplasmic ABC-ATPase, which forms a complex with SufB and SufD; SufA plays the role of a scaffold protein for assembly of iron-sulfur clusters and delivery to target proteins; SufS is a cysteine desulfurase which mobilizes the sulfur atom from cysteine and provides it to the cluster; SufE has no associated function yet.
Probab=86.34  E-value=0.38  Score=46.65  Aligned_cols=21  Identities=43%  Similarity=0.798  Sum_probs=18.6

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|+.+++.|.||+|||||..
T Consensus        24 ~~Ge~~~i~G~nGsGKStLl~   44 (200)
T cd03217          24 KKGEVHALMGPNGSGKSTLAK   44 (200)
T ss_pred             CCCcEEEEECCCCCCHHHHHH
Confidence            568999999999999999754


No 302
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional
Probab=86.24  E-value=0.32  Score=52.73  Aligned_cols=21  Identities=38%  Similarity=0.621  Sum_probs=18.4

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|.+++|.|++|+||||+.+
T Consensus       135 ~~g~ii~lvGptGvGKTTtia  155 (374)
T PRK14722        135 ERGGVFALMGPTGVGKTTTTA  155 (374)
T ss_pred             cCCcEEEEECCCCCCHHHHHH
Confidence            457799999999999999776


No 303
>PRK11153 metN DL-methionine transporter ATP-binding subunit; Provisional
Probab=86.23  E-value=0.36  Score=51.17  Aligned_cols=21  Identities=38%  Similarity=0.580  Sum_probs=18.9

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      +.|..+++.|+||+|||||..
T Consensus        29 ~~Gei~~iiG~nGsGKSTLlk   49 (343)
T PRK11153         29 PAGEIFGVIGASGAGKSTLIR   49 (343)
T ss_pred             cCCCEEEEECCCCCcHHHHHH
Confidence            678999999999999999765


No 304
>PRK13646 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=86.22  E-value=0.37  Score=49.56  Aligned_cols=21  Identities=33%  Similarity=0.578  Sum_probs=18.8

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|..+++.|+||+|||||..
T Consensus        31 ~~Ge~~~i~G~nGsGKSTLl~   51 (286)
T PRK13646         31 EQGKYYAIVGQTGSGKSTLIQ   51 (286)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            578999999999999999764


No 305
>PF10662 PduV-EutP:  Ethanolamine utilisation - propanediol utilisation;  InterPro: IPR012381 Members of this family function in ethanolamine [] and propanediol [] degradation pathways. Both pathways require coenzyme B12 (adenosylcobalamin, AdoCbl). Bacteria that harbour these pathways can use ethanolamine as a source of carbon and nitrogen, or propanediol as a sole carbon and energy source, respectively. The exact roles of the EutP and PduV proteins in these respective pathways are not yet determined. Members of this family contain P-loop consensus motifs in the N-terminal part, and are distantly related to various GTPases and ATPases, including ATPase components of transport systems. Propanediol degradation is thought to be important for the natural Salmonella populations, since propanediol is produced by the fermentation of the common plant sugars rhamnose and fucose [, ]. More than 1% of the Salmonella enterica genome is devoted to the utilisation of propanediol and cobalamin biosynthesis. In vivo expression technology has indicated that propanediol utilisation (pdu) genes may be important for growth in host tissues, and competitive index studies with mice have shown that pdu mutations confer a virulence defect [, ]. The pdu operon is contiguous and co-regulated with the cobalamin (B12) biosynthesis cob operon, indicating that propanediol catabolism may be the primary reason for de novo B12 synthesis in Salmonella [, , ]. Please see IPR003207 from INTERPRO, IPR003208 from INTERPRO, IPR009204 from INTERPRO, IPR009191 from INTERPRO, IPR009192 from INTERPRO for more details on the propanediol utilisation pathway and the pdu operon.; GO: 0005524 ATP binding, 0006576 cellular biogenic amine metabolic process
Probab=86.20  E-value=0.32  Score=46.17  Aligned_cols=18  Identities=44%  Similarity=0.704  Sum_probs=16.0

Q ss_pred             CEEEEEecCCCCcccccc
Q 008523          335 DVALFFGLSGTGKTTLST  352 (563)
Q Consensus       335 ~valfFGLSGTGKTTLsa  352 (563)
                      +.++|.|.+|||||||..
T Consensus         2 krimliG~~g~GKTTL~q   19 (143)
T PF10662_consen    2 KRIMLIGPSGSGKTTLAQ   19 (143)
T ss_pred             ceEEEECCCCCCHHHHHH
Confidence            358999999999999976


No 306
>PRK14260 phosphate ABC transporter ATP-binding protein; Provisional
Probab=86.16  E-value=0.38  Score=48.47  Aligned_cols=21  Identities=33%  Similarity=0.477  Sum_probs=18.8

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|+.+++.|.||+|||||..
T Consensus        31 ~~Ge~~~l~G~nGsGKSTLlk   51 (259)
T PRK14260         31 YRNKVTAIIGPSGCGKSTFIK   51 (259)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            568999999999999999765


No 307
>PRK13634 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=86.12  E-value=0.37  Score=49.70  Aligned_cols=21  Identities=33%  Similarity=0.585  Sum_probs=19.0

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|..+++.|.||+|||||..
T Consensus        31 ~~Ge~~~i~G~nGsGKSTLl~   51 (290)
T PRK13634         31 PSGSYVAIIGHTGSGKSTLLQ   51 (290)
T ss_pred             cCCCEEEEECCCCCcHHHHHH
Confidence            678999999999999999765


No 308
>PRK14266 phosphate ABC transporter ATP-binding protein; Provisional
Probab=86.11  E-value=0.39  Score=47.88  Aligned_cols=21  Identities=33%  Similarity=0.525  Sum_probs=18.8

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|..+++.|++|+|||||..
T Consensus        27 ~~Ge~~~i~G~nGsGKSTLl~   47 (250)
T PRK14266         27 PKNSVTALIGPSGCGKSTFIR   47 (250)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            578999999999999999764


No 309
>smart00072 GuKc Guanylate kinase homologues. Active enzymes catalyze ATP-dependent phosphorylation of GMP to GDP. Structure resembles that of adenylate kinase. So-called membrane-associated guanylate kinase homologues (MAGUKs) do not possess guanylate kinase activities; instead at least some possess protein-binding functions.
Probab=86.10  E-value=0.36  Score=46.29  Aligned_cols=19  Identities=37%  Similarity=0.420  Sum_probs=17.1

Q ss_pred             CCEEEEEecCCCCcccccc
Q 008523          334 GDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       334 G~valfFGLSGTGKTTLsa  352 (563)
                      ++.+++.|+||+||+||..
T Consensus         2 ~r~ivl~Gpsg~GK~tl~~   20 (184)
T smart00072        2 RRPIVLSGPSGVGKGTLLA   20 (184)
T ss_pred             CcEEEEECCCCCCHHHHHH
Confidence            5789999999999999876


No 310
>PRK14252 phosphate ABC transporter ATP-binding protein; Provisional
Probab=86.08  E-value=0.39  Score=48.56  Aligned_cols=21  Identities=33%  Similarity=0.556  Sum_probs=18.8

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|..+++.|.||+|||||..
T Consensus        40 ~~Ge~~~i~G~nGsGKSTLl~   60 (265)
T PRK14252         40 HEKQVTALIGPSGCGKSTFLR   60 (265)
T ss_pred             cCCcEEEEECCCCCCHHHHHH
Confidence            568899999999999999765


No 311
>cd02028 UMPK_like Uridine monophosphate kinase_like (UMPK_like) is a family of proteins highly similar to the uridine monophosphate kinase (UMPK, EC 2.7.1.48), also known as uridine kinase or uridine-cytidine kinase (UCK).
Probab=86.08  E-value=0.28  Score=47.28  Aligned_cols=17  Identities=47%  Similarity=0.597  Sum_probs=15.1

Q ss_pred             EEEEEecCCCCcccccc
Q 008523          336 VALFFGLSGTGKTTLST  352 (563)
Q Consensus       336 valfFGLSGTGKTTLsa  352 (563)
                      ++++.|.||||||||+.
T Consensus         1 ii~i~G~sgsGKttla~   17 (179)
T cd02028           1 VVGIAGPSGSGKTTFAK   17 (179)
T ss_pred             CEEEECCCCCCHHHHHH
Confidence            36889999999999887


No 312
>PRK11308 dppF dipeptide transporter ATP-binding subunit; Provisional
Probab=86.08  E-value=0.38  Score=50.79  Aligned_cols=21  Identities=38%  Similarity=0.582  Sum_probs=19.0

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|..+++.|.||+|||||..
T Consensus        39 ~~Ge~~~IvG~sGsGKSTLl~   59 (327)
T PRK11308         39 ERGKTLAVVGESGCGKSTLAR   59 (327)
T ss_pred             CCCCEEEEECCCCCcHHHHHH
Confidence            678999999999999999765


No 313
>PRK13651 cobalt transporter ATP-binding subunit; Provisional
Probab=86.04  E-value=0.37  Score=50.34  Aligned_cols=21  Identities=33%  Similarity=0.645  Sum_probs=18.9

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|..+++.|.||+|||||..
T Consensus        31 ~~Ge~v~iiG~nGsGKSTLl~   51 (305)
T PRK13651         31 NQGEFIAIIGQTGSGKTTFIE   51 (305)
T ss_pred             eCCCEEEEECCCCCcHHHHHH
Confidence            568999999999999999765


No 314
>PRK09473 oppD oligopeptide transporter ATP-binding component; Provisional
Probab=86.03  E-value=0.35  Score=51.08  Aligned_cols=21  Identities=29%  Similarity=0.480  Sum_probs=18.9

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|.++++.|.||+|||||..
T Consensus        40 ~~Ge~~~ivG~sGsGKSTL~~   60 (330)
T PRK09473         40 RAGETLGIVGESGSGKSQTAF   60 (330)
T ss_pred             cCCCEEEEECCCCchHHHHHH
Confidence            568999999999999999765


No 315
>TIGR03873 F420-0_ABC_ATP proposed F420-0 ABC transporter, ATP-binding protein. This small clade of ABC-type transporter ATP-binding protein components is found as a three gene cassette along with a periplasmic substrate-binding protein (TIGR03868) and a permease (TIGR03869). The organisms containing this cassette are all Actinobacteria and all contain numerous genes requiring the coenzyme F420. This model was defined based on five such organisms, four of which are lacking all F420 biosynthetic capability save the final side-chain polyglutamate attachment step (via the gene cofE: TIGR01916). In Jonesia denitrificans DSM 20603 and marine actinobacterium PHSC20C1 this cassette is in an apparent operon with the cofE gene and, in PHSC20C1, also with a F420-dependent glucose-6-phosphate dehydrogenase (TIGR03554). Based on these observations we propose that this ATP-binding protein is a component of an F420-0 (that is, F420 lacking only the polyglutamate tail) transporter.
Probab=86.01  E-value=0.39  Score=48.20  Aligned_cols=21  Identities=33%  Similarity=0.581  Sum_probs=18.9

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|..+++.|++|+|||||..
T Consensus        25 ~~Ge~~~i~G~nGsGKSTLl~   45 (256)
T TIGR03873        25 PPGSLTGLLGPNGSGKSTLLR   45 (256)
T ss_pred             cCCcEEEEECCCCCCHHHHHH
Confidence            568999999999999999765


No 316
>PRK14265 phosphate ABC transporter ATP-binding protein; Provisional
Probab=86.00  E-value=0.39  Score=49.03  Aligned_cols=21  Identities=38%  Similarity=0.567  Sum_probs=18.8

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|..+++.|.+|+|||||..
T Consensus        44 ~~Ge~~~IiG~nGsGKSTLl~   64 (274)
T PRK14265         44 PAKKIIAFIGPSGCGKSTLLR   64 (274)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            568999999999999999765


No 317
>PRK14275 phosphate ABC transporter ATP-binding protein; Provisional
Probab=85.95  E-value=0.39  Score=49.41  Aligned_cols=21  Identities=33%  Similarity=0.404  Sum_probs=18.8

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|..+++.|+||+|||||..
T Consensus        63 ~~Ge~~~l~G~nGsGKSTLl~   83 (286)
T PRK14275         63 LSKYVTAIIGPSGCGKSTFLR   83 (286)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            568999999999999999764


No 318
>cd01394 radB RadB. The archaeal protein radB shares similarity radA, the archaeal functional homologue to the bacterial RecA. The precise function of radB is unclear.
Probab=85.94  E-value=0.36  Score=47.01  Aligned_cols=21  Identities=38%  Similarity=0.714  Sum_probs=18.6

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|.+++++|.+|+|||||+.
T Consensus        17 ~~g~i~~i~G~~GsGKT~l~~   37 (218)
T cd01394          17 ERGTVTQVYGPPGTGKTNIAI   37 (218)
T ss_pred             cCCeEEEEECCCCCCHHHHHH
Confidence            457899999999999999876


No 319
>COG4618 ArpD ABC-type protease/lipase transport system, ATPase and permease components [General function prediction only]
Probab=85.88  E-value=0.24  Score=55.63  Aligned_cols=68  Identities=22%  Similarity=0.363  Sum_probs=42.6

Q ss_pred             CCCCEEEEEecCCCCcccccc------cCCC-ceeecCceeecCCCccccCCceeEeecCCCCCCCchhhhhccccceee
Q 008523          332 KDGDVALFFGLSGTGKTTLST------DHNR-YLIGDDEHCWGDNGVSNIEGGCYAKCIDLSREKEPDIWNAIKFGAVLE  404 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa------d~~r-~lIgDDe~~w~~~Gvfn~EgGcyaK~~dLs~e~EP~I~~ai~f~ailE  404 (563)
                      .-|....+.|+||+|||||..      .|.+ .+=-|.      .....++.-.+.|-+++-| ++-|+|    .|+|-|
T Consensus       360 ~~G~~lgIIGPSgSGKSTLaR~lvG~w~p~~G~VRLDg------a~l~qWd~e~lG~hiGYLP-QdVeLF----~GTIae  428 (580)
T COG4618         360 QAGEALGIIGPSGSGKSTLARLLVGIWPPTSGSVRLDG------ADLRQWDREQLGRHIGYLP-QDVELF----DGTIAE  428 (580)
T ss_pred             cCCceEEEECCCCccHHHHHHHHHcccccCCCcEEecc------hhhhcCCHHHhccccCcCc-ccceec----CCcHHH
Confidence            568899999999999999875      2211 111111      1133556666778888766 333444    278889


Q ss_pred             ee-EEcC
Q 008523          405 NV-VFDE  410 (563)
Q Consensus       405 NV-~~d~  410 (563)
                      |+ -|++
T Consensus       429 NIaRf~~  435 (580)
T COG4618         429 NIARFGE  435 (580)
T ss_pred             HHHhccc
Confidence            95 4443


No 320
>cd01876 YihA_EngB The YihA (EngB) subfamily.  This subfamily of GTPases is typified by the E. coli YihA, an essential protein involved in cell division control.  YihA and its orthologs are small proteins that typically contain less than 200 amino acid residues and consists of the GTPase domain only (some of the eukaryotic homologs contain an N-terminal extension of about 120 residues that might be involved in organellar targeting).  Homologs of yihA are found in most Gram-positive and Gram-negative pathogenic bacteria, with the exception of Mycobacterium tuberculosis.  The broad-spectrum nature of YihA and its essentiality for cell viability in bacteria make it an attractive antibacterial target.
Probab=85.88  E-value=0.33  Score=43.18  Aligned_cols=16  Identities=38%  Similarity=0.526  Sum_probs=14.4

Q ss_pred             EEEEecCCCCcccccc
Q 008523          337 ALFFGLSGTGKTTLST  352 (563)
Q Consensus       337 alfFGLSGTGKTTLsa  352 (563)
                      ++++|.+|+|||||..
T Consensus         2 i~l~G~~g~GKTtL~~   17 (170)
T cd01876           2 IAFAGRSNVGKSSLIN   17 (170)
T ss_pred             EEEEcCCCCCHHHHHH
Confidence            6899999999999876


No 321
>TIGR02314 ABC_MetN D-methionine ABC transporter, ATP-binding protein. Members of this family are the ATP-binding protein of the D-methionine ABC transporter complex. Known members belong to the Proteobacteria.
Probab=85.87  E-value=0.38  Score=51.30  Aligned_cols=21  Identities=38%  Similarity=0.553  Sum_probs=18.8

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|..+.+.|+||+|||||..
T Consensus        29 ~~Gei~gIiG~sGaGKSTLlr   49 (343)
T TIGR02314        29 PAGQIYGVIGASGAGKSTLIR   49 (343)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            568899999999999999765


No 322
>PRK03695 vitamin B12-transporter ATPase; Provisional
Probab=85.83  E-value=0.41  Score=48.07  Aligned_cols=21  Identities=33%  Similarity=0.675  Sum_probs=18.9

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|..+++.|.+|+|||||..
T Consensus        20 ~~Gei~~l~G~nGsGKSTLl~   40 (248)
T PRK03695         20 RAGEILHLVGPNGAGKSTLLA   40 (248)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            568999999999999999765


No 323
>COG4161 ArtP ABC-type arginine transport system, ATPase component [Amino acid transport and metabolism]
Probab=85.82  E-value=0.43  Score=47.02  Aligned_cols=21  Identities=33%  Similarity=0.702  Sum_probs=19.0

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      +.|++.++.|+||+|||||..
T Consensus        26 ~~getlvllgpsgagkssllr   46 (242)
T COG4161          26 PEGETLVLLGPSGAGKSSLLR   46 (242)
T ss_pred             CCCCEEEEECCCCCchHHHHH
Confidence            679999999999999999764


No 324
>PRK13635 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=85.80  E-value=0.4  Score=49.17  Aligned_cols=21  Identities=33%  Similarity=0.635  Sum_probs=18.8

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|..+++.|.+|+|||||..
T Consensus        31 ~~Ge~~~i~G~nGaGKSTLl~   51 (279)
T PRK13635         31 YEGEWVAIVGHNGSGKSTLAK   51 (279)
T ss_pred             cCCCEEEEECCCCCcHHHHHH
Confidence            568999999999999999765


No 325
>COG4608 AppF ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism]
Probab=85.77  E-value=0.43  Score=49.64  Aligned_cols=21  Identities=43%  Similarity=0.664  Sum_probs=19.1

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      +.|.+..+.|-||||||||..
T Consensus        37 ~~ge~~glVGESG~GKSTlgr   57 (268)
T COG4608          37 KEGETLGLVGESGCGKSTLGR   57 (268)
T ss_pred             cCCCEEEEEecCCCCHHHHHH
Confidence            679999999999999999865


No 326
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases. The homohexamer, VirB11 is one of eleven Vir proteins, which are required for T-pilus biogenesis and virulence in the transfer of T-DNA from the Ti (tumor-inducing) plasmid of bacterial to plant cells. The pilus is a fibrous cell surface organelle, which mediates adhesion between bacteria during conjugative transfer or between bacteria and host eukaryotic cells during infection. VirB11- related ATPases include the archaeal flagella biosynthesis protein and the pilus assembly proteins CpaF/TadA and TrbB.  This alignment contains the C-terminal domain, which is the ATPase.
Probab=85.76  E-value=0.39  Score=46.14  Aligned_cols=21  Identities=38%  Similarity=0.455  Sum_probs=18.1

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      +.|..++|.|++|+|||||..
T Consensus        23 ~~g~~i~I~G~tGSGKTTll~   43 (186)
T cd01130          23 EARKNILISGGTGSGKTTLLN   43 (186)
T ss_pred             hCCCEEEEECCCCCCHHHHHH
Confidence            457899999999999999754


No 327
>PRK15079 oligopeptide ABC transporter ATP-binding protein OppF; Provisional
Probab=85.75  E-value=0.4  Score=50.77  Aligned_cols=21  Identities=33%  Similarity=0.529  Sum_probs=19.0

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|..+++.|.||+|||||..
T Consensus        45 ~~Ge~~~lvG~sGsGKSTLlk   65 (331)
T PRK15079         45 YEGETLGVVGESGCGKSTFAR   65 (331)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            679999999999999999765


No 328
>PRK14236 phosphate transporter ATP-binding protein; Provisional
Probab=85.73  E-value=0.41  Score=48.71  Aligned_cols=21  Identities=43%  Similarity=0.618  Sum_probs=18.9

