Query         008530
Match_columns 562
No_of_seqs    100 out of 112
Neff          2.9 
Searched_HMMs 46136
Date          Thu Mar 28 13:19:21 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/008530.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/008530hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF10453 NUFIP1:  Nuclear fragi  99.1 8.4E-11 1.8E-15   94.1   5.0   31  292-322    16-46  (56)
  2 PF00642 zf-CCCH:  Zinc finger   87.1     0.2 4.4E-06   34.6   0.2   26  380-406     2-27  (27)
  3 smart00356 ZnF_C3H1 zinc finge  58.6       8 0.00017   25.4   1.9   24  380-405     3-26  (27)
  4 KOG4031 Vesicle coat protein c  58.0      31 0.00068   35.1   6.7   19  292-310   101-119 (216)
  5 KOG4264 Nucleo-cytoplasmic pro  50.4      12 0.00025   42.6   2.6   28  534-561   132-159 (694)
  6 KOG1677 CCCH-type Zn-finger pr  49.8     9.5 0.00021   38.7   1.7   30  378-408   174-203 (332)
  7 KOG2185 Predicted RNA-processi  41.6      11 0.00024   41.6   0.8   27  380-408   139-165 (486)
  8 KOG0943 Predicted ubiquitin-pr  34.4      23 0.00049   44.2   1.9   14  547-560  1781-1794(3015)
  9 PTZ00415 transmission-blocking  34.2      23 0.00051   45.2   2.0   16  377-392    59-74  (2849)
 10 PF10446 DUF2457:  Protein of u  33.8      20 0.00043   39.9   1.2    7  445-451    37-43  (458)
 11 KOG3671 Actin regulatory prote  31.4      42 0.00091   38.1   3.2   10  438-447   494-503 (569)
 12 KOG1492 C3H1-type Zn-finger pr  29.0      24 0.00053   36.6   0.9   27  379-408   204-232 (377)
 13 PF01086 Clathrin_lg_ch:  Clath  28.2      69  0.0015   32.0   3.8   27  296-322   111-137 (225)
 14 KOG2002 TPR-containing nuclear  27.0 2.2E+02  0.0047   34.9   8.0   16  543-558  1001-1016(1018)
 15 PRK10947 global DNA-binding tr  26.6 2.1E+02  0.0046   27.1   6.4   22  337-358    54-75  (135)
 16 PF05178 Kri1:  KRI1-like famil  25.4   1E+02  0.0022   27.8   4.0   46  318-363     3-49  (101)
 17 KOG3241 Uncharacterized conser  23.1 1.7E+02  0.0038   29.7   5.5   36  285-320    33-73  (227)
 18 PF12728 HTH_17:  Helix-turn-he  22.4      43 0.00092   25.1   0.9   16  292-307    36-51  (51)
 19 PRK10328 DNA binding protein,   21.3 2.9E+02  0.0063   26.2   6.3   23  336-358    53-75  (134)
 20 COG0620 MetE Methionine syntha  21.1 1.8E+02  0.0039   30.9   5.4   46  310-355    13-58  (330)

No 1  
>PF10453 NUFIP1:  Nuclear fragile X mental retardation-interacting protein 1 (NUFIP1);  InterPro: IPR019496 Nuclear fragile X mental retardation-interacting protein 1 (Nufip1) has been implicated in the assembly of the large subunit of the ribosome [] and in telomere maintenance []. It is known to bind RNA [] and is phosphorylated upon DNA damage []. This entry represents a conserved domain found within Nufip1. Some proteins containing this region also contain a CCCH zinc finger.
Probab=99.11  E-value=8.4e-11  Score=94.10  Aligned_cols=31  Identities=61%  Similarity=0.901  Sum_probs=28.2