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|..+++.|+||+|||||..
T Consensus        49 ~~Ge~~~I~G~nGsGKSTLl~   69 (272)
T PRK14236         49 PKNRVTAFIGPSGCGKSTLLR   69 (272)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            578999999999999999765


No 329
>TIGR02982 heterocyst_DevA ABC exporter ATP-binding subunit, DevA family. Members of this protein family are found mostly in the Cyanobacteria, but also in the Planctomycetes. Cyanobacterial examples are involved in heterocyst formation, by which some fraction of members of the colony undergo a developmental change and become capable of nitrogen fixation. The DevBCA proteins are thought export of either heterocyst-specific glycolipids or an enzyme essential for formation of the laminated layer found in heterocysts.
Probab=85.72  E-value=0.42  Score=46.80  Aligned_cols=21  Identities=48%  Similarity=0.778  Sum_probs=18.9

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|+.+++.|.||+|||||..
T Consensus        29 ~~G~~~~I~G~nGsGKStLl~   49 (220)
T TIGR02982        29 NPGEIVILTGPSGSGKTTLLT   49 (220)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            578999999999999999765


No 330
>COG4555 NatA ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism]
Probab=85.70  E-value=0.36  Score=48.92  Aligned_cols=21  Identities=38%  Similarity=0.713  Sum_probs=18.8

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ++|.++.++|+.|+||||+..
T Consensus        26 e~Gei~GlLG~NGAGKTT~LR   46 (245)
T COG4555          26 EEGEITGLLGENGAGKTTLLR   46 (245)
T ss_pred             ccceEEEEEcCCCCCchhHHH
Confidence            689999999999999999654


No 331
>cd03271 ABC_UvrA_II The excision repair protein UvrA domain II; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion.  Recognition and cleavage of the damaged DNA is a multistep ATP-dependent reaction that requires the UvrA, UvrB, and UvrC proteins.  Both UvrA and UvrB are ATPases, with UvrA having two ATP binding sites, which have the characteristic signature of the family of ABC proteins and UvrB having one ATP binding site that is structurally related to that of helicases.
Probab=85.66  E-value=0.42  Score=49.25  Aligned_cols=21  Identities=33%  Similarity=0.510  Sum_probs=19.1

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      +-|..+++.|.||+|||||..
T Consensus        19 p~g~~~~vtGvSGsGKStL~~   39 (261)
T cd03271          19 PLGVLTCVTGVSGSGKSSLIN   39 (261)
T ss_pred             cCCcEEEEECCCCCchHHHHH
Confidence            568899999999999999876


No 332
>PRK14271 phosphate ABC transporter ATP-binding protein; Provisional
Probab=85.63  E-value=0.42  Score=48.96  Aligned_cols=21  Identities=33%  Similarity=0.504  Sum_probs=18.9

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|..+++.|+||+|||||..
T Consensus        45 ~~Ge~~~I~G~nGsGKSTLl~   65 (276)
T PRK14271         45 PARAVTSLMGPTGSGKTTFLR   65 (276)
T ss_pred             cCCcEEEEECCCCCCHHHHHH
Confidence            578999999999999999765


No 333
>PRK13650 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=85.63  E-value=0.4  Score=49.06  Aligned_cols=21  Identities=33%  Similarity=0.548  Sum_probs=18.8

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|..+++.|.||+|||||..
T Consensus        31 ~~Ge~~~i~G~nGsGKSTLl~   51 (279)
T PRK13650         31 KQGEWLSIIGHNGSGKSTTVR   51 (279)
T ss_pred             eCCCEEEEECCCCCCHHHHHH
Confidence            568999999999999999765


No 334
>cd03283 ABC_MutS-like MutS-like homolog in eukaryotes.  The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch.  Members of the MutS family possess C-terminal domain with a conserved ATPase activity that belongs to the ATP binding cassette (ABC) superfamily.  MutS homologs (MSH) have been identified in most prokaryotic and all eukaryotic organisms examined.  Prokaryotes have two homologs (MutS1 and MutS2), whereas seven MSH proteins (MSH1 to MSH7) have been identified in eukaryotes.  The homodimer MutS1 and heterodimers MSH2-MSH3 and MSH2-MSH6 are primarily involved in mitotic mismatch repair, whereas MSH4-MSH5 is involved in resolution of Holliday junctions during meiosis.  All members of the MutS family contain the highly conserved Walker A/B ATPase domain, and many share a common mechanism of action.  MutS1, MSH2-MSH3, MSH2-MSH6, and MSH4-MSH5 dimerize to form slid
Probab=85.62  E-value=0.43  Score=46.82  Aligned_cols=19  Identities=26%  Similarity=0.294  Sum_probs=17.0

Q ss_pred             CCEEEEEecCCCCcccccc
Q 008523          334 GDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       334 G~valfFGLSGTGKTTLsa  352 (563)
                      |+.+++.|++|+|||||..
T Consensus        25 g~~~~ltGpNg~GKSTllr   43 (199)
T cd03283          25 KNGILITGSNMSGKSTFLR   43 (199)
T ss_pred             CcEEEEECCCCCChHHHHH
Confidence            5899999999999999754


No 335
>PRK14254 phosphate ABC transporter ATP-binding protein; Provisional
Probab=85.61  E-value=0.42  Score=49.23  Aligned_cols=21  Identities=33%  Similarity=0.555  Sum_probs=18.8

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|+.+++.|.+|+|||||..
T Consensus        63 ~~Ge~~~I~G~nGsGKSTLl~   83 (285)
T PRK14254         63 PENQVTAMIGPSGCGKSTFLR   83 (285)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            568999999999999999764


No 336
>cd03236 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 of RNase L inhibitor.  The ABC ATPase, RNase L inhibitor (RLI), is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids.  RLI s are not transport proteins and thus cluster with a group of soluble proteins that lack the transmembrane components commonly found in other members of the family.  Structurally, RLIs have an N-terminal Fe-S domain and two nucleotide binding domains which are arranged to form two composite active sites in their interface cleft.  RLI is one of the most conserved enzymes between archaea and eukaryotes with a sequence identity more than 48%.  The high degree of evolutionary conservation suggests that RLI performs a central role in archaeal and eukaryotic physiology.
Probab=85.61  E-value=0.43  Score=48.64  Aligned_cols=22  Identities=32%  Similarity=0.501  Sum_probs=19.2

Q ss_pred             cCCCCEEEEEecCCCCcccccc
Q 008523          331 GKDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       331 g~~G~valfFGLSGTGKTTLsa  352 (563)
                      -..|..+++.|+||+|||||..
T Consensus        23 i~~Ge~~~IvG~nGsGKSTLlk   44 (255)
T cd03236          23 PREGQVLGLVGPNGIGKSTALK   44 (255)
T ss_pred             CCCCCEEEEECCCCCCHHHHHH
Confidence            3578999999999999999765


No 337
>PRK13975 thymidylate kinase; Provisional
Probab=85.58  E-value=0.36  Score=45.96  Aligned_cols=19  Identities=37%  Similarity=0.658  Sum_probs=16.7

Q ss_pred             CCEEEEEecCCCCcccccc
Q 008523          334 GDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       334 G~valfFGLSGTGKTTLsa  352 (563)
                      |..++|.|+.|+||||++.
T Consensus         2 ~~~I~ieG~~GsGKtT~~~   20 (196)
T PRK13975          2 NKFIVFEGIDGSGKTTQAK   20 (196)
T ss_pred             CeEEEEECCCCCCHHHHHH
Confidence            3579999999999999876


No 338
>cd02020 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the reversible phosphorylation of cytidine monophosphate (CMP) to produce cytidine diphosphate (CDP), using ATP as the preferred phosphoryl donor.
Probab=85.45  E-value=0.31  Score=43.67  Aligned_cols=17  Identities=29%  Similarity=0.548  Sum_probs=15.0

Q ss_pred             EEEEEecCCCCcccccc
Q 008523          336 VALFFGLSGTGKTTLST  352 (563)
Q Consensus       336 valfFGLSGTGKTTLsa  352 (563)
                      ++++.|++||||||++.
T Consensus         1 ~I~i~G~~GsGKst~a~   17 (147)
T cd02020           1 IIAIDGPAGSGKSTVAK   17 (147)
T ss_pred             CEEEECCCCCCHHHHHH
Confidence            37899999999999876


No 339
>PRK14737 gmk guanylate kinase; Provisional
Probab=85.44  E-value=0.39  Score=46.74  Aligned_cols=20  Identities=20%  Similarity=0.393  Sum_probs=17.4

Q ss_pred             CCCEEEEEecCCCCcccccc
Q 008523          333 DGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       333 ~G~valfFGLSGTGKTTLsa  352 (563)
                      .+..+++.|+||+|||||..
T Consensus         3 ~~~~ivl~GpsG~GK~tl~~   22 (186)
T PRK14737          3 SPKLFIISSVAGGGKSTIIQ   22 (186)
T ss_pred             CCeEEEEECCCCCCHHHHHH
Confidence            35789999999999999865


No 340
>PRK13640 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=85.35  E-value=0.43  Score=48.94  Aligned_cols=21  Identities=33%  Similarity=0.613  Sum_probs=18.8

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|..+++.|++|+|||||..
T Consensus        31 ~~Ge~~~I~G~nGaGKSTLl~   51 (282)
T PRK13640         31 PRGSWTALIGHNGSGKSTISK   51 (282)
T ss_pred             cCCCEEEEECCCCCcHHHHHH
Confidence            568999999999999999765


No 341
>PRK05057 aroK shikimate kinase I; Reviewed
Probab=85.23  E-value=0.39  Score=45.91  Aligned_cols=18  Identities=28%  Similarity=0.514  Sum_probs=16.0

Q ss_pred             CEEEEEecCCCCcccccc
Q 008523          335 DVALFFGLSGTGKTTLST  352 (563)
Q Consensus       335 ~valfFGLSGTGKTTLsa  352 (563)
                      ..++|.|++|+|||||+.
T Consensus         5 ~~I~liG~~GaGKStl~~   22 (172)
T PRK05057          5 RNIFLVGPMGAGKSTIGR   22 (172)
T ss_pred             CEEEEECCCCcCHHHHHH
Confidence            469999999999999876


No 342
>COG0444 DppD ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism]
Probab=85.23  E-value=0.71  Score=49.12  Aligned_cols=41  Identities=24%  Similarity=0.305  Sum_probs=27.5

Q ss_pred             CCCCEEEEEecCCCCcccccc-----cC-CCceeecCceeecCCCcc
Q 008523          332 KDGDVALFFGLSGTGKTTLST-----DH-NRYLIGDDEHCWGDNGVS  372 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa-----d~-~r~lIgDDe~~w~~~Gvf  372 (563)
                      +.|.+..+.|.||||||||+.     -| ...-|.+.+..++...++
T Consensus        29 ~~GE~lgiVGESGsGKS~~~~aim~llp~~~~~i~~G~i~f~g~~l~   75 (316)
T COG0444          29 KKGEILGIVGESGSGKSVLAKAIMGLLPKPNARIVGGEILFDGKDLL   75 (316)
T ss_pred             cCCcEEEEEcCCCCCHHHHHHHHHhccCCCCCeEeeeEEEECCcccc
Confidence            678999999999999999775     22 223344445555544443


No 343
>PRK13639 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=85.19  E-value=0.44  Score=48.60  Aligned_cols=21  Identities=33%  Similarity=0.661  Sum_probs=18.8

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|..+++.|++|+|||||..
T Consensus        26 ~~Ge~~~l~G~nGsGKSTLl~   46 (275)
T PRK13639         26 EKGEMVALLGPNGAGKSTLFL   46 (275)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            578999999999999999764


No 344
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda. Members of this protein family are Hda (Homologous to DnaA). These proteins are about half the length of DnaA and homologous over length of Hda. In the model species Escherichia coli, the initiation of DNA replication requires DnaA bound to ATP rather than ADP; Hda helps facilitate the conversion of DnaA-ATP to DnaA-ADP.
Probab=85.16  E-value=0.43  Score=46.29  Aligned_cols=20  Identities=30%  Similarity=0.524  Sum_probs=17.4

Q ss_pred             CCCEEEEEecCCCCcccccc
Q 008523          333 DGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       333 ~G~valfFGLSGTGKTTLsa  352 (563)
                      .+..++++|.+|||||+|+.
T Consensus        37 ~~~~lll~G~~G~GKT~la~   56 (226)
T TIGR03420        37 GDRFLYLWGESGSGKSHLLQ   56 (226)
T ss_pred             CCCeEEEECCCCCCHHHHHH
Confidence            34679999999999999876


No 345
>PF01695 IstB_IS21:  IstB-like ATP binding protein;  InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif. They are found associated with IS21 family insertion sequences []. Functionally they have not been characterised, but they may be involved in transposition [].; GO: 0005524 ATP binding; PDB: 3EC2_A 3ECC_A 2W58_A 2QGZ_A.
Probab=85.14  E-value=0.42  Score=46.20  Aligned_cols=20  Identities=40%  Similarity=0.815  Sum_probs=16.4

Q ss_pred             CCCEEEEEecCCCCcccccc
Q 008523          333 DGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       333 ~G~valfFGLSGTGKTTLsa  352 (563)
                      ++..++|+|.+|||||.|+.
T Consensus        46 ~~~~l~l~G~~G~GKThLa~   65 (178)
T PF01695_consen   46 NGENLILYGPPGTGKTHLAV   65 (178)
T ss_dssp             C--EEEEEESTTSSHHHHHH
T ss_pred             cCeEEEEEhhHhHHHHHHHH
Confidence            46679999999999999876


No 346
>PRK13633 cobalt transporter ATP-binding subunit; Provisional
Probab=85.13  E-value=0.45  Score=48.68  Aligned_cols=21  Identities=33%  Similarity=0.760  Sum_probs=18.7

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|..+++.|.+|+|||||..
T Consensus        34 ~~Ge~~~l~G~nGsGKSTLl~   54 (280)
T PRK13633         34 KKGEFLVILGRNGSGKSTIAK   54 (280)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            568999999999999999764


No 347
>PRK13641 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=85.08  E-value=0.44  Score=48.98  Aligned_cols=21  Identities=33%  Similarity=0.680  Sum_probs=18.9

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|..+++.|++|+|||||..
T Consensus        31 ~~Ge~~~iiG~NGaGKSTLl~   51 (287)
T PRK13641         31 EEGSFVALVGHTGSGKSTLMQ   51 (287)
T ss_pred             eCCCEEEEECCCCCCHHHHHH
Confidence            578999999999999999765


No 348
>PRK13637 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=85.04  E-value=0.45  Score=49.01  Aligned_cols=21  Identities=38%  Similarity=0.703  Sum_probs=18.8

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|..+++.|+||+|||||..
T Consensus        31 ~~Ge~~~i~G~nGaGKSTLl~   51 (287)
T PRK13637         31 EDGEFVGLIGHTGSGKSTLIQ   51 (287)
T ss_pred             cCCCEEEEECCCCCcHHHHHH
Confidence            568999999999999999765


No 349
>PRK13652 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=85.03  E-value=0.46  Score=48.54  Aligned_cols=21  Identities=29%  Similarity=0.387  Sum_probs=18.8

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|.++++.|.+|+|||||..
T Consensus        28 ~~Ge~~~i~G~NGsGKSTLl~   48 (277)
T PRK13652         28 PRNSRIAVIGPNGAGKSTLFR   48 (277)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            568999999999999999764


No 350
>TIGR01618 phage_P_loop phage nucleotide-binding protein. This model represents an uncharacterized family of proteins from a number of phage of Gram-positive bacteria. This protein contains a P-loop motif, G/A-X-X-G-X-G-K-T near its amino end. The function of this protein is unknown.
Probab=85.03  E-value=0.46  Score=47.99  Aligned_cols=25  Identities=32%  Similarity=0.468  Sum_probs=19.3

Q ss_pred             CCEEEEEecCCCCcccccc-cCCCce
Q 008523          334 GDVALFFGLSGTGKTTLST-DHNRYL  358 (563)
Q Consensus       334 G~valfFGLSGTGKTTLsa-d~~r~l  358 (563)
                      ...++|.|.+|+||||++. -|++.+
T Consensus        12 ~~~~liyG~~G~GKtt~a~~~~~~~~   37 (220)
T TIGR01618        12 PNMYLIYGKPGTGKTSTIKYLPGKTL   37 (220)
T ss_pred             CcEEEEECCCCCCHHHHHHhcCCCCE
Confidence            3469999999999999885 444443


No 351
>COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism]
Probab=85.02  E-value=0.46  Score=49.18  Aligned_cols=21  Identities=33%  Similarity=0.645  Sum_probs=18.9

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      +.|..+.+.|+.|||||||..
T Consensus        26 ~~G~i~~iiGpNG~GKSTLLk   46 (258)
T COG1120          26 PKGEITGILGPNGSGKSTLLK   46 (258)
T ss_pred             cCCcEEEEECCCCCCHHHHHH
Confidence            568999999999999999765


No 352
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family. Members of this protein family are homologs of ClpB, an ATPase associated with chaperone-related functions. These ClpB homologs, designated ClpV1, are a key component of the bacterial pathogenicity-associated type VI secretion system.
Probab=85.01  E-value=0.33  Score=57.70  Aligned_cols=17  Identities=47%  Similarity=0.608  Sum_probs=15.4

Q ss_pred             EEEEEecCCCCcccccc
Q 008523          336 VALFFGLSGTGKTTLST  352 (563)
Q Consensus       336 valfFGLSGTGKTTLsa  352 (563)
                      +++|.|++|+|||.|+.
T Consensus       598 ~~lf~Gp~GvGKT~lA~  614 (852)
T TIGR03345       598 VFLLVGPSGVGKTETAL  614 (852)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            58999999999999875


No 353
>PRK13631 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=84.99  E-value=0.46  Score=50.05  Aligned_cols=21  Identities=38%  Similarity=0.646  Sum_probs=18.9

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|..+++.|.||+|||||..
T Consensus        50 ~~Ge~~~I~G~nGsGKSTLl~   70 (320)
T PRK13631         50 EKNKIYFIIGNSGSGKSTLVT   70 (320)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            568999999999999999765


No 354
>PRK02496 adk adenylate kinase; Provisional
Probab=84.98  E-value=0.37  Score=45.81  Aligned_cols=17  Identities=35%  Similarity=0.612  Sum_probs=15.1

Q ss_pred             EEEEEecCCCCcccccc
Q 008523          336 VALFFGLSGTGKTTLST  352 (563)
Q Consensus       336 valfFGLSGTGKTTLsa  352 (563)
                      .++|+|++|+||||++.
T Consensus         3 ~i~i~G~pGsGKst~a~   19 (184)
T PRK02496          3 RLIFLGPPGAGKGTQAV   19 (184)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            47899999999999876


No 355
>TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family. This KaiC domain-containing protein family occurs sporadically across a broad taxonomic range (Euryarchaeota, Aquificae, Dictyoglomi, Epsilonproteobacteria, and Firmicutes), but exclusively in thermophiles.
Probab=84.98  E-value=0.41  Score=48.83  Aligned_cols=21  Identities=29%  Similarity=0.302  Sum_probs=18.7

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      +.|.++++.|.+|||||||+.
T Consensus        34 p~gs~~lI~G~pGtGKT~l~~   54 (259)
T TIGR03878        34 PAYSVINITGVSDTGKSLMVE   54 (259)
T ss_pred             ECCcEEEEEcCCCCCHHHHHH
Confidence            457899999999999999877


No 356
>COG2274 SunT ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms]
Probab=84.94  E-value=0.43  Score=55.75  Aligned_cols=21  Identities=38%  Similarity=0.585  Sum_probs=18.6

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      +.|..+++.|-||||||||+.
T Consensus       497 ~~Ge~vaIvG~SGsGKSTL~K  517 (709)
T COG2274         497 PPGEKVAIVGRSGSGKSTLLK  517 (709)
T ss_pred             CCCCEEEEECCCCCCHHHHHH
Confidence            347889999999999999876


No 357
>PRK14532 adenylate kinase; Provisional
Probab=84.93  E-value=0.37  Score=45.87  Aligned_cols=17  Identities=29%  Similarity=0.491  Sum_probs=15.1

Q ss_pred             EEEEEecCCCCcccccc
Q 008523          336 VALFFGLSGTGKTTLST  352 (563)
Q Consensus       336 valfFGLSGTGKTTLsa  352 (563)
                      .++++|++||||||++.
T Consensus         2 ~i~~~G~pGsGKsT~a~   18 (188)
T PRK14532          2 NLILFGPPAAGKGTQAK   18 (188)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            37899999999999876


No 358
>PRK11176 lipid transporter ATP-binding/permease protein; Provisional
Probab=84.87  E-value=0.46  Score=53.23  Aligned_cols=21  Identities=33%  Similarity=0.637  Sum_probs=19.1

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      +.|..+++.|.||+|||||..
T Consensus       367 ~~G~~~aIvG~sGsGKSTLl~  387 (582)
T PRK11176        367 PAGKTVALVGRSGSGKSTIAN  387 (582)
T ss_pred             CCCCEEEEECCCCCCHHHHHH
Confidence            678899999999999999765


No 359
>PRK09361 radB DNA repair and recombination protein RadB; Provisional
Probab=84.79  E-value=0.42  Score=46.88  Aligned_cols=21  Identities=29%  Similarity=0.681  Sum_probs=18.8

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      +.|.+++++|.+|+|||+|+.
T Consensus        21 ~~g~i~~i~G~~GsGKT~l~~   41 (225)
T PRK09361         21 ERGTITQIYGPPGSGKTNICL   41 (225)
T ss_pred             CCCeEEEEECCCCCCHHHHHH
Confidence            557899999999999999876


No 360
>PF08477 Miro:  Miro-like protein;  InterPro: IPR013684 Mitochondrial Rho proteins (Miro-1, Q8IXI2 from SWISSPROT and Miro-2, Q8IXI1 from SWISSPROT) are atypical Rho GTPases. They have a unique domain organisation, with tandem GTP-binding domains and two EF hand domains (IPR002048 from INTERPRO), that may bind calcium. They are also larger than classical small GTPases. It has been proposed that they are involved in mitochondrial homeostasis and apoptosis []. ; GO: 0005525 GTP binding, 0007264 small GTPase mediated signal transduction, 0005622 intracellular; PDB: 2IWR_A 2BMJ_A 3IHW_A 2ZEJ_A 3D6T_B 3DPU_A.
Probab=84.78  E-value=0.42  Score=41.30  Aligned_cols=16  Identities=44%  Similarity=0.632  Sum_probs=14.3

Q ss_pred             EEEEecCCCCcccccc
Q 008523          337 ALFFGLSGTGKTTLST  352 (563)
Q Consensus       337 alfFGLSGTGKTTLsa  352 (563)
                      +++.|.+|+|||||..
T Consensus         2 I~V~G~~g~GKTsLi~   17 (119)
T PF08477_consen    2 IVVLGDSGVGKTSLIR   17 (119)
T ss_dssp             EEEECSTTSSHHHHHH
T ss_pred             EEEECcCCCCHHHHHH
Confidence            7899999999999765


No 361
>PRK13644 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=84.77  E-value=0.47  Score=48.47  Aligned_cols=21  Identities=38%  Similarity=0.632  Sum_probs=18.9

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      +.|..+++.|.+|+|||||..
T Consensus        26 ~~Ge~~~i~G~nGsGKSTLl~   46 (274)
T PRK13644         26 KKGEYIGIIGKNGSGKSTLAL   46 (274)
T ss_pred             eCCCEEEEECCCCCCHHHHHH
Confidence            679999999999999999765


No 362
>cd03299 ABC_ModC_like Archeal protein closely related to ModC.  ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=84.76  E-value=0.49  Score=46.97  Aligned_cols=21  Identities=33%  Similarity=0.645  Sum_probs=18.7

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|..+++.|.||+|||||..
T Consensus        23 ~~Ge~~~i~G~nG~GKStLl~   43 (235)
T cd03299          23 ERGDYFVILGPTGSGKSVLLE   43 (235)
T ss_pred             cCCcEEEEECCCCCCHHHHHH
Confidence            568999999999999999654


No 363
>PRK13642 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=84.75  E-value=0.48  Score=48.42  Aligned_cols=21  Identities=29%  Similarity=0.552  Sum_probs=18.7

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|..+++.|.||+|||||..
T Consensus        31 ~~Ge~~~I~G~nGsGKSTLl~   51 (277)
T PRK13642         31 TKGEWVSIIGQNGSGKSTTAR   51 (277)
T ss_pred             cCCCEEEEECCCCCcHHHHHH
Confidence            568999999999999999765


No 364
>PF13476 AAA_23:  AAA domain; PDB: 3AV0_B 3AUY_B 3AUX_A 2O5V_A 3QG5_B 3QF7_A 3THO_A.
Probab=84.73  E-value=0.48  Score=44.24  Aligned_cols=18  Identities=28%  Similarity=0.689  Sum_probs=15.7

Q ss_pred             CEEEEEecCCCCcccccc
Q 008523          335 DVALFFGLSGTGKTTLST  352 (563)
Q Consensus       335 ~valfFGLSGTGKTTLsa  352 (563)
                      .+.+|+|++||||||+..
T Consensus        20 g~~vi~G~Ng~GKStil~   37 (202)
T PF13476_consen   20 GLNVIYGPNGSGKSTILE   37 (202)
T ss_dssp             EEEEEEESTTSSHHHHHH
T ss_pred             CcEEEECCCCCCHHHHHH
Confidence            489999999999999653


No 365
>cd03279 ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complexes are implicated in the metabolism of DNA ends. They cleave ends sealed by hairpin structures and are thought to play a role in removing protein bound to DNA termini.
Probab=84.70  E-value=0.48  Score=46.46  Aligned_cols=20  Identities=30%  Similarity=0.566  Sum_probs=17.2

Q ss_pred             CCCEEEEEecCCCCcccccc
Q 008523          333 DGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       333 ~G~valfFGLSGTGKTTLsa  352 (563)
                      +|..++|.|++|+|||||..
T Consensus        27 ~~~~~~i~G~NGsGKSTll~   46 (213)
T cd03279          27 NNGLFLICGPTGAGKSTILD   46 (213)
T ss_pred             ccCEEEEECCCCCCHHHHHH
Confidence            46799999999999999753


No 366
>PRK08356 hypothetical protein; Provisional
Probab=84.68  E-value=0.46  Score=45.98  Aligned_cols=20  Identities=25%  Similarity=0.322  Sum_probs=16.6

Q ss_pred             CCCEEEEEecCCCCcccccc
Q 008523          333 DGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       333 ~G~valfFGLSGTGKTTLsa  352 (563)
                      +...++|.|++|+||||++.
T Consensus         4 ~~~~i~~~G~~gsGK~t~a~   23 (195)
T PRK08356          4 EKMIVGVVGKIAAGKTTVAK   23 (195)
T ss_pred             CcEEEEEECCCCCCHHHHHH
Confidence            34568999999999999765


No 367
>cd01428 ADK Adenylate kinase (ADK) catalyzes the reversible phosphoryl transfer from adenosine triphosphates (ATP) to adenosine monophosphates (AMP) and to yield adenosine diphosphates (ADP). This enzyme is required for the biosynthesis of ADP and is essential for homeostasis of adenosine phosphates.
Probab=84.60  E-value=0.39  Score=45.41  Aligned_cols=16  Identities=38%  Similarity=0.638  Sum_probs=14.8

Q ss_pred             EEEEecCCCCcccccc
Q 008523          337 ALFFGLSGTGKTTLST  352 (563)
Q Consensus       337 alfFGLSGTGKTTLsa  352 (563)
                      ++++|++||||||++.
T Consensus         2 I~i~G~pGsGKst~a~   17 (194)
T cd01428           2 ILLLGPPGSGKGTQAE   17 (194)
T ss_pred             EEEECCCCCCHHHHHH
Confidence            7899999999999876


No 368
>PRK14258 phosphate ABC transporter ATP-binding protein; Provisional
Probab=84.59  E-value=0.5  Score=47.73  Aligned_cols=21  Identities=33%  Similarity=0.491  Sum_probs=18.9

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|+.+++.|.+|+|||||..
T Consensus        31 ~~Ge~~~I~G~nGsGKSTLl~   51 (261)
T PRK14258         31 YQSKVTAIIGPSGCGKSTFLK   51 (261)
T ss_pred             cCCcEEEEECCCCCCHHHHHH
Confidence            578999999999999999765


No 369
>cd01393 recA_like RecA is a  bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response.  RecA couples ATP hydrolysis to DNA strand exchange. While prokaryotes have a single RecA protein, eukaryotes have multiple RecA homologs such as Rad51, DMC1 and Rad55/57.  Archaea have the RecA-like homologs radA and radB.
Probab=84.54  E-value=0.5  Score=46.02  Aligned_cols=21  Identities=38%  Similarity=0.616  Sum_probs=18.7

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      +.|.++.++|++|+|||+|+.
T Consensus        17 ~~g~v~~I~G~~GsGKT~l~~   37 (226)
T cd01393          17 PTGRITEIFGEFGSGKTQLCL   37 (226)
T ss_pred             cCCcEEEEeCCCCCChhHHHH
Confidence            457899999999999999776


No 370
>cd04159 Arl10_like Arl10-like subfamily.  Arl9/Arl10 was identified from a human cancer-derived EST dataset.  No functional information about the subfamily is available at the current time, but crystal structures of human Arl10b and Arl10c have been solved.
Probab=84.50  E-value=0.44  Score=42.05  Aligned_cols=16  Identities=44%  Similarity=0.646  Sum_probs=14.3

Q ss_pred             EEEEecCCCCcccccc
Q 008523          337 ALFFGLSGTGKTTLST  352 (563)
Q Consensus       337 alfFGLSGTGKTTLsa  352 (563)
                      ++|.|++|+|||||..
T Consensus         2 i~i~G~~~~GKssl~~   17 (159)
T cd04159           2 ITLVGLQNSGKTTLVN   17 (159)
T ss_pred             EEEEcCCCCCHHHHHH
Confidence            6899999999999865


No 371
>cd03288 ABCC_SUR2 The SUR domain 2.  The sulfonylurea receptor SUR is an ATP binding cassette (ABC) protein of the ABCC/MRP family.  Unlike other ABC proteins, it has no intrinsic transport function, neither active nor passive, but associates with the potassium channel proteins Kir6.1 or Kir6.2 to form the ATP-sensitive potassium (K(ATP)) channel.  Within the channel complex, SUR serves as a regulatory subunit that fine-tunes the gating of Kir6.x in response to alterations in cellular metabolism.  It constitutes a major pharmaceutical target as it binds numerous drugs, K(ATP) channel openers and blockers, capable of up- or down-regulating channel activity.
Probab=84.42  E-value=0.52  Score=47.49  Aligned_cols=21  Identities=38%  Similarity=0.570  Sum_probs=19.0

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      +.|+.+++.|.||+|||||..
T Consensus        45 ~~Ge~~~i~G~nGsGKSTLl~   65 (257)
T cd03288          45 KPGQKVGICGRTGSGKSSLSL   65 (257)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            578999999999999999765


No 372
>cd01672 TMPK Thymidine monophosphate kinase (TMPK), also known as thymidylate kinase, catalyzes the phosphorylation of thymidine monophosphate (TMP) to thymidine diphosphate (TDP) utilizing ATP as its preferred phophoryl donor. TMPK represents the rate-limiting step in either de novo or salvage biosynthesis of thymidine triphosphate (TTP).
Probab=84.37  E-value=0.41  Score=44.88  Aligned_cols=17  Identities=47%  Similarity=0.749  Sum_probs=15.3

Q ss_pred             EEEEEecCCCCcccccc
Q 008523          336 VALFFGLSGTGKTTLST  352 (563)
Q Consensus       336 valfFGLSGTGKTTLsa  352 (563)
                      .++|.|+.|+||||++.
T Consensus         2 ~I~ieG~~GsGKtT~~~   18 (200)
T cd01672           2 FIVFEGIDGAGKTTLIE   18 (200)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            47899999999999876


No 373
>PRK13636 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=84.36  E-value=0.51  Score=48.42  Aligned_cols=21  Identities=43%  Similarity=0.700  Sum_probs=18.9

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|..+++.|++|+|||||..
T Consensus        30 ~~Ge~~~i~G~nGaGKSTLl~   50 (283)
T PRK13636         30 KKGEVTAILGGNGAGKSTLFQ   50 (283)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            578999999999999999765


No 374
>PRK06893 DNA replication initiation factor; Validated
Probab=84.32  E-value=0.38  Score=48.01  Aligned_cols=18  Identities=22%  Similarity=0.351  Sum_probs=15.9

Q ss_pred             CEEEEEecCCCCcccccc
Q 008523          335 DVALFFGLSGTGKTTLST  352 (563)
Q Consensus       335 ~valfFGLSGTGKTTLsa  352 (563)
                      ...+++|+||||||+|+.
T Consensus        40 ~~l~l~G~~G~GKThL~~   57 (229)
T PRK06893         40 PFFYIWGGKSSGKSHLLK   57 (229)
T ss_pred             CeEEEECCCCCCHHHHHH
Confidence            458999999999999876


No 375
>PRK13546 teichoic acids export protein ATP-binding subunit; Provisional
Probab=84.31  E-value=0.52  Score=48.17  Aligned_cols=21  Identities=48%  Similarity=0.811  Sum_probs=19.1

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|..+++.|++|+|||||..
T Consensus        48 ~~Ge~~~liG~NGsGKSTLlk   68 (264)
T PRK13546         48 YEGDVIGLVGINGSGKSTLSN   68 (264)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            678999999999999999765


No 376
>PRK13643 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=84.27  E-value=0.5  Score=48.69  Aligned_cols=21  Identities=38%  Similarity=0.669  Sum_probs=19.0

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|..+++.|.+|+|||||..
T Consensus        30 ~~Ge~v~i~G~nGsGKSTLl~   50 (288)
T PRK13643         30 KKGSYTALIGHTGSGKSTLLQ   50 (288)
T ss_pred             cCCCEEEEECCCCChHHHHHH
Confidence            578999999999999999765


No 377
>PRK08084 DNA replication initiation factor; Provisional
Probab=84.26  E-value=0.46  Score=47.61  Aligned_cols=18  Identities=17%  Similarity=0.399  Sum_probs=16.1

Q ss_pred             CEEEEEecCCCCcccccc
Q 008523          335 DVALFFGLSGTGKTTLST  352 (563)
Q Consensus       335 ~valfFGLSGTGKTTLsa  352 (563)
                      ..++|+|++|||||+|..
T Consensus        46 ~~l~l~Gp~G~GKThLl~   63 (235)
T PRK08084         46 GYIYLWSREGAGRSHLLH   63 (235)
T ss_pred             CeEEEECCCCCCHHHHHH
Confidence            478999999999999875


No 378
>PRK12339 2-phosphoglycerate kinase; Provisional
Probab=84.24  E-value=0.48  Score=46.74  Aligned_cols=19  Identities=32%  Similarity=0.607  Sum_probs=16.8

Q ss_pred             CCEEEEEecCCCCcccccc
Q 008523          334 GDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       334 G~valfFGLSGTGKTTLsa  352 (563)
                      +.++++.|+||+||||++.
T Consensus         3 ~~~i~i~G~~G~GKst~a~   21 (197)
T PRK12339          3 STIHFIGGIPGVGKTSISG   21 (197)
T ss_pred             ceEEEEECCCCCCHHHHHH
Confidence            4579999999999999876


No 379
>cd04155 Arl3 Arl3 subfamily.  Arl3 (Arf-like 3) is an Arf family protein that differs from most Arf family members in the N-terminal extension.  In is inactive, GDP-bound form, the N-terminal extension forms an elongated loop that is hydrophobically anchored into the membrane surface; however, it has been proposed that this region might form a helix in the GTP-bound form.  The delta subunit of the rod-specific cyclic GMP phosphodiesterase type 6 (PDEdelta) is an Arl3 effector.  Arl3 binds microtubules in a regulated manner to alter specific aspects of cytokinesis via interactions with retinitis pigmentosa 2 (RP2).  It has been proposed that RP2 functions in concert with Arl3 to link the cell membrane and the cytoskeleton in photoreceptors as part of the cell signaling or vesicular transport machinery.  In mice, the absence of Arl3 is associated with abnormal epithelial cell proliferation and cyst formation.
Probab=84.23  E-value=0.48  Score=43.52  Aligned_cols=19  Identities=37%  Similarity=0.534  Sum_probs=16.5

Q ss_pred             CCEEEEEecCCCCcccccc
Q 008523          334 GDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       334 G~valfFGLSGTGKTTLsa  352 (563)
                      ...++++|++|+|||||..
T Consensus        14 ~~~v~i~G~~g~GKStLl~   32 (173)
T cd04155          14 EPRILILGLDNAGKTTILK   32 (173)
T ss_pred             ccEEEEEccCCCCHHHHHH
Confidence            3569999999999999865


No 380
>cd02025 PanK Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway. The reaction carried out by this enzyme is a key regulatory point in CoA biosynthesis.
Probab=84.18  E-value=0.39  Score=47.89  Aligned_cols=16  Identities=25%  Similarity=0.229  Sum_probs=14.2

Q ss_pred             EEEEecCCCCcccccc
Q 008523          337 ALFFGLSGTGKTTLST  352 (563)
Q Consensus       337 alfFGLSGTGKTTLsa  352 (563)
                      +.+.|.||+|||||+.
T Consensus         2 igI~G~sGSGKTTla~   17 (220)
T cd02025           2 IGIAGSVAVGKSTTAR   17 (220)
T ss_pred             EEeeCCCCCCHHHHHH
Confidence            5788999999999875


No 381
>PRK12726 flagellar biosynthesis regulator FlhF; Provisional
Probab=84.17  E-value=0.73  Score=50.53  Aligned_cols=31  Identities=23%  Similarity=0.416  Sum_probs=22.4

Q ss_pred             eeeecccceecCCCCEEEEEecCCCCcccccc
Q 008523          321 ILSLHSGCNMGKDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       321 ~L~mH~sanvg~~G~valfFGLSGTGKTTLsa  352 (563)
                      .+++..+... ..+.+++|.|++|+||||+.+
T Consensus       194 ~l~~~~~~~~-~~~~ii~lvGptGvGKTTt~a  224 (407)
T PRK12726        194 KLAVEDSFDL-SNHRIISLIGQTGVGKTTTLV  224 (407)
T ss_pred             cEeeCCCcee-cCCeEEEEECCCCCCHHHHHH
Confidence            4444433322 357899999999999999776


No 382
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit. RuvA specifically binds Holliday junctions as a sandwich of two tetramers and maintains the configuration of the junction. It forms a complex with two hexameric rings of RuvB, the subunit that contains helicase activity. The complex drives ATP-dependent branch migration of the Holliday junction recombination intermediate. The endonuclease RuvC resolves junctions.
Probab=84.16  E-value=0.44  Score=48.78  Aligned_cols=18  Identities=50%  Similarity=0.781  Sum_probs=16.0

Q ss_pred             CEEEEEecCCCCcccccc
Q 008523          335 DVALFFGLSGTGKTTLST  352 (563)
Q Consensus       335 ~valfFGLSGTGKTTLsa  352 (563)
                      ..++|+|++|||||+|+.
T Consensus        31 ~~~ll~Gp~G~GKT~la~   48 (305)
T TIGR00635        31 DHLLLYGPPGLGKTTLAH   48 (305)
T ss_pred             CeEEEECCCCCCHHHHHH
Confidence            468999999999999875


No 383
>PHA02530 pseT polynucleotide kinase; Provisional
Probab=84.11  E-value=0.43  Score=48.70  Aligned_cols=18  Identities=33%  Similarity=0.660  Sum_probs=15.7

Q ss_pred             CEEEEEecCCCCcccccc
Q 008523          335 DVALFFGLSGTGKTTLST  352 (563)
Q Consensus       335 ~valfFGLSGTGKTTLsa  352 (563)
                      ..+++.|++||||||++.
T Consensus         3 ~liil~G~pGSGKSTla~   20 (300)
T PHA02530          3 KIILTVGVPGSGKSTWAR   20 (300)
T ss_pred             EEEEEEcCCCCCHHHHHH
Confidence            357889999999999876


No 384
>PRK14246 phosphate ABC transporter ATP-binding protein; Provisional
Probab=84.08  E-value=0.54  Score=47.57  Aligned_cols=21  Identities=33%  Similarity=0.507  Sum_probs=18.7

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|..++++|++|+|||||..
T Consensus        34 ~~Ge~~~i~G~nGsGKSTLl~   54 (257)
T PRK14246         34 PNNSIFGIMGPSGSGKSTLLK   54 (257)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            568999999999999999764


No 385
>PHA00729 NTP-binding motif containing protein
Probab=84.02  E-value=0.42  Score=48.54  Aligned_cols=17  Identities=47%  Similarity=0.757  Sum_probs=16.0

Q ss_pred             EEEEEecCCCCcccccc
Q 008523          336 VALFFGLSGTGKTTLST  352 (563)
Q Consensus       336 valfFGLSGTGKTTLsa  352 (563)
                      .++++|.+|||||||+.
T Consensus        19 nIlItG~pGvGKT~LA~   35 (226)
T PHA00729         19 SAVIFGKQGSGKTTYAL   35 (226)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            59999999999999987


No 386
>PRK04040 adenylate kinase; Provisional
Probab=83.97  E-value=0.48  Score=46.20  Aligned_cols=18  Identities=39%  Similarity=0.632  Sum_probs=16.1

Q ss_pred             CEEEEEecCCCCcccccc
Q 008523          335 DVALFFGLSGTGKTTLST  352 (563)
Q Consensus       335 ~valfFGLSGTGKTTLsa  352 (563)
                      ..+++.|.+||||||++.
T Consensus         3 ~~i~v~G~pG~GKtt~~~   20 (188)
T PRK04040          3 KVVVVTGVPGVGKTTVLN   20 (188)
T ss_pred             eEEEEEeCCCCCHHHHHH
Confidence            468999999999999876


No 387
>cd03297 ABC_ModC_molybdenum_transporter ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=83.88  E-value=0.49  Score=46.06  Aligned_cols=18  Identities=50%  Similarity=0.752  Sum_probs=16.6

Q ss_pred             CEEEEEecCCCCcccccc
Q 008523          335 DVALFFGLSGTGKTTLST  352 (563)
Q Consensus       335 ~valfFGLSGTGKTTLsa  352 (563)
                      +.+++.|+||+|||||..
T Consensus        24 e~~~i~G~nGsGKSTLl~   41 (214)
T cd03297          24 EVTGIFGASGAGKSTLLR   41 (214)
T ss_pred             eeEEEECCCCCCHHHHHH
Confidence            899999999999999765


No 388
>TIGR00041 DTMP_kinase thymidylate kinase. Function: phosphorylation of DTMP to form DTDP in both de novo and salvage pathways of DTTP synthesis. Catalytic activity: ATP + thymidine 5'-phosphate = ADP + thymidine 5'-diphosphate.
Probab=83.87  E-value=0.48  Score=45.11  Aligned_cols=19  Identities=37%  Similarity=0.592  Sum_probs=17.1

Q ss_pred             CCEEEEEecCCCCcccccc
Q 008523          334 GDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       334 G~valfFGLSGTGKTTLsa  352 (563)
                      |..++|.|+.|+||||++.
T Consensus         3 g~~IvieG~~GsGKsT~~~   21 (195)
T TIGR00041         3 GMFIVIEGIDGAGKTTQAN   21 (195)
T ss_pred             ceEEEEECCCCCCHHHHHH
Confidence            5679999999999999876


No 389
>COG1131 CcmA ABC-type multidrug transport system, ATPase component [Defense mechanisms]
Probab=83.68  E-value=0.55  Score=48.90  Aligned_cols=21  Identities=38%  Similarity=0.626  Sum_probs=18.6

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      +.|.+++|.|++|+|||||..
T Consensus        29 ~~Gei~gllG~NGAGKTTllk   49 (293)
T COG1131          29 EPGEIFGLLGPNGAGKTTLLK   49 (293)
T ss_pred             cCCeEEEEECCCCCCHHHHHH
Confidence            568999999999999999654


No 390
>PRK13657 cyclic beta-1,2-glucan ABC transporter; Provisional
Probab=83.65  E-value=0.56  Score=52.84  Aligned_cols=21  Identities=38%  Similarity=0.627  Sum_probs=19.1

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      +.|+.+++.|.||+|||||..
T Consensus       359 ~~G~~v~IvG~sGsGKSTLl~  379 (588)
T PRK13657        359 KPGQTVAIVGPTGAGKSTLIN  379 (588)
T ss_pred             CCCCEEEEECCCCCCHHHHHH
Confidence            678999999999999999765


No 391
>TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2. The enzyme that catalyzes the final step in methanogenesis, methyl coenzyme M reductase, contains alpha, beta, and gamma chains. In older literature, the complex of alpha, beta, and gamma chains was termed component C, while this single chain protein was termed methyl coenzyme M reductase system component A2.
Probab=83.63  E-value=0.56  Score=52.09  Aligned_cols=21  Identities=38%  Similarity=0.658  Sum_probs=18.8

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|..+++.|+||+|||||..
T Consensus        24 ~~Ge~~~iiG~nGsGKSTLl~   44 (520)
T TIGR03269        24 EEGEVLGILGRSGAGKSVLMH   44 (520)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            568999999999999999765


No 392
>cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of recombinases includes the eukaryotic proteins RAD51, RAD55/57 and the meiosis-specific protein DMC1, and the archaeal proteins radA and radB. They are closely related to the bacterial RecA group. Rad51 proteins catalyze a similiar recombination reaction as RecA, using ATP-dependent DNA binding activity and a DNA-dependent ATPase. However, this reaction is less efficient and requires accessory proteins such as RAD55/57 .
Probab=83.61  E-value=0.54  Score=46.08  Aligned_cols=21  Identities=38%  Similarity=0.673  Sum_probs=18.6

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      +.|.++.+.|.||||||+|+.
T Consensus        17 ~~g~i~~i~G~~GsGKT~l~~   37 (235)
T cd01123          17 ETGSITEIFGEFGSGKTQLCH   37 (235)
T ss_pred             CCCeEEEEECCCCCCHHHHHH
Confidence            457899999999999999876


No 393
>cd03278 ABC_SMC_barmotin Barmotin is a tight junction-associated protein expressed in rat epithelial cells which is thought to have an important regulatory role in tight junction barrier function.  Barmotin belongs to the SMC protein family.  SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains.  Amino-acid sequence homology of SMC proteins between species is largely confined to the amino- and carboxy-terminal globular domains. The amino-terminal domain contains a 'Walker A' nucleotide-binding domain (GxxGxGKS/T, in the single-letter amino-acid code), which by mutational studies has been shown to be essential in several proteins.  The carboxy-terminal domain contains a sequence (the DA-box) that resembles a 'Walker B' motif, and a motif with homology to the signature sequence of the ATP-binding cassette (ABC) family of ATPases.  The sequence homology within the carboxy-terminal domain is relatively high within the SMC1-SMC4 group, w
Probab=83.60  E-value=0.54  Score=45.97  Aligned_cols=19  Identities=26%  Similarity=0.602  Sum_probs=16.2

Q ss_pred             CCCEEEEEecCCCCcccccc
Q 008523          333 DGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       333 ~G~valfFGLSGTGKTTLsa  352 (563)
                      .| .+++.|+||+|||||..
T Consensus        22 ~g-~~~i~G~nGsGKStll~   40 (197)
T cd03278          22 PG-LTAIVGPNGSGKSNIID   40 (197)
T ss_pred             CC-cEEEECCCCCCHHHHHH
Confidence            46 88999999999999654


No 394
>PF05729 NACHT:  NACHT domain
Probab=83.54  E-value=0.5  Score=42.68  Aligned_cols=18  Identities=39%  Similarity=0.505  Sum_probs=15.9

Q ss_pred             CEEEEEecCCCCcccccc
Q 008523          335 DVALFFGLSGTGKTTLST  352 (563)
Q Consensus       335 ~valfFGLSGTGKTTLsa  352 (563)
                      +++++.|..|+||||+..
T Consensus         1 r~l~I~G~~G~GKStll~   18 (166)
T PF05729_consen    1 RVLWISGEPGSGKSTLLR   18 (166)
T ss_pred             CEEEEECCCCCChHHHHH
Confidence            478999999999999776


No 395
>PRK01184 hypothetical protein; Provisional
Probab=83.53  E-value=0.49  Score=44.86  Aligned_cols=17  Identities=29%  Similarity=0.567  Sum_probs=14.9

Q ss_pred             EEEEEecCCCCcccccc
Q 008523          336 VALFFGLSGTGKTTLST  352 (563)
Q Consensus       336 valfFGLSGTGKTTLsa  352 (563)
                      ++++.|++||||||++.
T Consensus         3 ~i~l~G~~GsGKsT~a~   19 (184)
T PRK01184          3 IIGVVGMPGSGKGEFSK   19 (184)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            68899999999999754


No 396
>cd03272 ABC_SMC3_euk Eukaryotic SMC3 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains.  Amino-acid sequence homology of SMC proteins between species is largely confined to the amino- and carboxy-terminal globular domains.  The amino-terminal domain contains a 'Walker A' nucleotide-binding domain (GxxGxGKS/T, in the single-letter amino-acid code), which by mutational studies has been shown to be essential in several proteins.  The carboxy-terminal domain contains a sequence (the DA-box) that resembles a 'Walker B' motif, and a motif with homology to the signature sequence of the ATP-binding cassette (ABC) family of ATPases.  The sequence homology within the carboxy-terminal domain is relatively high within the SMC1-SMC4 group, whereas SMC5 and SMC6 show some divergence in both of these sequences.  In eukaryotic cells, the proteins are found as heterodimers of SMC1 paired with SMC3, SMC2 with SMC4, and SMC5 with SMC6 (fo
Probab=83.46  E-value=0.55  Score=46.42  Aligned_cols=19  Identities=21%  Similarity=0.413  Sum_probs=16.4

Q ss_pred             CCCEEEEEecCCCCccccc
Q 008523          333 DGDVALFFGLSGTGKTTLS  351 (563)
Q Consensus       333 ~G~valfFGLSGTGKTTLs  351 (563)
                      ++...+|.|++|+|||||.
T Consensus        22 ~~~~~~i~GpNGsGKStll   40 (243)
T cd03272          22 SPKHNVVVGRNGSGKSNFF   40 (243)
T ss_pred             CCCcEEEECCCCCCHHHHH
Confidence            3668999999999999964


No 397
>PRK14263 phosphate ABC transporter ATP-binding protein; Provisional
Probab=83.42  E-value=0.59  Score=47.39  Aligned_cols=21  Identities=33%  Similarity=0.627  Sum_probs=18.8

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|..+++.|.+|+|||||..
T Consensus        32 ~~Ge~~~i~G~nGsGKSTLl~   52 (261)
T PRK14263         32 RKNEITGFIGPSGCGKSTVLR   52 (261)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            578899999999999999765


No 398
>PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional
Probab=83.41  E-value=0.57  Score=51.54  Aligned_cols=21  Identities=38%  Similarity=0.703  Sum_probs=18.8

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|+.+++.|+||+|||||..
T Consensus        27 ~~Ge~~~liG~nGsGKSTLl~   47 (490)
T PRK10938         27 NAGDSWAFVGANGSGKSALAR   47 (490)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            568999999999999999765


No 399
>PRK10751 molybdopterin-guanine dinucleotide biosynthesis protein B; Provisional
Probab=83.38  E-value=0.5  Score=46.03  Aligned_cols=18  Identities=44%  Similarity=0.470  Sum_probs=15.6

Q ss_pred             CEEEEEecCCCCcccccc
Q 008523          335 DVALFFGLSGTGKTTLST  352 (563)
Q Consensus       335 ~valfFGLSGTGKTTLsa  352 (563)
                      .++.|.|.||||||||..
T Consensus         7 ~ii~ivG~sgsGKTTLi~   24 (173)
T PRK10751          7 PLLAIAAWSGTGKTTLLK   24 (173)
T ss_pred             eEEEEECCCCChHHHHHH
Confidence            378999999999999765


No 400
>PRK10762 D-ribose transporter ATP binding protein; Provisional
Probab=83.31  E-value=0.56  Score=51.88  Aligned_cols=21  Identities=33%  Similarity=0.545  Sum_probs=18.7

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|+.+++.|+||+|||||..
T Consensus        28 ~~Ge~~~l~G~NGsGKSTLl~   48 (501)
T PRK10762         28 YPGRVMALVGENGAGKSTMMK   48 (501)
T ss_pred             cCCeEEEEECCCCCCHHHHHH
Confidence            568999999999999999754


No 401
>PRK10522 multidrug transporter membrane component/ATP-binding component; Provisional
Probab=83.28  E-value=0.58  Score=52.35  Aligned_cols=21  Identities=38%  Similarity=0.751  Sum_probs=19.1

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      +.|+.+++.|+||+|||||..
T Consensus       347 ~~G~~~aivG~sGsGKSTL~~  367 (547)
T PRK10522        347 KRGELLFLIGGNGSGKSTLAM  367 (547)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            678999999999999999765


No 402
>PRK06620 hypothetical protein; Validated
Probab=83.27  E-value=0.48  Score=47.15  Aligned_cols=18  Identities=39%  Similarity=0.379  Sum_probs=16.2

Q ss_pred             CEEEEEecCCCCcccccc
Q 008523          335 DVALFFGLSGTGKTTLST  352 (563)
Q Consensus       335 ~valfFGLSGTGKTTLsa  352 (563)
                      ..++|+|++|+|||+|..
T Consensus        45 ~~l~l~Gp~G~GKThLl~   62 (214)
T PRK06620         45 FTLLIKGPSSSGKTYLTK   62 (214)
T ss_pred             ceEEEECCCCCCHHHHHH
Confidence            569999999999999876


No 403
>PRK06526 transposase; Provisional
Probab=83.20  E-value=0.53  Score=48.20  Aligned_cols=20  Identities=40%  Similarity=0.679  Sum_probs=17.5

Q ss_pred             CCCEEEEEecCCCCcccccc
Q 008523          333 DGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       333 ~G~valfFGLSGTGKTTLsa  352 (563)
                      .+..++|.|++|||||+|+.
T Consensus        97 ~~~nlll~Gp~GtGKThLa~  116 (254)
T PRK06526         97 GKENVVFLGPPGTGKTHLAI  116 (254)
T ss_pred             cCceEEEEeCCCCchHHHHH
Confidence            45679999999999999877


No 404
>PRK14264 phosphate ABC transporter ATP-binding protein; Provisional
Probab=83.20  E-value=0.61  Score=48.48  Aligned_cols=21  Identities=33%  Similarity=0.531  Sum_probs=18.8

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|..+++.|++|+|||||..
T Consensus        69 ~~Ge~~~IvG~nGsGKSTLl~   89 (305)
T PRK14264         69 PEKSVTALIGPSGCGKSTFLR   89 (305)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            578999999999999999765


No 405
>PRK05537 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Validated
Probab=83.19  E-value=0.54  Score=53.58  Aligned_cols=22  Identities=45%  Similarity=0.750  Sum_probs=19.3

Q ss_pred             cCCCCEEEEEecCCCCcccccc
Q 008523          331 GKDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       331 g~~G~valfFGLSGTGKTTLsa  352 (563)
                      .+.|.+++|.|+|||||||++.
T Consensus       389 ~~~g~~Ivl~Gl~GSGKSTia~  410 (568)
T PRK05537        389 HKQGFTVFFTGLSGAGKSTIAK  410 (568)
T ss_pred             cCCCeEEEEECCCCChHHHHHH
Confidence            4567899999999999999876


No 406
>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair]
Probab=83.14  E-value=0.48  Score=50.10  Aligned_cols=18  Identities=56%  Similarity=0.840  Sum_probs=16.7

Q ss_pred             CEEEEEecCCCCcccccc
Q 008523          335 DVALFFGLSGTGKTTLST  352 (563)
Q Consensus       335 ~valfFGLSGTGKTTLsa  352 (563)
                      |-++|||+.|.|||||++
T Consensus        53 DHvLl~GPPGlGKTTLA~   70 (332)
T COG2255          53 DHVLLFGPPGLGKTTLAH   70 (332)
T ss_pred             CeEEeeCCCCCcHHHHHH
Confidence            679999999999999987


No 407
>cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase. It is a homohexamer. Each monomer consists of an N-terminal domain of the OB fold, which is responsible for binding to cysteine rich nucleotides. This alignment is of the C-terminal ATP binding domain.
Probab=83.05  E-value=0.56  Score=48.01  Aligned_cols=20  Identities=35%  Similarity=0.441  Sum_probs=17.9

Q ss_pred             CCCEEEEEecCCCCcccccc
Q 008523          333 DGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       333 ~G~valfFGLSGTGKTTLsa  352 (563)
                      .|..++|||++|+|||||..
T Consensus        15 ~Gqr~~I~G~~G~GKTTLlr   34 (249)
T cd01128          15 KGQRGLIVAPPKAGKTTLLQ   34 (249)
T ss_pred             CCCEEEEECCCCCCHHHHHH
Confidence            57789999999999999765


No 408
>PRK13947 shikimate kinase; Provisional
Probab=83.04  E-value=0.55  Score=43.75  Aligned_cols=28  Identities=32%  Similarity=0.465  Sum_probs=20.0

Q ss_pred             EEEEEecCCCCcccccc----cCCCceeecCc
Q 008523          336 VALFFGLSGTGKTTLST----DHNRYLIGDDE  363 (563)
Q Consensus       336 valfFGLSGTGKTTLsa----d~~r~lIgDDe  363 (563)
                      .+++.|++||||||++.    .-+..+|..|.
T Consensus         3 ~I~l~G~~GsGKst~a~~La~~lg~~~id~d~   34 (171)
T PRK13947          3 NIVLIGFMGTGKTTVGKRVATTLSFGFIDTDK   34 (171)
T ss_pred             eEEEEcCCCCCHHHHHHHHHHHhCCCEEECch
Confidence            48999999999999876    22344555553


No 409
>PRK09700 D-allose transporter ATP-binding protein; Provisional
Probab=82.91  E-value=0.61  Score=51.66  Aligned_cols=21  Identities=33%  Similarity=0.635  Sum_probs=18.9

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|..+++.|+||+|||||..
T Consensus        29 ~~Ge~~~liG~nGsGKSTLl~   49 (510)
T PRK09700         29 YPGEIHALLGENGAGKSTLMK   49 (510)
T ss_pred             cCCcEEEEECCCCCCHHHHHH
Confidence            578999999999999999765


No 410
>cd03240 ABC_Rad50 The catalytic domains of Rad50 are similar to the ATP-binding cassette of ABC transporters, but are not associated with membrane-spanning domains.  The conserved ATP-binding motifs common to Rad50 and the ABC transporter family include the Walker A and Walker B motifs, the Q loop, a histidine residue in the switch region, a D-loop, and a conserved LSGG sequence.  This conserved sequence, LSGG, is the most specific and characteristic motif of this family and is thus known as the ABC signature sequence.
Probab=82.89  E-value=0.71  Score=45.32  Aligned_cols=17  Identities=41%  Similarity=0.712  Sum_probs=15.4

Q ss_pred             EEEEEecCCCCcccccc
Q 008523          336 VALFFGLSGTGKTTLST  352 (563)
Q Consensus       336 valfFGLSGTGKTTLsa  352 (563)
                      +.++.|++|+|||||..
T Consensus        24 ~~~i~G~NGsGKTTLl~   40 (204)
T cd03240          24 LTLIVGQNGAGKTTIIE   40 (204)
T ss_pred             eEEEECCCCCCHHHHHH
Confidence            89999999999999654


No 411
>KOG0057 consensus Mitochondrial Fe/S cluster exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport]
Probab=82.86  E-value=0.38  Score=54.43  Aligned_cols=66  Identities=18%  Similarity=0.338  Sum_probs=38.5

Q ss_pred             CCCCEEEEEecCCCCcccccc------cCCCceeecCceeecCCCccccCCceeEeecCCCCCCCchhhhhccccceeee
Q 008523          332 KDGDVALFFGLSGTGKTTLST------DHNRYLIGDDEHCWGDNGVSNIEGGCYAKCIDLSREKEPDIWNAIKFGAVLEN  405 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa------d~~r~lIgDDe~~w~~~Gvfn~EgGcyaK~~dLs~e~EP~I~~ai~f~ailEN  405 (563)
                      +.|+.+++.|.|||||||+..      |....+.-|..-+|.      .+....-++|++-|.+- .+|+    ++|++|
T Consensus       376 ~kGekVaIvG~nGsGKSTilr~LlrF~d~sG~I~IdG~dik~------~~~~SlR~~Ig~VPQd~-~LFn----dTIl~N  444 (591)
T KOG0057|consen  376 PKGEKVAIVGSNGSGKSTILRLLLRFFDYSGSILIDGQDIKE------VSLESLRQSIGVVPQDS-VLFN----DTILYN  444 (591)
T ss_pred             cCCCEEEEECCCCCCHHHHHHHHHHHhccCCcEEECCeeHhh------hChHHhhhheeEeCCcc-cccc----hhHHHH
Confidence            568899999999999999654      544445445443433      22333445555555222 2333    466666


Q ss_pred             eEE
Q 008523          406 VVF  408 (563)
Q Consensus       406 V~~  408 (563)
                      |.+
T Consensus       445 I~Y  447 (591)
T KOG0057|consen  445 IKY  447 (591)
T ss_pred             hhc
Confidence            544


No 412
>COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only]
Probab=82.86  E-value=0.59  Score=52.95  Aligned_cols=21  Identities=38%  Similarity=0.699  Sum_probs=19.4

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|.+..+.|.||||||||+.
T Consensus       315 ~~GE~lglVGeSGsGKSTlar  335 (539)
T COG1123         315 REGETLGLVGESGSGKSTLAR  335 (539)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            679999999999999999875


No 413
>cd04160 Arfrp1 Arfrp1 subfamily.  Arfrp1 (Arf-related protein 1), formerly known as ARP, is a membrane-associated Arf family member that lacks the N-terminal myristoylation motif.  Arfrp1 is mainly associated with the trans-Golgi compartment and the trans-Golgi network, where it regulates the targeting of Arl1 and the GRIP domain-containing proteins, golgin-97 and golgin-245, onto Golgi membranes.  It is also involved in the anterograde transport of the vesicular stomatitis virus G protein from the Golgi to the plasma membrane, and in the retrograde transport of TGN38 and Shiga toxin from endosomes to the trans-Golgi network.  Arfrp1 also inhibits Arf/Sec7-dependent activation of phospholipase D.  Deletion of Arfrp1 in mice causes embryonic lethality at the gastrulation stage and apoptosis of mesodermal cells, indicating its importance in development.
Probab=82.82  E-value=0.57  Score=42.67  Aligned_cols=16  Identities=44%  Similarity=0.704  Sum_probs=14.4

Q ss_pred             EEEEecCCCCcccccc
Q 008523          337 ALFFGLSGTGKTTLST  352 (563)
Q Consensus       337 alfFGLSGTGKTTLsa  352 (563)
                      ++|.|++|+|||||..
T Consensus         2 i~~vG~~~~GKstLi~   17 (167)
T cd04160           2 VLILGLDNAGKTTFLE   17 (167)
T ss_pred             EEEEecCCCCHHHHHH
Confidence            6899999999999865


No 414
>PRK13537 nodulation ABC transporter NodI; Provisional
Probab=82.80  E-value=0.63  Score=48.56  Aligned_cols=21  Identities=33%  Similarity=0.499  Sum_probs=18.6

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      +.|..+.+.|++|+|||||..
T Consensus        31 ~~Gei~gllGpNGaGKSTLl~   51 (306)
T PRK13537         31 QRGECFGLLGPNGAGKTTTLR   51 (306)
T ss_pred             eCCcEEEEECCCCCCHHHHHH
Confidence            568999999999999999654


No 415
>TIGR00231 small_GTP small GTP-binding protein domain. This model recognizes a large number of small GTP-binding proteins and related domains in larger proteins. Note that the alpha chains of heterotrimeric G proteins are larger proteins in which the NKXD motif is separated from the GxxxxGK[ST] motif (P-loop) by a long insert and are not easily detected by this model.
Probab=82.80  E-value=0.6  Score=40.53  Aligned_cols=17  Identities=29%  Similarity=0.393  Sum_probs=15.1

Q ss_pred             EEEEEecCCCCcccccc
Q 008523          336 VALFFGLSGTGKTTLST  352 (563)
Q Consensus       336 valfFGLSGTGKTTLsa  352 (563)
                      .+++.|.+|+|||||..
T Consensus         3 ki~~~G~~~~GKstl~~   19 (161)
T TIGR00231         3 KIVIVGDPNVGKSTLLN   19 (161)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            58999999999999765


No 416
>PRK12288 GTPase RsgA; Reviewed
Probab=82.77  E-value=2  Score=46.12  Aligned_cols=19  Identities=42%  Similarity=0.872  Sum_probs=17.1

Q ss_pred             CCEEEEEecCCCCcccccc
Q 008523          334 GDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       334 G~valfFGLSGTGKTTLsa  352 (563)
                      +.+++|.|.||+|||||..
T Consensus       205 ~ki~~~vG~sgVGKSTLiN  223 (347)
T PRK12288        205 GRISIFVGQSGVGKSSLIN  223 (347)
T ss_pred             hCCEEEECCCCCCHHHHHH
Confidence            5679999999999999876


No 417
>PRK09700 D-allose transporter ATP-binding protein; Provisional
Probab=82.77  E-value=0.62  Score=51.60  Aligned_cols=21  Identities=38%  Similarity=0.650  Sum_probs=18.8

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|+.+++.|++|+|||||..
T Consensus       287 ~~Ge~~~l~G~NGsGKSTLlk  307 (510)
T PRK09700        287 CRGEILGFAGLVGSGRTELMN  307 (510)
T ss_pred             cCCcEEEEECCCCCCHHHHHH
Confidence            568999999999999999765


No 418
>TIGR01351 adk adenylate kinases. Adenylate kinase (EC 2.7.4.3) converts ATP + AMP to ADP + ADP, that is, uses ATP as a phosphate donor for AMP. Most members of this family are known or believed to be adenylate kinase. However, some members accept other nucleotide triphosphates as donors, may be unable to use ATP, and may fail to complement adenylate kinase mutants. An example of a nucleoside-triphosphate--adenylate kinase (EC 2.7.4.10) is a GTP:AMP phosphotransferase. This family is designated subfamily rather than equivalog for this reason.
Probab=82.77  E-value=0.51  Score=46.10  Aligned_cols=16  Identities=31%  Similarity=0.588  Sum_probs=14.7

Q ss_pred             EEEEecCCCCcccccc
Q 008523          337 ALFFGLSGTGKTTLST  352 (563)
Q Consensus       337 alfFGLSGTGKTTLsa  352 (563)
                      ++++|++|+||||++.
T Consensus         2 I~i~G~pGsGKsT~a~   17 (210)
T TIGR01351         2 LVLLGPPGSGKGTQAK   17 (210)
T ss_pred             EEEECCCCCCHHHHHH
Confidence            7899999999999876


No 419
>cd01131 PilT Pilus retraction ATPase PilT. PilT is a nucleotide binding protein responsible for the retraction of type IV pili, likely by pili disassembly. This retraction provides the force required for travel of bacteria in low water environments by a mechanism known as twitching motility.
Probab=82.75  E-value=0.54  Score=45.87  Aligned_cols=17  Identities=35%  Similarity=0.563  Sum_probs=14.9

Q ss_pred             EEEEEecCCCCcccccc
Q 008523          336 VALFFGLSGTGKTTLST  352 (563)
Q Consensus       336 valfFGLSGTGKTTLsa  352 (563)
                      .++|.|++|+||||+..
T Consensus         3 lilI~GptGSGKTTll~   19 (198)
T cd01131           3 LVLVTGPTGSGKSTTLA   19 (198)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            58999999999999655


No 420
>PF09439 SRPRB:  Signal recognition particle receptor beta subunit;  InterPro: IPR019009  The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ]. SRP recognises the signal sequence of the nascent polypeptide on the ribosome, retards its elongation, and docks the SRP-ribosome-polypeptide complex to the RER membrane via the SR receptor. Eukaryotic SRP consists of six polypeptides (SRP9, SRP14, SRP19, SRP54, SRP68 and SRP72) and a single 300 nucleotide 7S RNA molecule. The RNA component catalyses the interaction of SRP with its SR receptor []. In higher eukaryotes, the SRP complex consists of the Alu domain and the S domain linked by the SRP RNA. The Alu domain consists of a heterodimer of SRP9 and SRP14 bound to the 5' and 3' terminal sequences of SRP RNA. This domain is necessary for retarding the elongation of the nascent polypeptide chain, which gives SRP time to dock the ribosome-polypeptide complex to the RER membrane. In archaea, the SRP complex contains 7S RNA like its eukaryotic counterpart, yet only includes two of the six protein subunits found in the eukarytic complex: SRP19 and SRP54 []. The SR receptor is a monomer consisting of the loosely membrane-associated SR-alpha homologue FtsY, while the eukaryotic SR receptor is a heterodimer of SR-alpha (70 kDa) and SR-beta (25 kDa), both of which contain a GTP-binding domain []. SR-alpha regulates the targeting of SRP-ribosome-nascent polypeptide complexes to the translocon []. SR-alpha binds to the SRP54 subunit of the SRP complex. The SR-beta subunit is a transmembrane GTPase that anchors the SR-alpha subunit (a peripheral membrane GTPase) to the ER membrane []. SR-beta interacts with the N-terminal SRX-domain of SR-alpha, which is not present in the bacterial FtsY homologue. SR-beta also functions in recruiting the SRP-nascent polypeptide to the protein-conducting channel.   The beta subunit of the signal recognition particle receptor (SRP) is a transmembrane GTPase, which anchors the alpha subunit to the endoplasmic reticulum membrane []. ; PDB: 2GED_B 1NRJ_B 2GO5_2 2FH5_B.
Probab=82.60  E-value=0.62  Score=45.79  Aligned_cols=19  Identities=42%  Similarity=0.609  Sum_probs=14.2

Q ss_pred             CCEEEEEecCCCCcccccc
Q 008523          334 GDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       334 G~valfFGLSGTGKTTLsa  352 (563)
                      ..++++.||||+|||+|-.
T Consensus         3 ~~~vlL~Gps~SGKTaLf~   21 (181)
T PF09439_consen    3 RPTVLLVGPSGSGKTALFS   21 (181)
T ss_dssp             --EEEEE-STTSSHHHHHH
T ss_pred             CceEEEEcCCCCCHHHHHH
Confidence            4579999999999999654


No 421
>TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2. The enzyme that catalyzes the final step in methanogenesis, methyl coenzyme M reductase, contains alpha, beta, and gamma chains. In older literature, the complex of alpha, beta, and gamma chains was termed component C, while this single chain protein was termed methyl coenzyme M reductase system component A2.
Probab=82.57  E-value=0.65  Score=51.55  Aligned_cols=21  Identities=52%  Similarity=0.770  Sum_probs=19.0

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|+.+++.|+||+|||||..
T Consensus       308 ~~Ge~~~l~G~NGsGKSTLl~  328 (520)
T TIGR03269       308 KEGEIFGIVGTSGAGKTTLSK  328 (520)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            578999999999999999765


No 422
>TIGR03522 GldA_ABC_ATP gliding motility-associated ABC transporter ATP-binding subunit GldA. Members of this protein family are exclusive to the Bacteroidetes phylum (previously Cytophaga-Flavobacteria-Bacteroides). GldA is an ABC transporter ATP-binding protein (pfam00005) linked to a type of rapid surface gliding motility found in certain Bacteroidetes, such as Flavobacterium johnsoniae and Cytophaga hutchinsonii. Knockouts of GldA abolish the gliding phenotype. Gliding motility appears closely linked to chitin utilization in the model species Flavobacterium johnsoniae. Bacteroidetes with members of this protein family appear to have all of the genes associated with gliding motility.
Probab=82.49  E-value=0.63  Score=48.25  Aligned_cols=21  Identities=33%  Similarity=0.631  Sum_probs=18.7

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|..+++.|++|+|||||..
T Consensus        26 ~~Gei~~l~G~NGaGKTTLl~   46 (301)
T TIGR03522        26 QKGRIVGFLGPNGAGKSTTMK   46 (301)
T ss_pred             eCCeEEEEECCCCCCHHHHHH
Confidence            578999999999999999654


No 423
>PF00025 Arf:  ADP-ribosylation factor family The prints entry specific to Sar1 proteins The Prosite entry specific to Sar1 proteins;  InterPro: IPR006689 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases. This superfamily contains proteins that control a vast number of important processes and possess a common, structurally preserved GTP-binding domain [, ]. Sequence comparisons of small G proteins from various species have revealed that they are conserved in primary structures at the level of 30-55% similarity []. Crystallographic analysis of various small G proteins revealed the presence of a 20 kDa catalytic domain that is unique for the whole superfamily [, ]. The domain is built of five alpha helices (A1-A5), six beta-strands (B1-B6) and five polypeptide loops (G1-G5). A structural comparison of the GTP- and GDP-bound form, allows one to distinguish two functional loop regions: switch I and switch II that surround the gamma-phosphate group of the nucleotide. The G1 loop (also called the P-loop) that connects the B1 strand and the A1 helix is responsible for the binding of the phosphate groups. The G3 loop provides residues for Mg(2+) and phosphate binding and is located at the N terminus of the A2 helix. The G1 and G3 loops are sequentially similar to Walker A and Walker B boxes that are found in other nucleotide binding motifs. The G2 loop connects the A1 helix and the B2 strand and contains a conserved Thr residue responsible for Mg(2+) binding. The guanine base is recognised by the G4 and G5 loops. The consensus sequence NKXD of the G4 loop contains Lys and Asp residues directly interacting with the nucleotide. Part of the G5 loop located between B6 and A5 acts as a recognition site for the guanine base []. The small GTPase superfamily can be divided into at least 8 different families, including:  Arf small GTPases. GTP-binding proteins involved in protein trafficking by modulating vesicle budding and uncoating within the Golgi apparatus. Ran small GTPases. GTP-binding proteins involved in nucleocytoplasmic transport. Required for the import of proteins into the nucleus and also for RNA export. Rab small GTPases. GTP-binding proteins involved in vesicular traffic. Rho small GTPases. GTP-binding proteins that control cytoskeleton reorganisation. Ras small GTPases. GTP-binding proteins involved in signalling pathways. Sar1 small GTPases. Small GTPase component of the coat protein complex II (COPII) which promotes the formation of transport vesicles from the endoplasmic reticulum (ER). Mitochondrial Rho (Miro). Small GTPase domain found in mitochondrial proteins involved in mitochondrial trafficking. Roc small GTPases domain. Small GTPase domain always found associated with the COR domain.  This entry represents a branch of the small GTPase superfamily that includes the ADP ribosylation factor Arf, Arl (Arf-like), Arp (Arf-related proteins) and the remotely related Sar (Secretion-associated and Ras-related) proteins. Arf proteins are major regulators of vesicle biogenesis in intracellular traffic []. They cycle between inactive GDP-bound and active GTP-bound forms that bind selectively to effectors. The classical structural GDP/GTP switch is characterised by conformational changes at the so-called switch 1 and switch 2 regions, which bind tightly to the gamma-phosphate of GTP but poorly or not at all to the GDP nucleotide. Structural studies of Arf1 and Arf6 have revealed that although these proteins feature the switch 1 and 2 conformational changes, they depart from other small GTP-binding proteins in that they use an additional, unique switch to propagate structural information from one side of the protein to the other.   The GDP/GTP structural cycles of human Arf1 and Arf6 feature a unique conformational change that affects the beta2-beta3 strands connecting switch 1 and switch 2 (interswitch) and also the amphipathic helical N terminus. In GDP-bound Arf1 and Arf6, the interswitch is retracted and forms a pocket to which the N-terminal helix binds, the latter serving as a molecular hasp to maintain the inactive conformation. In the GTP-bound form of these proteins, the interswitch undergoes a two-residue register shift that pulls switch 1 and switch 2 up, restoring an active conformation that can bind GTP. In this conformation, the interswitch projects out of the protein and extrudes the N-terminal hasp by occluding its binding pocket.; GO: 0005525 GTP binding; PDB: 2H57_B 2W83_B 3N5C_B 2J5X_A 3LVR_E 2BAO_A 3LVQ_E 2A5F_A 3PCR_B 1E0S_A ....
Probab=82.49  E-value=0.67  Score=43.97  Aligned_cols=19  Identities=47%  Similarity=0.637  Sum_probs=16.4

Q ss_pred             CCEEEEEecCCCCcccccc
Q 008523          334 GDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       334 G~valfFGLSGTGKTTLsa  352 (563)
                      ...++|+||.|+|||||..
T Consensus        14 ~~~ililGl~~sGKTtll~   32 (175)
T PF00025_consen   14 EIKILILGLDGSGKTTLLN   32 (175)
T ss_dssp             EEEEEEEESTTSSHHHHHH
T ss_pred             EEEEEEECCCccchHHHHH
Confidence            3469999999999999766


No 424
>PRK08903 DnaA regulatory inactivator Hda; Validated
Probab=82.46  E-value=0.61  Score=45.78  Aligned_cols=19  Identities=21%  Similarity=0.503  Sum_probs=16.9

Q ss_pred             CCEEEEEecCCCCcccccc
Q 008523          334 GDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       334 G~valfFGLSGTGKTTLsa  352 (563)
                      +..++|+|.+|||||+|+.
T Consensus        42 ~~~~~l~G~~G~GKT~La~   60 (227)
T PRK08903         42 DRFFYLWGEAGSGRSHLLQ   60 (227)
T ss_pred             CCeEEEECCCCCCHHHHHH
Confidence            4579999999999999876


No 425
>PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional
Probab=82.43  E-value=0.63  Score=51.82  Aligned_cols=21  Identities=29%  Similarity=0.537  Sum_probs=18.6

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|..+++.|+||+|||||..
T Consensus        33 ~~Ge~~~iiG~nGsGKSTLl~   53 (529)
T PRK15134         33 EAGETLALVGESGSGKSVTAL   53 (529)
T ss_pred             eCCCEEEEECCCCCcHHHHHH
Confidence            568999999999999999744


No 426
>PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional
Probab=82.41  E-value=0.65  Score=51.16  Aligned_cols=21  Identities=29%  Similarity=0.532  Sum_probs=18.9

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|+.+++.|+||+|||||..
T Consensus        22 ~~Ge~~~liG~nGsGKSTLl~   42 (491)
T PRK10982         22 RPHSIHALMGENGAGKSTLLK   42 (491)
T ss_pred             cCCcEEEEECCCCCCHHHHHH
Confidence            578999999999999999764


No 427
>cd03291 ABCC_CFTR1 The CFTR subfamily domain 1.  The cystic fibrosis transmembrane regulator (CFTR), the product of the gene mutated in patients with cystic fibrosis, has adapted the ABC transporter structural motif to form a tightly regulated anion channel at the apical surface of many epithelia.  Use of the term assembly of a functional ion channel implies the coming together of subunits, or at least smaller not-yet functional components of the active whole.  In fact, on the basis of current knowledge only the CFTR polypeptide itself is required to form an ATP- and protein kinase A-dependent low-conductance chloride channel of the type present in the apical membrane of many epithelial cells.  CFTR displays the typical organization (IM-ABC)2 and carries a characteristic hydrophilic R-domain that separates IM1-ABC1 from IM2-ABC2.
Probab=82.35  E-value=0.69  Score=47.89  Aligned_cols=21  Identities=33%  Similarity=0.607  Sum_probs=18.8

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|..+++.|.+|+|||||..
T Consensus        61 ~~Ge~~~liG~NGsGKSTLl~   81 (282)
T cd03291          61 EKGEMLAITGSTGSGKTSLLM   81 (282)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            568899999999999999765


No 428
>PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional
Probab=82.33  E-value=0.67  Score=51.02  Aligned_cols=21  Identities=33%  Similarity=0.523  Sum_probs=18.9

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|+.+++.|+||+|||||..
T Consensus       284 ~~Ge~~~i~G~NGsGKSTLl~  304 (490)
T PRK10938        284 NPGEHWQIVGPNGAGKSTLLS  304 (490)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            578999999999999999765


No 429
>cd03289 ABCC_CFTR2 The CFTR subfamily domain 2.  The cystic fibrosis transmembrane regulator (CFTR), the product of the gene mutated in patients with cystic fibrosis, has adapted the ABC transporter structural motif to form a tightly regulated anion channel at the apical surface of many epithelia.  Use of the term assembly of a functional ion channel implies the coming together of subunits or at least smaller not-yet functional components of the active whole.  In fact, on the basis of current knowledge only the CFTR polypeptide itself is required to form an ATP- and protein kinase A-dependent low-conductance chloride channel of the type present in the apical membrane of many epithelial cells.  CFTR displays the typical organization (IM-ABC)2 and carries a characteristic hydrophilic R-domain that separates IM1-ABC1 from IM2-ABC2.
Probab=82.30  E-value=0.7  Score=47.70  Aligned_cols=21  Identities=33%  Similarity=0.569  Sum_probs=19.1

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      +.|..+++.|++|+|||||..
T Consensus        28 ~~Ge~~~IvG~nGsGKSTLl~   48 (275)
T cd03289          28 SPGQRVGLLGRTGSGKSTLLS   48 (275)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            678999999999999999765


No 430
>PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional
Probab=82.28  E-value=0.67  Score=51.65  Aligned_cols=21  Identities=33%  Similarity=0.533  Sum_probs=19.0

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|+.+++.|+||+|||||..
T Consensus       310 ~~Ge~~~i~G~nGsGKSTLlk  330 (529)
T PRK15134        310 RPGETLGLVGESGSGKSTTGL  330 (529)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            678999999999999999765


No 431
>TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein. Several bacterial species have enzymes xylose isomerase and xylulokinase enzymes for xylose utilization. Members of this protein family are the ATP-binding cassette (ABC) subunit of the known or predicted high-affinity xylose ABC transporter for xylose import. These genes, which closely resemble other sugar transport ABC transporter genes, typically are encoded near xylose utilization enzymes and regulatory proteins. Note that this form of the transporter contains two copies of the ABC transporter domain (pfam00005).
Probab=82.25  E-value=0.65  Score=51.21  Aligned_cols=21  Identities=33%  Similarity=0.582  Sum_probs=18.8

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|+.+++.|+||+|||||..
T Consensus        25 ~~Ge~~~liG~nGsGKSTLl~   45 (500)
T TIGR02633        25 RPGECVGLCGENGAGKSTLMK   45 (500)
T ss_pred             eCCcEEEEECCCCCCHHHHHH
Confidence            568999999999999999765


No 432
>PF13173 AAA_14:  AAA domain
Probab=82.22  E-value=0.73  Score=41.50  Aligned_cols=20  Identities=35%  Similarity=0.569  Sum_probs=17.8

Q ss_pred             CCCEEEEEecCCCCcccccc
Q 008523          333 DGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       333 ~G~valfFGLSGTGKTTLsa  352 (563)
                      |+.++++.|+-|+|||||..
T Consensus         1 n~~~~~l~G~R~vGKTtll~   20 (128)
T PF13173_consen    1 NRKIIILTGPRGVGKTTLLK   20 (128)
T ss_pred             CCCeEEEECCCCCCHHHHHH
Confidence            46789999999999999875


No 433
>PRK03731 aroL shikimate kinase II; Reviewed
Probab=82.21  E-value=0.61  Score=43.63  Aligned_cols=31  Identities=23%  Similarity=0.363  Sum_probs=21.1

Q ss_pred             CEEEEEecCCCCcccccc----cCCCceeecCcee
Q 008523          335 DVALFFGLSGTGKTTLST----DHNRYLIGDDEHC  365 (563)
Q Consensus       335 ~valfFGLSGTGKTTLsa----d~~r~lIgDDe~~  365 (563)
                      ..++|.|++||||||++.    ..+..++.-|+..
T Consensus         3 ~~i~~~G~~GsGKst~~~~la~~lg~~~~d~D~~~   37 (171)
T PRK03731          3 QPLFLVGARGCGKTTVGMALAQALGYRFVDTDQWL   37 (171)
T ss_pred             CeEEEECCCCCCHHHHHHHHHHHhCCCEEEccHHH
Confidence            358889999999999876    2234455545433


No 434
>PF13481 AAA_25:  AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C.
Probab=82.18  E-value=0.72  Score=43.64  Aligned_cols=21  Identities=43%  Similarity=0.713  Sum_probs=18.0

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|...+|+|.+|+||||++.
T Consensus        30 ~~g~l~~i~g~~g~GKT~~~~   50 (193)
T PF13481_consen   30 PRGELTLIAGPPGSGKTTLAL   50 (193)
T ss_dssp             -TTSEEEEEECSTSSHHHHHH
T ss_pred             cCCeEEEEEeCCCCCHHHHHH
Confidence            457899999999999999766


No 435
>PRK09270 nucleoside triphosphate hydrolase domain-containing protein; Reviewed
Probab=82.17  E-value=0.59  Score=46.41  Aligned_cols=19  Identities=32%  Similarity=0.478  Sum_probs=16.7

Q ss_pred             CCEEEEEecCCCCcccccc
Q 008523          334 GDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       334 G~valfFGLSGTGKTTLsa  352 (563)
                      ...+.+-|+||+|||||+.
T Consensus        33 ~~iigi~G~~GsGKTTl~~   51 (229)
T PRK09270         33 RTIVGIAGPPGAGKSTLAE   51 (229)
T ss_pred             CEEEEEECCCCCCHHHHHH
Confidence            4679999999999999776


No 436
>CHL00095 clpC Clp protease ATP binding subunit
Probab=82.16  E-value=1.7  Score=51.53  Aligned_cols=17  Identities=47%  Similarity=0.688  Sum_probs=15.2

Q ss_pred             EEEEEecCCCCcccccc
Q 008523          336 VALFFGLSGTGKTTLST  352 (563)
Q Consensus       336 valfFGLSGTGKTTLsa  352 (563)
                      +.+|.|++|+|||+|+.
T Consensus       541 ~~lf~Gp~GvGKt~lA~  557 (821)
T CHL00095        541 SFLFSGPTGVGKTELTK  557 (821)
T ss_pred             EEEEECCCCCcHHHHHH
Confidence            47899999999999875


No 437
>COG0572 Udk Uridine kinase [Nucleotide transport and metabolism]
Probab=82.10  E-value=0.72  Score=46.72  Aligned_cols=18  Identities=39%  Similarity=0.429  Sum_probs=15.9

Q ss_pred             CEEEEEecCCCCcccccc
Q 008523          335 DVALFFGLSGTGKTTLST  352 (563)
Q Consensus       335 ~valfFGLSGTGKTTLsa  352 (563)
                      ..+.+-|.|||||||++.
T Consensus         9 iiIgIaG~SgSGKTTva~   26 (218)
T COG0572           9 IIIGIAGGSGSGKTTVAK   26 (218)
T ss_pred             EEEEEeCCCCCCHHHHHH
Confidence            468999999999999876


No 438
>PRK07667 uridine kinase; Provisional
Probab=82.08  E-value=0.6  Score=45.27  Aligned_cols=18  Identities=39%  Similarity=0.357  Sum_probs=16.0

Q ss_pred             CEEEEEecCCCCcccccc
Q 008523          335 DVALFFGLSGTGKTTLST  352 (563)
Q Consensus       335 ~valfFGLSGTGKTTLsa  352 (563)
                      .++.+-|.||+||||++.
T Consensus        18 ~iIgI~G~~gsGKStla~   35 (193)
T PRK07667         18 FILGIDGLSRSGKTTFVA   35 (193)
T ss_pred             EEEEEECCCCCCHHHHHH
Confidence            468999999999999876


No 439
>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated
Probab=82.05  E-value=0.6  Score=52.30  Aligned_cols=20  Identities=40%  Similarity=0.632  Sum_probs=17.8

Q ss_pred             CCCEEEEEecCCCCcccccc
Q 008523          333 DGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       333 ~G~valfFGLSGTGKTTLsa  352 (563)
                      .|.+++|.|++|+||||+.+
T Consensus       255 ~g~Vi~LvGpnGvGKTTTia  274 (484)
T PRK06995        255 RGGVFALMGPTGVGKTTTTA  274 (484)
T ss_pred             CCcEEEEECCCCccHHHHHH
Confidence            46799999999999999766


No 440
>PRK14490 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobB/MobA; Provisional
Probab=82.03  E-value=0.68  Score=49.60  Aligned_cols=20  Identities=50%  Similarity=0.551  Sum_probs=17.5

Q ss_pred             CCCEEEEEecCCCCcccccc
Q 008523          333 DGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       333 ~G~valfFGLSGTGKTTLsa  352 (563)
                      .|-++.|.|+||||||||..
T Consensus         4 ~~~~i~i~G~~gsGKTTl~~   23 (369)
T PRK14490          4 HPFEIAFCGYSGSGKTTLIT   23 (369)
T ss_pred             CCEEEEEEeCCCCCHHHHHH
Confidence            46689999999999999865


No 441
>cd04156 ARLTS1 ARLTS1 subfamily.  ARLTS1 (Arf-like tumor suppressor gene 1), also known as Arl11, is a member of the Arf family of small GTPases that is believed to play a major role in apoptotic signaling.  ARLTS1 is widely expressed and functions as a tumor suppressor gene in several human cancers.  ARLTS1 is a low-penetrance suppressor that accounts for a small percentage of familial melanoma or familial chronic lymphocytic leukemia (CLL).  ARLTS1 inactivation seems to occur most frequently through biallelic down-regulation by hypermethylation of the promoter.  In breast cancer, ARLTS1 alterations were typically a combination of a hypomorphic polymorphism plus loss of heterozygosity.  In a case of thyroid adenoma, ARLTS1 alterations were polymorphism plus promoter hypermethylation.  The nonsense polymorphism Trp149Stop occurs with significantly greater frequency in familial cancer cases than in sporadic cancer cases, and the Cys148Arg polymorphism is associated with an increase in h
Probab=82.02  E-value=0.62  Score=42.13  Aligned_cols=16  Identities=44%  Similarity=0.708  Sum_probs=14.3

Q ss_pred             EEEEecCCCCcccccc
Q 008523          337 ALFFGLSGTGKTTLST  352 (563)
Q Consensus       337 alfFGLSGTGKTTLsa  352 (563)
                      ++|.|++|+|||||..
T Consensus         2 i~i~G~~~~GKTsl~~   17 (160)
T cd04156           2 VLLLGLDSAGKSTLLY   17 (160)
T ss_pred             EEEEcCCCCCHHHHHH
Confidence            6899999999999765


No 442
>TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family. Members of this protein family are archaeal single-domain KaiC_related proteins, homologous to the Cyanobacterial circadian clock cycle protein KaiC, an autokinase/autophosphorylase that has two copies of the domain.
Probab=81.83  E-value=0.7  Score=45.36  Aligned_cols=21  Identities=33%  Similarity=0.381  Sum_probs=18.6

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      +.|..+++.|.+|||||||+.
T Consensus        18 ~~G~~~~i~G~~G~GKT~l~~   38 (229)
T TIGR03881        18 PRGFFVAVTGEPGTGKTIFCL   38 (229)
T ss_pred             cCCeEEEEECCCCCChHHHHH
Confidence            457899999999999999875


No 443
>COG1122 CbiO ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism]
Probab=81.82  E-value=0.76  Score=46.77  Aligned_cols=21  Identities=38%  Similarity=0.718  Sum_probs=19.1

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      +.|..+++.|.+|+|||||..
T Consensus        28 ~~Ge~~~i~G~nGsGKSTL~~   48 (235)
T COG1122          28 EKGERVLLIGPNGSGKSTLLK   48 (235)
T ss_pred             CCCCEEEEECCCCCCHHHHHH
Confidence            678999999999999999765


No 444
>PRK13549 xylose transporter ATP-binding subunit; Provisional
Probab=81.81  E-value=0.7  Score=51.19  Aligned_cols=21  Identities=33%  Similarity=0.626  Sum_probs=19.0

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|+.+++.|++|+|||||..
T Consensus       286 ~~Ge~~~l~G~NGsGKSTLlk  306 (506)
T PRK13549        286 RRGEILGIAGLVGAGRTELVQ  306 (506)
T ss_pred             cCCcEEEEeCCCCCCHHHHHH
Confidence            678999999999999999765


No 445
>TIGR02203 MsbA_lipidA lipid A export permease/ATP-binding protein MsbA. This family consists of a single polypeptide chain transporter in the ATP-binding cassette (ABC) transporter family, MsbA, which exports lipid A. It may also act in multidrug resistance. Lipid A, a part of lipopolysaccharide, is found in the outer leaflet of the outer membrane of most Gram-negative bacteria. Members of this family are restricted to the Proteobacteria (although lipid A is more broadly distributed) and often are clustered with lipid A biosynthesis genes.
Probab=81.78  E-value=0.72  Score=51.39  Aligned_cols=21  Identities=38%  Similarity=0.680  Sum_probs=18.8

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      +.|+.+++.|.||+|||||..
T Consensus       356 ~~G~~v~IvG~sGsGKSTLl~  376 (571)
T TIGR02203       356 EPGETVALVGRSGSGKSTLVN  376 (571)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            568899999999999999765


No 446
>PRK04182 cytidylate kinase; Provisional
Probab=81.76  E-value=0.63  Score=43.21  Aligned_cols=17  Identities=35%  Similarity=0.579  Sum_probs=15.2

Q ss_pred             EEEEEecCCCCcccccc
Q 008523          336 VALFFGLSGTGKTTLST  352 (563)
Q Consensus       336 valfFGLSGTGKTTLsa  352 (563)
                      ++++.|.+||||||++.
T Consensus         2 ~I~i~G~~GsGKstia~   18 (180)
T PRK04182          2 IITISGPPGSGKTTVAR   18 (180)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            58899999999999776


No 447
>PRK13549 xylose transporter ATP-binding subunit; Provisional
Probab=81.76  E-value=0.66  Score=51.38  Aligned_cols=21  Identities=33%  Similarity=0.673  Sum_probs=18.6

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|..+++.|+||+|||||..
T Consensus        29 ~~Ge~~~l~G~nGsGKSTLl~   49 (506)
T PRK13549         29 RAGEIVSLCGENGAGKSTLMK   49 (506)
T ss_pred             eCCeEEEEECCCCCCHHHHHH
Confidence            568899999999999999764


No 448
>cd04163 Era Era subfamily.  Era (E. coli Ras-like protein) is a multifunctional GTPase found in all bacteria except some eubacteria.  It binds to the 16S ribosomal RNA (rRNA) of the 30S subunit and appears to play a role in the assembly of the 30S subunit, possibly by chaperoning the 16S rRNA.  It also contacts several assembly elements of the 30S subunit.  Era couples cell growth with cytokinesis and plays a role in cell division and energy metabolism.  Homologs have also been found in eukaryotes. Era contains two domains: the N-terminal GTPase domain and a C-terminal domain KH domain that is critical for RNA binding.  Both domains are important for Era function.  Era is functionally able to compensate for deletion of RbfA, a cold-shock adaptation protein that is required for efficient processing of the 16S rRNA.
Probab=81.75  E-value=0.69  Score=40.93  Aligned_cols=18  Identities=28%  Similarity=0.401  Sum_probs=15.9

Q ss_pred             CEEEEEecCCCCcccccc
Q 008523          335 DVALFFGLSGTGKTTLST  352 (563)
Q Consensus       335 ~valfFGLSGTGKTTLsa  352 (563)
                      .++++.|.+|+|||||..
T Consensus         4 ~~i~~~G~~g~GKttl~~   21 (168)
T cd04163           4 GFVAIVGRPNVGKSTLLN   21 (168)
T ss_pred             eEEEEECCCCCCHHHHHH
Confidence            469999999999999775


No 449
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated
Probab=81.73  E-value=0.66  Score=51.01  Aligned_cols=42  Identities=29%  Similarity=0.386  Sum_probs=27.2

Q ss_pred             hHHHHHHHHHHhcccCceeeecccceecCCCCEEEEEecCCCCcccccc
Q 008523          304 MKKGLFSVMHYLMPKRQILSLHSGCNMGKDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       304 iKK~iltl~n~~l~~~G~L~mH~sanvg~~G~valfFGLSGTGKTTLsa  352 (563)
                      +++.+...+.-.++-...-       ....|.+++|.|++|+||||+++
T Consensus       198 ~~~~~~~~L~~~l~~~~~~-------~~~~~~~i~~vGptGvGKTTt~~  239 (424)
T PRK05703        198 AWRYLLELLANMIPVRVED-------ILKQGGVVALVGPTGVGKTTTLA  239 (424)
T ss_pred             HHHHHHHHHHHHhCccccc-------cccCCcEEEEECCCCCCHHHHHH
Confidence            5666666654444432221       12236799999999999999665


No 450
>cd00876 Ras Ras family.  The Ras family of the Ras superfamily includes classical N-Ras, H-Ras, and K-Ras, as well as R-Ras, Rap, Ral, Rheb, Rhes, ARHI, RERG, Rin/Rit, RSR1, RRP22, Ras2, Ras-dva, and RGK proteins.  Ras proteins regulate cell growth, proliferation and differentiation.  Ras is activated by guanine nucleotide exchange factors (GEFs) that release GDP and allow GTP binding.  Many RasGEFs have been identified.  These are sequestered in the cytosol until activation by growth factors triggers recruitment to the plasma membrane or Golgi, where the GEF colocalizes with Ras.  Active GTP-bound Ras interacts with several effector proteins: among the best characterized are the Raf kinases, phosphatidylinositol 3-kinase (PI3K), RalGEFs and NORE/MST1.  Most Ras proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid.  Lipid binding is essential for membrane attachment, a key feature of m
Probab=81.72  E-value=0.63  Score=41.55  Aligned_cols=16  Identities=25%  Similarity=0.667  Sum_probs=14.4

Q ss_pred             EEEEecCCCCcccccc
Q 008523          337 ALFFGLSGTGKTTLST  352 (563)
Q Consensus       337 alfFGLSGTGKTTLsa  352 (563)
                      ++++|++|+|||||..
T Consensus         2 i~i~G~~~~GKTsli~   17 (160)
T cd00876           2 VVVLGAGGVGKSAITI   17 (160)
T ss_pred             EEEECCCCCCHHHHHH
Confidence            6899999999999765


No 451
>PF06745 KaiC:  KaiC;  InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical. More than one copy is sometimes found in each protein in this entry. These include KaiC, which is one of the Kai proteins among which direct protein-protein association may be a critical process in the generation of circadian rhythms in cyanobacteria [].  The circadian clock protein KaiC, is encoded in the kaiABC operon that controls circadian rhythms and may be universal in Cyanobacteria. Each member contains two copies of this domain, which is also found in other proteins. KaiC performs autophosphorylation and acts as its own transcriptional repressor. RadA/Sms is a highly conserved eubacterial protein that shares sequence similarity with both RecA strand transferase and lon protease. The RadA/Sms family are probable ATP-dependent proteases involved in both DNA repair and degradation of proteins, peptides, glycopeptides. They are classified in as non-peptidase homologues and unassigned peptidases in MEROPS peptidase family S16 (lon protease family, clan SJ). RadA/Sms is involved in recombination and recombinational repair, most likely involving the stabilisation or processing of branched DNA molecules or blocked replication forks because of its genetic redundancy with RecG and RuvABC [].; PDB: 2W0M_A 2ZTS_C 4DUG_B 3K0E_B 3K09_B 3S1A_E 3JZM_E 2GBL_B 3DVL_A 1TF7_C ....
Probab=81.71  E-value=0.72  Score=45.27  Aligned_cols=21  Identities=48%  Similarity=0.700  Sum_probs=18.7

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      +.|.++++.|.+|||||+|+.
T Consensus        17 p~gs~~li~G~~GsGKT~l~~   37 (226)
T PF06745_consen   17 PKGSVVLISGPPGSGKTTLAL   37 (226)
T ss_dssp             ETTSEEEEEESTTSSHHHHHH
T ss_pred             CCCcEEEEEeCCCCCcHHHHH
Confidence            457899999999999999876


No 452
>PRK09087 hypothetical protein; Validated
Probab=81.68  E-value=0.62  Score=46.70  Aligned_cols=19  Identities=37%  Similarity=0.609  Sum_probs=16.7

Q ss_pred             CCEEEEEecCCCCcccccc
Q 008523          334 GDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       334 G~valfFGLSGTGKTTLsa  352 (563)
                      +..++++|.||+|||+|..
T Consensus        44 ~~~l~l~G~~GsGKThLl~   62 (226)
T PRK09087         44 SPVVVLAGPVGSGKTHLAS   62 (226)
T ss_pred             CCeEEEECCCCCCHHHHHH
Confidence            4568999999999999876


No 453
>cd04123 Rab21 Rab21 subfamily.  The localization and function of Rab21 are not clearly defined, with conflicting data reported.  Rab21 has been reported to localize in the ER in human intestinal epithelial cells, with partial colocalization with alpha-glucosidase, a late endosomal/lysosomal marker.  More recently, Rab21 was shown to colocalize with and affect the morphology of early endosomes. In Dictyostelium, GTP-bound Rab21, together with two novel LIM domain proteins, LimF and ChLim, has been shown to regulate phagocytosis. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GTPases contain a lipid modification site
Probab=81.46  E-value=0.71  Score=41.30  Aligned_cols=17  Identities=29%  Similarity=0.450  Sum_probs=15.0

Q ss_pred             EEEEEecCCCCcccccc
Q 008523          336 VALFFGLSGTGKTTLST  352 (563)
Q Consensus       336 valfFGLSGTGKTTLsa  352 (563)
                      .++|+|++|+|||||..
T Consensus         2 ki~i~G~~~~GKStli~   18 (162)
T cd04123           2 KVVLLGEGRVGKTSLVL   18 (162)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            47899999999999765


No 454
>PRK11160 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed
Probab=81.40  E-value=0.76  Score=51.84  Aligned_cols=21  Identities=38%  Similarity=0.653  Sum_probs=18.9

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      +.|+.+++.|.||+|||||..
T Consensus       364 ~~G~~~aivG~sGsGKSTL~~  384 (574)
T PRK11160        364 KAGEKVALLGRTGCGKSTLLQ  384 (574)
T ss_pred             CCCCEEEEECCCCCCHHHHHH
Confidence            678999999999999999765


No 455
>COG1100 GTPase SAR1 and related small G proteins [General function prediction only]
Probab=81.40  E-value=0.65  Score=44.55  Aligned_cols=18  Identities=39%  Similarity=0.440  Sum_probs=16.2

Q ss_pred             CEEEEEecCCCCcccccc
Q 008523          335 DVALFFGLSGTGKTTLST  352 (563)
Q Consensus       335 ~valfFGLSGTGKTTLsa  352 (563)
                      ..++++|++|+|||||..
T Consensus         6 ~kivv~G~~g~GKTtl~~   23 (219)
T COG1100           6 FKIVVLGDGGVGKTTLLN   23 (219)
T ss_pred             EEEEEEcCCCccHHHHHH
Confidence            469999999999999876


No 456
>TIGR01194 cyc_pep_trnsptr cyclic peptide transporter. This model describes cyclic peptide transporter in bacteria. Bacteria have elaborate pathways for the production of toxins and secondary metabolites. Many such compounds, including syringomycin and pyoverdine are synthesized on non-ribosomal templates consisting of a multienzyme complex. On several occasions the proteins of the complex and transporter protein are present on the same operon. Often times these compounds cross the biological membrane by specific transporters. Syringomycin is an amphipathic, cylclic lipodepsipeptide when inserted into host causes formation of channels, permeable to variety of cations. On the other hand, pyoverdine is a cyclic octa-peptidyl dihydroxyquinoline, which is efficient in sequestering iron for uptake.
Probab=81.37  E-value=0.75  Score=51.69  Aligned_cols=21  Identities=38%  Similarity=0.760  Sum_probs=19.0

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      +.|..+++.|+||+|||||..
T Consensus       366 ~~G~~~aivG~sGsGKSTl~~  386 (555)
T TIGR01194       366 AQGDIVFIVGENGCGKSTLAK  386 (555)
T ss_pred             cCCcEEEEECCCCCCHHHHHH
Confidence            678999999999999999765


No 457
>PRK14257 phosphate ABC transporter ATP-binding protein; Provisional
Probab=81.37  E-value=0.79  Score=48.51  Aligned_cols=21  Identities=43%  Similarity=0.646  Sum_probs=18.8

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|..++|.|.||+|||||..
T Consensus       106 ~~Ge~v~IvG~~GsGKSTLl~  126 (329)
T PRK14257        106 KRNKVTAFIGPSGCGKSTFLR  126 (329)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            578999999999999999765


No 458
>PF13086 AAA_11:  AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A.
Probab=81.35  E-value=0.59  Score=44.45  Aligned_cols=17  Identities=47%  Similarity=0.626  Sum_probs=12.8

Q ss_pred             EEEEEecCCCCcccccc
Q 008523          336 VALFFGLSGTGKTTLST  352 (563)
Q Consensus       336 valfFGLSGTGKTTLsa  352 (563)
                      ..++.|+.||||||+.+
T Consensus        19 ~~~i~GpPGTGKT~~l~   35 (236)
T PF13086_consen   19 ITLIQGPPGTGKTTTLA   35 (236)
T ss_dssp             -EEEE-STTSSHHHHHH
T ss_pred             CEEEECCCCCChHHHHH
Confidence            69999999999997443


No 459
>PRK15064 ABC transporter ATP-binding protein; Provisional
Probab=81.33  E-value=0.78  Score=51.11  Aligned_cols=21  Identities=29%  Similarity=0.463  Sum_probs=18.8

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|..+++.|++|+|||||..
T Consensus        25 ~~Ge~~~liG~NGsGKSTLl~   45 (530)
T PRK15064         25 GGGNRYGLIGANGCGKSTFMK   45 (530)
T ss_pred             CCCCEEEEECCCCCCHHHHHH
Confidence            568999999999999999765


No 460
>COG4778 PhnL ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism]
Probab=81.32  E-value=0.84  Score=45.41  Aligned_cols=21  Identities=38%  Similarity=0.694  Sum_probs=18.5

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      +.|.-+++-|+||+|||||..
T Consensus        35 ~aGECvvL~G~SG~GKStllr   55 (235)
T COG4778          35 NAGECVVLHGPSGSGKSTLLR   55 (235)
T ss_pred             cCccEEEeeCCCCCcHHHHHH
Confidence            568889999999999999764


No 461
>PRK14528 adenylate kinase; Provisional
Probab=81.27  E-value=0.69  Score=44.68  Aligned_cols=17  Identities=35%  Similarity=0.610  Sum_probs=15.4

Q ss_pred             EEEEEecCCCCcccccc
Q 008523          336 VALFFGLSGTGKTTLST  352 (563)
Q Consensus       336 valfFGLSGTGKTTLsa  352 (563)
                      .++++|++|+||||++.
T Consensus         3 ~i~i~G~pGsGKtt~a~   19 (186)
T PRK14528          3 NIIFMGPPGAGKGTQAK   19 (186)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            58999999999999876


No 462
>PRK15453 phosphoribulokinase; Provisional
Probab=81.24  E-value=0.66  Score=48.82  Aligned_cols=19  Identities=32%  Similarity=0.426  Sum_probs=16.7

Q ss_pred             CCEEEEEecCCCCcccccc
Q 008523          334 GDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       334 G~valfFGLSGTGKTTLsa  352 (563)
                      .-++++.|.|||||||++.
T Consensus         5 ~piI~ItG~SGsGKTTva~   23 (290)
T PRK15453          5 HPIIAVTGSSGAGTTTVKR   23 (290)
T ss_pred             CcEEEEECCCCCCHHHHHH
Confidence            4579999999999999876


No 463
>PRK10762 D-ribose transporter ATP binding protein; Provisional
Probab=81.21  E-value=0.76  Score=50.86  Aligned_cols=21  Identities=33%  Similarity=0.605  Sum_probs=18.8

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|+.+++.|++|+|||||..
T Consensus       276 ~~Ge~~~liG~NGsGKSTLl~  296 (501)
T PRK10762        276 RKGEILGVSGLMGAGRTELMK  296 (501)
T ss_pred             cCCcEEEEecCCCCCHHHHHH
Confidence            568999999999999999764


No 464
>TIGR01842 type_I_sec_PrtD type I secretion system ABC transporter, PrtD family. Type I protein secretion is a system in some Gram-negative bacteria to export proteins (often proteases) across both inner and outer membranes to the extracellular medium. This is one of three proteins of the type I secretion apparatus. Targeted proteins are not cleaved at the N-terminus, but rather carry signals located toward the extreme C-terminus to direct type I secretion.
Probab=81.16  E-value=0.78  Score=51.22  Aligned_cols=21  Identities=38%  Similarity=0.691  Sum_probs=18.9

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      +.|+.+++.|.||+|||||..
T Consensus       342 ~~G~~~~ivG~sGsGKSTL~~  362 (544)
T TIGR01842       342 QAGEALAIIGPSGSGKSTLAR  362 (544)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            578899999999999999765


No 465
>PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional
Probab=81.09  E-value=0.78  Score=50.99  Aligned_cols=21  Identities=38%  Similarity=0.664  Sum_probs=18.8

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|+.+++.|+||+|||||..
T Consensus        35 ~~Ge~~~liG~NGsGKSTLl~   55 (510)
T PRK15439         35 HAGEVHALLGGNGAGKSTLMK   55 (510)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            568899999999999999765


No 466
>PF00625 Guanylate_kin:  Guanylate kinase;  InterPro: IPR008144 Guanylate kinase (2.7.4.8 from EC) (GK) [] catalyzes the ATP-dependent phosphorylation of GMP into GDP. It is essential for recycling GMP and indirectly, cGMP. In prokaryotes (such as Escherichia coli), lower eukaryotes (such as yeast) and in vertebrates, GK is a highly conserved monomeric protein of about 200 amino acids. GK has been shown [, , ] to be structurally similar to protein A57R (or SalG2R) from various strains of Vaccinia virus. Proteins containing one or more copies of the DHR domain, an SH3 domain as well as a C-terminal GK-like domain, are collectively termed MAGUKs (membrane-associated guanylate kinase homologs) [], and include Drosophila lethal(1)discs large-1 tumor suppressor protein (gene dlg1); mammalian tight junction protein Zo-1; a family of mammalian synaptic proteins that seem to interact with the cytoplasmic tail of NMDA receptor subunits (SAP90/PSD-95, CHAPSYN-110/PSD-93, SAP97/DLG1 and SAP102); vertebrate 55kDa erythrocyte membrane protein (p55); Caenorhabditis elegans protein lin-2; rat protein CASK; and human proteins DLG2 and DLG3. There is an ATP-binding site (P-loop) in the N-terminal section of GK, which is not conserved in the GK-like domain of the above proteins. However these proteins retain the residues known, in GK, to be involved in the binding of GMP.; GO: 0005515 protein binding; PDB: 3UAT_A 3KFV_A 2ANC_F 2F3T_E 2ANB_A 2AN9_A 1S96_A 2F3R_B 3TR0_A 1LVG_A ....
Probab=81.06  E-value=0.8  Score=43.70  Aligned_cols=19  Identities=37%  Similarity=0.590  Sum_probs=16.9

Q ss_pred             CCEEEEEecCCCCcccccc
Q 008523          334 GDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       334 G~valfFGLSGTGKTTLsa  352 (563)
                      ++.+++.|+||+|||||..
T Consensus         2 ~r~ivl~Gpsg~GK~~l~~   20 (183)
T PF00625_consen    2 RRPIVLVGPSGSGKSTLAK   20 (183)
T ss_dssp             SSEEEEESSTTSSHHHHHH
T ss_pred             CCEEEEECCCCCCHHHHHH
Confidence            5789999999999999765


No 467
>PF03205 MobB:  Molybdopterin guanine dinucleotide synthesis protein B; PDB: 2F1R_B 1P9N_A 1NP6_B 2NPI_A 1XJC_A.
Probab=81.05  E-value=0.77  Score=42.84  Aligned_cols=17  Identities=41%  Similarity=0.495  Sum_probs=15.4

Q ss_pred             EEEEEecCCCCcccccc
Q 008523          336 VALFFGLSGTGKTTLST  352 (563)
Q Consensus       336 valfFGLSGTGKTTLsa  352 (563)
                      ++++.|.|++|||||..
T Consensus         2 vv~VvG~~~sGKTTl~~   18 (140)
T PF03205_consen    2 VVQVVGPKNSGKTTLIR   18 (140)
T ss_dssp             EEEEEESTTSSHHHHHH
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            68999999999999876


No 468
>TIGR03574 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Members of this protein are L-seryl-tRNA(Sec) kinase. This enzyme is part of a two-step pathway in Eukaryota and Archaea for performing selenocysteine biosynthesis by changing serine misacylated on selenocysteine-tRNA to selenocysteine. This enzyme performs the first step, phosphorylation of the OH group of the serine side chain. This family represents archaeal proteins with this activity.
Probab=81.00  E-value=0.64  Score=46.62  Aligned_cols=16  Identities=44%  Similarity=0.781  Sum_probs=14.8

Q ss_pred             EEEEecCCCCcccccc
Q 008523          337 ALFFGLSGTGKTTLST  352 (563)
Q Consensus       337 alfFGLSGTGKTTLsa  352 (563)
                      ++|.|++|+||||++.
T Consensus         2 Ivl~G~pGSGKST~a~   17 (249)
T TIGR03574         2 IILTGLPGVGKSTFSK   17 (249)
T ss_pred             EEEEcCCCCCHHHHHH
Confidence            6899999999999886


No 469
>cd04138 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily.  H-Ras, N-Ras, and K-Ras4A/4B are the prototypical members of the Ras family.  These isoforms generate distinct signal outputs despite interacting with a common set of activators and effectors, and are strongly associated with oncogenic progression in tumor initiation.  Mutated versions of Ras that are insensitive to GAP stimulation (and are therefore constitutively active) are found in a significant fraction of human cancers.  Many Ras guanine nucleotide exchange factors (GEFs) have been identified.  They are sequestered in the cytosol until activation by growth factors triggers recruitment to the plasma membrane or Golgi, where the GEF colocalizes with Ras.  Active (GTP-bound) Ras interacts with several effector proteins that stimulate a variety of diverse cytoplasmic signaling activities.  Some are known to positively mediate the oncogenic properties of Ras, including Raf, phosphatidylinositol 3-kinase (PI3K), RalGEFs, and Tiam1.  
Probab=80.98  E-value=0.69  Score=41.37  Aligned_cols=17  Identities=29%  Similarity=0.556  Sum_probs=15.0

Q ss_pred             EEEEEecCCCCcccccc
Q 008523          336 VALFFGLSGTGKTTLST  352 (563)
Q Consensus       336 valfFGLSGTGKTTLsa  352 (563)
                      .++|.|++|+|||||..
T Consensus         3 ki~iiG~~~vGKTsl~~   19 (162)
T cd04138           3 KLVVVGAGGVGKSALTI   19 (162)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            47899999999999865


No 470
>TIGR02236 recomb_radA DNA repair and recombination protein RadA. This family consists exclusively of archaeal RadA protein, a homolog of bacterial RecA (TIGR02012), eukaryotic RAD51 (TIGR02239), and archaeal RadB (TIGR02237). This protein is involved in DNA repair and recombination. The member from Pyrococcus horikoshii contains an intein.
Probab=80.97  E-value=0.67  Score=48.07  Aligned_cols=21  Identities=29%  Similarity=0.507  Sum_probs=18.3

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|.++.++|++|||||||+.
T Consensus        93 ~~g~i~ei~G~~g~GKT~l~~  113 (310)
T TIGR02236        93 ETQAITEVFGEFGSGKTQICH  113 (310)
T ss_pred             CCCeEEEEECCCCCCHHHHHH
Confidence            347889999999999999876


No 471
>PRK13536 nodulation factor exporter subunit NodI; Provisional
Probab=80.95  E-value=0.82  Score=48.65  Aligned_cols=21  Identities=29%  Similarity=0.581  Sum_probs=18.7

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|..+.+.|++|+|||||..
T Consensus        65 ~~Gei~gLlGpNGaGKSTLl~   85 (340)
T PRK13536         65 ASGECFGLLGPNGAGKSTIAR   85 (340)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            568999999999999999654


No 472
>PRK13946 shikimate kinase; Provisional
Probab=80.90  E-value=0.74  Score=44.19  Aligned_cols=18  Identities=33%  Similarity=0.665  Sum_probs=16.2

Q ss_pred             CEEEEEecCCCCcccccc
Q 008523          335 DVALFFGLSGTGKTTLST  352 (563)
Q Consensus       335 ~valfFGLSGTGKTTLsa  352 (563)
                      ..+++.|++||||||++.
T Consensus        11 ~~I~l~G~~GsGKsti~~   28 (184)
T PRK13946         11 RTVVLVGLMGAGKSTVGR   28 (184)
T ss_pred             CeEEEECCCCCCHHHHHH
Confidence            579999999999999876


No 473
>COG0467 RAD55 RecA-superfamily ATPases implicated in signal transduction [Signal transduction mechanisms]
Probab=80.89  E-value=0.77  Score=46.32  Aligned_cols=21  Identities=43%  Similarity=0.632  Sum_probs=19.3

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      +.|.++++.|.+|||||+++.
T Consensus        21 p~g~~~lI~G~pGsGKT~f~~   41 (260)
T COG0467          21 PRGSVVLITGPPGTGKTIFAL   41 (260)
T ss_pred             cCCcEEEEEcCCCCcHHHHHH
Confidence            668899999999999999887


No 474
>PRK15064 ABC transporter ATP-binding protein; Provisional
Probab=80.86  E-value=0.82  Score=50.95  Aligned_cols=21  Identities=38%  Similarity=0.566  Sum_probs=18.9

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|..+++.|++|+|||||..
T Consensus       343 ~~Ge~~~l~G~NGsGKSTLl~  363 (530)
T PRK15064        343 EAGERLAIIGENGVGKTTLLR  363 (530)
T ss_pred             CCCCEEEEECCCCCCHHHHHH
Confidence            678999999999999999765


No 475
>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs. A related protein is found in archaea.
Probab=80.78  E-value=0.64  Score=43.56  Aligned_cols=16  Identities=50%  Similarity=0.669  Sum_probs=14.7

Q ss_pred             EEEEecCCCCcccccc
Q 008523          337 ALFFGLSGTGKTTLST  352 (563)
Q Consensus       337 alfFGLSGTGKTTLsa  352 (563)
                      +++.|.+|||||+|+.
T Consensus         2 ~li~G~~G~GKT~l~~   17 (187)
T cd01124           2 TLLSGGPGTGKTTFAL   17 (187)
T ss_pred             EEEEcCCCCCHHHHHH
Confidence            6899999999999876


No 476
>PRK10416 signal recognition particle-docking protein FtsY; Provisional
Probab=80.64  E-value=0.73  Score=48.81  Aligned_cols=21  Identities=43%  Similarity=0.491  Sum_probs=18.3

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..+.+++|.|++|+||||+++
T Consensus       112 ~~~~vi~lvGpnGsGKTTt~~  132 (318)
T PRK10416        112 KKPFVILVVGVNGVGKTTTIG  132 (318)
T ss_pred             CCCeEEEEECCCCCcHHHHHH
Confidence            357899999999999999776


No 477
>PRK10789 putative multidrug transporter membrane\ATP-binding components; Provisional
Probab=80.58  E-value=0.84  Score=51.38  Aligned_cols=21  Identities=38%  Similarity=0.593  Sum_probs=18.9

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      +.|..+++.|+||+|||||..
T Consensus       339 ~~G~~~~ivG~sGsGKSTLl~  359 (569)
T PRK10789        339 KPGQMLGICGPTGSGKSTLLS  359 (569)
T ss_pred             CCCCEEEEECCCCCCHHHHHH
Confidence            568999999999999999765


No 478
>PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional
Probab=80.55  E-value=0.81  Score=50.42  Aligned_cols=21  Identities=24%  Similarity=0.465  Sum_probs=18.7

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|+.+.+.|++|+|||||..
T Consensus       272 ~~Ge~~~l~G~nGsGKSTLl~  292 (491)
T PRK10982        272 HKGEILGIAGLVGAKRTDIVE  292 (491)
T ss_pred             eCCcEEEEecCCCCCHHHHHH
Confidence            568999999999999999754


No 479
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed
Probab=80.52  E-value=0.67  Score=48.52  Aligned_cols=18  Identities=50%  Similarity=0.820  Sum_probs=16.1

Q ss_pred             CEEEEEecCCCCcccccc
Q 008523          335 DVALFFGLSGTGKTTLST  352 (563)
Q Consensus       335 ~valfFGLSGTGKTTLsa  352 (563)
                      ..++|+|++|||||||+.
T Consensus        52 ~~~ll~GppG~GKT~la~   69 (328)
T PRK00080         52 DHVLLYGPPGLGKTTLAN   69 (328)
T ss_pred             CcEEEECCCCccHHHHHH
Confidence            468999999999999876


No 480
>KOG3354 consensus Gluconate kinase [Carbohydrate transport and metabolism]
Probab=80.51  E-value=1  Score=44.06  Aligned_cols=35  Identities=34%  Similarity=0.560  Sum_probs=23.6

Q ss_pred             cCCCCEEEEEecCCCCcccccc----cCCC-ceeecCcee
Q 008523          331 GKDGDVALFFGLSGTGKTTLST----DHNR-YLIGDDEHC  365 (563)
Q Consensus       331 g~~G~valfFGLSGTGKTTLsa----d~~r-~lIgDDe~~  365 (563)
                      ++-.++++++|.|||||||+..    .-+. .+=|||-|-
T Consensus         9 ~~~k~~i~vmGvsGsGKSTigk~L~~~l~~~F~dgDd~Hp   48 (191)
T KOG3354|consen    9 GPFKYVIVVMGVSGSGKSTIGKALSEELGLKFIDGDDLHP   48 (191)
T ss_pred             CCCceeEEEEecCCCChhhHHHHHHHHhCCcccccccCCC
Confidence            4445799999999999999654    2232 244666543


No 481
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily. Members of this protein are marked as probable ATPases by the nucleotide binding P-loop motif GXXGXGKTT, a motif DEAQ similar to the DEAD/H box of helicases, and extensive homology to ATPases of MSHA-type pilus systems and to GspA proteins associated with type II protein secretion systems.
Probab=80.39  E-value=0.85  Score=45.46  Aligned_cols=39  Identities=31%  Similarity=0.459  Sum_probs=26.0

Q ss_pred             cchhhHHHHHHHHHHhcccCceeeecccceecCCCCEEEEEecCCCCcccccc
Q 008523          300 YAGEMKKGLFSVMHYLMPKRQILSLHSGCNMGKDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       300 Y~GEiKK~iltl~n~~l~~~G~L~mH~sanvg~~G~valfFGLSGTGKTTLsa  352 (563)
                      |..+..+.++..+++.+.+.              ...+++.|++|+|||||..
T Consensus        23 ~~~~~~~~~~~~l~~~~~~~--------------~~~~~l~G~~G~GKTtl~~   61 (269)
T TIGR03015        23 YPSKGHKRAMAYLEYGLSQR--------------EGFILITGEVGAGKTTLIR   61 (269)
T ss_pred             CCCHHHHHHHHHHHHHHhcC--------------CCEEEEEcCCCCCHHHHHH
Confidence            44555566666665544321              1257899999999999876


No 482
>smart00175 RAB Rab subfamily of small GTPases. Rab GTPases are implicated in vesicle trafficking.
Probab=80.36  E-value=0.75  Score=41.43  Aligned_cols=17  Identities=35%  Similarity=0.606  Sum_probs=15.0

Q ss_pred             EEEEEecCCCCcccccc
Q 008523          336 VALFFGLSGTGKTTLST  352 (563)
Q Consensus       336 valfFGLSGTGKTTLsa  352 (563)
                      .++|+|.+|+|||||..
T Consensus         2 kv~v~G~~~~GKTtli~   18 (164)
T smart00175        2 KIILIGDSGVGKSSLLS   18 (164)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            47899999999999765


No 483
>TIGR02012 tigrfam_recA protein RecA. This model describes orthologs of the recA protein. RecA promotes hybridization of homolgous regions of DNA. A segment of ssDNA can be hybridized to another ssDNA region, or to a dsDNA region. ATP is hydrolyzed in the process. Part of the SOS respones, it is regulated by LexA via autocatalytic cleavage.
Probab=80.25  E-value=0.8  Score=48.76  Aligned_cols=21  Identities=33%  Similarity=0.572  Sum_probs=18.4

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      +.|.++.++|++|||||||+.
T Consensus        53 p~G~iteI~G~~GsGKTtLaL   73 (321)
T TIGR02012        53 PRGRIIEIYGPESSGKTTLAL   73 (321)
T ss_pred             cCCeEEEEECCCCCCHHHHHH
Confidence            456799999999999999865


No 484
>TIGR02173 cyt_kin_arch cytidylate kinase, putative. Proteins in this family are believed to be cytidylate kinase. Members of this family are found in the archaea and in spirochaetes, and differ considerably from the common bacterial form of cytidylate kinase described by TIGR00017.
Probab=80.24  E-value=0.77  Score=42.37  Aligned_cols=17  Identities=35%  Similarity=0.585  Sum_probs=15.4

Q ss_pred             EEEEEecCCCCcccccc
Q 008523          336 VALFFGLSGTGKTTLST  352 (563)
Q Consensus       336 valfFGLSGTGKTTLsa  352 (563)
                      ++++.|.+||||||++.
T Consensus         2 iI~i~G~~GSGKstia~   18 (171)
T TIGR02173         2 IITISGPPGSGKTTVAK   18 (171)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            57899999999999876


No 485
>PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional
Probab=80.22  E-value=0.84  Score=50.50  Aligned_cols=21  Identities=33%  Similarity=0.789  Sum_probs=18.8

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|+.+++.|++|+|||||..
T Consensus       277 ~~Ge~~~iiG~NGsGKSTLlk  297 (501)
T PRK11288        277 RAGEIVGLFGLVGAGRSELMK  297 (501)
T ss_pred             eCCcEEEEEcCCCCCHHHHHH
Confidence            568999999999999999765


No 486
>TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein. Several bacterial species have enzymes xylose isomerase and xylulokinase enzymes for xylose utilization. Members of this protein family are the ATP-binding cassette (ABC) subunit of the known or predicted high-affinity xylose ABC transporter for xylose import. These genes, which closely resemble other sugar transport ABC transporter genes, typically are encoded near xylose utilization enzymes and regulatory proteins. Note that this form of the transporter contains two copies of the ABC transporter domain (pfam00005).
Probab=80.11  E-value=0.84  Score=50.38  Aligned_cols=21  Identities=33%  Similarity=0.612  Sum_probs=18.7

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|+.+++.|++|+|||||..
T Consensus       284 ~~Ge~~~l~G~NGsGKSTLl~  304 (500)
T TIGR02633       284 RRGEILGVAGLVGAGRTELVQ  304 (500)
T ss_pred             eCCcEEEEeCCCCCCHHHHHH
Confidence            568899999999999999765


No 487
>PF13521 AAA_28:  AAA domain; PDB: 1LW7_A.
Probab=80.11  E-value=0.61  Score=43.44  Aligned_cols=27  Identities=22%  Similarity=0.401  Sum_probs=18.6

Q ss_pred             ChHHHHHHHHHHHHHcCCEEEEEeccc
Q 008523          510 HPTKYAAMLAEKMQKHGATGWLVNTGW  536 (563)
Q Consensus       510 ~p~~yae~L~~kl~~~~v~v~LiNTGw  536 (563)
                      .....-++|.+.++++|+++..|++|-
T Consensus       133 ~r~~~~~~~~~~l~~~~~~~~~v~~gs  159 (163)
T PF13521_consen  133 ERERIDELLKELLERHGIPYIIVPSGS  159 (163)
T ss_dssp             SHHHHHHHHHHHHHGGG---EEEE-SS
T ss_pred             HHHHHHHHHHHHHHHCCCeEEEeCCCC
Confidence            345667889999999999999998763


No 488
>TIGR00554 panK_bact pantothenate kinase, bacterial type. Shown to be a homodimer in E. coli. This enzyme catalyzes the rate-limiting step in the biosynthesis of coenzyme A. It is very well conserved from E. coli to B. subtilis, but differs considerably from known eukaryotic forms, described in a separate model.
Probab=80.08  E-value=0.75  Score=48.24  Aligned_cols=18  Identities=22%  Similarity=0.252  Sum_probs=15.9

Q ss_pred             CEEEEEecCCCCcccccc
Q 008523          335 DVALFFGLSGTGKTTLST  352 (563)
Q Consensus       335 ~valfFGLSGTGKTTLsa  352 (563)
                      .++.+.|.||+|||||+.
T Consensus        63 ~IIGIaG~~GSGKSTlar   80 (290)
T TIGR00554        63 YIISIAGSVAVGKSTTAR   80 (290)
T ss_pred             EEEEEECCCCCCHHHHHH
Confidence            468999999999999874


No 489
>PRK10261 glutathione transporter ATP-binding protein; Provisional
Probab=80.07  E-value=0.87  Score=52.09  Aligned_cols=21  Identities=29%  Similarity=0.526  Sum_probs=19.0

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|..+++.|.||+|||||..
T Consensus        40 ~~Ge~~~lvG~nGsGKSTLl~   60 (623)
T PRK10261         40 QRGETLAIVGESGSGKSVTAL   60 (623)
T ss_pred             CCCCEEEEECCCCChHHHHHH
Confidence            578999999999999999775


No 490
>cd04161 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily.  Arl2l1 (Arl2-like protein 1) and Arl13 form a subfamily of the Arf family of small GTPases.  Arl2l1 was identified in human cells during a search for the gene(s) responsible for Bardet-Biedl syndrome (BBS).  Like Arl6, the identified BBS gene, Arl2l1 is proposed to have cilia-specific functions.  Arl13 is found on the X chromosome, but its expression has not been confirmed; it may be a pseudogene.
Probab=80.04  E-value=0.71  Score=43.00  Aligned_cols=17  Identities=47%  Similarity=0.630  Sum_probs=14.9

Q ss_pred             EEEEEecCCCCcccccc
Q 008523          336 VALFFGLSGTGKTTLST  352 (563)
Q Consensus       336 valfFGLSGTGKTTLsa  352 (563)
                      +++++|++|+|||||..
T Consensus         1 ~i~~~G~~~~GKTsl~~   17 (167)
T cd04161           1 TLLTVGLDNAGKTTLVS   17 (167)
T ss_pred             CEEEECCCCCCHHHHHH
Confidence            47899999999999854


No 491
>TIGR01192 chvA glucan exporter ATP-binding protein. This model describes glucan exporter ATP binding protein in bacteria. It belongs to the larger ABC transporter superfamily with the characteristic ATP binding motif. The In general, this protein is in some ways implicated in osmoregulation and suggested to participate in the export of glucan from the cytoplasm to periplasm. The cyclic beta-1,2-glucan in the bactrerial periplasmic space is suggested to confer the property of high osmolority. It has also been demonstrated that mutants in this loci have lost functions of virulence and motility. It is unclear as to how virulence and osmoadaptaion are related.
Probab=80.02  E-value=0.9  Score=51.45  Aligned_cols=21  Identities=43%  Similarity=0.650  Sum_probs=18.9

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      +.|+.+++.|+||+|||||..
T Consensus       359 ~~G~~~~ivG~sGsGKSTL~~  379 (585)
T TIGR01192       359 KAGQTVAIVGPTGAGKTTLIN  379 (585)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            578999999999999999765


No 492
>PF02367 UPF0079:  Uncharacterised P-loop hydrolase UPF0079;  InterPro: IPR003442 This group consists of bacterial proteins, which contain a P-loop. They are probably essential to bacteria as members are found in all genomes so far sequenced and no equivalent genes have been found in the archaea and eukaryotes, suggesting the protein may be involved in cell wall biosynthesis. The sequence of YjeE, from Haemophilus influenzae, has been determined to 1.7-A resolution. The protein has a nucleotide-binding fold with a four-stranded parallel beta-sheet flanked by antiparallel beta-strands on each side. The topology of the beta-sheet is unique among P-loop proteins and has features of different families of enzymes. ADP has been shown to bind to the P-loop in the presence of Mg2+ and ATPase activity has been confirmed by kinetic measurements [].; PDB: 1HTW_A 1FL9_A.
Probab=80.02  E-value=0.9  Score=42.03  Aligned_cols=21  Identities=52%  Similarity=0.681  Sum_probs=18.6

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      +.|+++++.|+=|+||||++.
T Consensus        13 ~~g~vi~L~GdLGaGKTtf~r   33 (123)
T PF02367_consen   13 KPGDVILLSGDLGAGKTTFVR   33 (123)
T ss_dssp             SS-EEEEEEESTTSSHHHHHH
T ss_pred             CCCCEEEEECCCCCCHHHHHH
Confidence            678999999999999999876


No 493
>PRK11147 ABC transporter ATPase component; Reviewed
Probab=79.99  E-value=0.91  Score=52.01  Aligned_cols=21  Identities=33%  Similarity=0.583  Sum_probs=18.9

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|+.+++.|++|+|||||..
T Consensus        27 ~~Ge~v~LvG~NGsGKSTLLr   47 (635)
T PRK11147         27 EDNERVCLVGRNGAGKSTLMK   47 (635)
T ss_pred             CCCCEEEEECCCCCCHHHHHH
Confidence            568999999999999999765


No 494
>cd01673 dNK Deoxyribonucleoside kinase (dNK) catalyzes the phosphorylation of deoxyribonucleosides to yield corresponding monophosphates (dNMPs). This family consists of various deoxynucleoside kinases including deoxyribo- cytidine (EC 2.7.1.74), guanosine (EC 2.7.1.113), adenosine (EC 2.7.1.76), and thymidine (EC 2.7.1.21) kinases. They are key enzymes in the salvage of deoxyribonucleosides originating from extra- or intracellular breakdown of DNA.
Probab=79.98  E-value=0.73  Score=43.94  Aligned_cols=16  Identities=38%  Similarity=0.526  Sum_probs=14.6

Q ss_pred             EEEEecCCCCcccccc
Q 008523          337 ALFFGLSGTGKTTLST  352 (563)
Q Consensus       337 alfFGLSGTGKTTLsa  352 (563)
                      ++|.|..||||||++.
T Consensus         2 I~ieG~~GsGKSTl~~   17 (193)
T cd01673           2 IVVEGNIGAGKSTLAK   17 (193)
T ss_pred             EEEECCCCCCHHHHHH
Confidence            7899999999999776


No 495
>cd03243 ABC_MutS_homologs The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch.  Members of the MutS family also possess a conserved ATPase activity that belongs to the ATP binding cassette (ABC) superfamily.  MutS homologs (MSH) have been identified in most prokaryotic and all eukaryotic organisms examined.  Prokaryotes have two homologs (MutS1 and MutS2), whereas seven MSH proteins (MSH1 to MSH7) have been identified in eukaryotes.  The homodimer MutS1 and heterodimers MSH2-MSH3 and MSH2-MSH6 are primarily involved in mitotic mismatch repair, whereas MSH4-MSH5 is involved in resolution of Holliday junctions during meiosis.  All members of the MutS family contain the highly conserved Walker A/B ATPase domain, and many share a common mechanism of action.  MutS1, MSH2-MSH3, MSH2-MSH6, and MSH4-MSH5 dimerize to form sliding clamps, and recognition of specific DNA stru
Probab=79.98  E-value=0.96  Score=43.92  Aligned_cols=31  Identities=19%  Similarity=0.209  Sum_probs=22.0

Q ss_pred             CceeeecccceecCCCCEEEEEecCCCCcccccc
Q 008523          319 RQILSLHSGCNMGKDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       319 ~G~L~mH~sanvg~~G~valfFGLSGTGKTTLsa  352 (563)
                      +.+.|.+-..   ..|+.+++.|++|+|||||..
T Consensus        17 ~~~~~~~~~l---~~~~~~~l~G~Ng~GKStll~   47 (202)
T cd03243          17 ETFVPNDINL---GSGRLLLITGPNMGGKSTYLR   47 (202)
T ss_pred             CceEeeeEEE---cCCeEEEEECCCCCccHHHHH
Confidence            4455554332   236899999999999999654


No 496
>cd01857 HSR1_MMR1 HSR1/MMR1.  Human HSR1, is localized to the human MHC class I region and is highly homologous to a putative GTP-binding protein, MMR1 from mouse. These proteins represent a new subfamily of GTP-binding proteins that has only eukaryote members. This subfamily shows a circular permutation of the GTPase signature motifs so that the C-terminal strands 5, 6, and 7 (strand 6 contains the G4 box with sequence NKXD) are relocated to the N terminus.
Probab=79.97  E-value=1.1  Score=40.92  Aligned_cols=27  Identities=15%  Similarity=0.186  Sum_probs=19.8

Q ss_pred             ecccceecCCCCEEEEEecCCCCcccccc
Q 008523          324 LHSGCNMGKDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       324 mH~sanvg~~G~valfFGLSGTGKTTLsa  352 (563)
                      +..||..+.+  .++|+|.||.|||||..
T Consensus        75 i~iSa~~~~~--~~~~~G~~~vGKstlin  101 (141)
T cd01857          75 VFFSALKENA--TIGLVGYPNVGKSSLIN  101 (141)
T ss_pred             EEEEecCCCc--EEEEECCCCCCHHHHHH
Confidence            3346643332  79999999999999865


No 497
>cd03116 MobB Molybdenum is an essential trace element in the form of molybdenum cofactor (Moco) which is associated with the metabolism of nitrogen, carbon and sulfur by redox active enzymes. In E. coli, the synthesis of Moco involves genes from several loci: moa, mob, mod, moe and mog. The mob locus contains mobA and mobB genes. MobB catalyzes the attachment of the guanine dinucleotide to molybdopterin.
Probab=79.79  E-value=0.8  Score=43.76  Aligned_cols=18  Identities=56%  Similarity=0.728  Sum_probs=15.7

Q ss_pred             CEEEEEecCCCCcccccc
Q 008523          335 DVALFFGLSGTGKTTLST  352 (563)
Q Consensus       335 ~valfFGLSGTGKTTLsa  352 (563)
                      .++.|.|.||+|||||..
T Consensus         2 ~vi~i~G~~gsGKTTli~   19 (159)
T cd03116           2 KVIGFVGYSGSGKTTLLE   19 (159)
T ss_pred             eEEEEECCCCCCHHHHHH
Confidence            368899999999999865


No 498
>cd03273 ABC_SMC2_euk Eukaryotic SMC2 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains.  Amino-acid sequence homology of SMC proteins between species is largely confined to the amino- and carboxy-terminal globular domains.  The amino-terminal domain contains a 'Walker A' nucleotide-binding domain (GxxGxGKS/T, in the single-letter amino-acid code), which by mutational studies has been shown to be essential in several proteins.  The carboxy-terminal domain contains a sequence (the DA-box) that resembles a 'Walker B' motif, and a motif with homology to the signature sequence of the ATP-binding cassette (ABC) family of ATPases.  The sequence homology within the carboxy-terminal domain is relatively high within the SMC1-SMC4 group, whereas SMC5 and SMC6 show some divergence in both of these sequences.  In eukaryotic cells, the proteins are found as heterodimers of SMC1 paired with SMC3, SMC2 with SMC4, and SMC5 with SMC6 (fo
Probab=79.79  E-value=0.94  Score=45.46  Aligned_cols=19  Identities=26%  Similarity=0.506  Sum_probs=16.0

Q ss_pred             CCEEEEEecCCCCcccccc
Q 008523          334 GDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       334 G~valfFGLSGTGKTTLsa  352 (563)
                      ....+|.|+||+|||||..
T Consensus        25 ~~~~~IvG~NGsGKStll~   43 (251)
T cd03273          25 PQFNAITGLNGSGKSNILD   43 (251)
T ss_pred             CCeEEEECCCCCCHHHHHH
Confidence            4578899999999999654


No 499
>PRK11819 putative ABC transporter ATP-binding protein; Reviewed
Probab=79.78  E-value=0.95  Score=50.94  Aligned_cols=21  Identities=38%  Similarity=0.504  Sum_probs=18.9

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|+.+++.|++|+|||||..
T Consensus        31 ~~Ge~~~iiG~NGsGKSTLlk   51 (556)
T PRK11819         31 FPGAKIGVLGLNGAGKSTLLR   51 (556)
T ss_pred             CCCCEEEEECCCCCCHHHHHH
Confidence            568999999999999999765


No 500
>PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional
Probab=79.77  E-value=0.91  Score=50.46  Aligned_cols=21  Identities=29%  Similarity=0.639  Sum_probs=18.9

Q ss_pred             CCCCEEEEEecCCCCcccccc
Q 008523          332 KDGDVALFFGLSGTGKTTLST  352 (563)
Q Consensus       332 ~~G~valfFGLSGTGKTTLsa  352 (563)
                      ..|+.+++.|++|+|||||..
T Consensus       287 ~~Ge~~~l~G~NGsGKSTLl~  307 (510)
T PRK15439        287 RAGEILGLAGVVGAGRTELAE  307 (510)
T ss_pred             cCCcEEEEECCCCCCHHHHHH
Confidence            578999999999999999765


Done!