Q ss_pred             cccCHHHHHHHHHHHHhcCCChHHHHHHHHH
Q 008530          292 LTYTEQEVKQWCEERRKNYPTKANINKKLTE  322 (562)
Q Consensus       292 l~~t~eeI~~WreERrKN~PT~anIe~K~~e  322 (562)
                      .++|++||++|||||||||||+++|++|+++
T Consensus        16 ~L~t~eeI~~W~eERrk~~PT~~~i~~k~~~   46 (56)
T PF10453_consen   16 KLQTPEEIAKWIEERRKNYPTKANIEKKKAE   46 (56)
T ss_pred             ecCCHHHHHHHHHHHHHcCCcHHHHHHHHHH
Confidence            3479999999999999999999999988765


No 2  
>PF00642 zf-CCCH:  Zinc finger C-x8-C-x5-C-x3-H type (and similar);  InterPro: IPR000571 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents C-x8-C-x5-C-x3-H (CCCH) type Zinc finger (Znf) domains. Proteins containing CCCH Znf domains include Znf proteins from eukaryotes involved in cell cycle or growth phase-related regulation, e.g. human TIS11B (butyrate response factor 1), a probable regulatory protein involved in regulating the response to growth factors, and the mouse TTP growth factor-inducible nuclear protein, which has the same function. The mouse TTP protein is induced by growth factors. Another protein containing this domain is the human splicing factor U2AF 35kDa subunit, which plays a critical role in both constitutive and enhancer-dependent splicing by mediating essential protein-protein interactions and protein-RNA interactions required for 3' splice site selection. It has been shown that different CCCH-type Znf proteins interact with the 3'-untranslated region of various mRNA [, ]. This type of Znf is very often present in two copies. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003676 nucleic acid binding, 0008270 zinc ion binding; PDB: 1M9O_A 1RGO_A 2CQE_A 2FC6_A 2D9M_A 2E5S_A 2RHK_C 2D9N_A 3D2S_A 3D2Q_C ....
Probab=87.09  E-value=0.2  Score=34.61  Aligned_cols=26  Identities=19%  Similarity=0.188  Sum_probs=19.3

Q ss_pred             CCCCcceeccCCCCcccCCCCccchhh
Q 008530          380 LNKRGRFQNNYDKRGRYKRKDQFSKEQ  406 (562)
Q Consensus       380 ~~K~CKF~nrGg~RgRcgRKcRFsh~~  406 (562)
                      .++.|+||.+.| .|++|.+|+|+|.+
T Consensus         2 k~~~C~~f~~~g-~C~~G~~C~f~H~~   27 (27)
T PF00642_consen    2 KTKLCRFFMRTG-TCPFGDKCRFAHGE   27 (27)
T ss_dssp             TSSB-HHHHHTS---TTGGGSSSBSSG
T ss_pred             ccccChhhccCC-ccCCCCCcCccCCC
Confidence            467899999977 67899999999963


No 3  
>smart00356 ZnF_C3H1 zinc finger.
Probab=58.62  E-value=8  Score=25.44  Aligned_cols=24  Identities=13%  Similarity=0.134  Sum_probs=17.6

Q ss_pred             CCCCcceeccCCCCcccCCCCccchh
Q 008530          380 LNKRGRFQNNYDKRGRYKRKDQFSKE  405 (562)
Q Consensus       380 ~~K~CKF~nrGg~RgRcgRKcRFsh~  405 (562)
                      ....|++|.+|.  |+.|..|+|.|.
T Consensus         3 k~~~C~~~~~g~--C~~g~~C~~~H~   26 (27)
T smart00356        3 KTELCKFFKRGY--CPYGDRCKFAHP   26 (27)
T ss_pred             CCCcCcCccCCC--CCCCCCcCCCCc
Confidence            345799995554  558888999885


No 4  
>KOG4031 consensus Vesicle coat protein clathrin, light chain [Intracellular trafficking, secretion, and vesicular transport]
Probab=58.01  E-value=31  Score=35.14  Aligned_cols=19  Identities=26%  Similarity=0.571  Sum_probs=16.0

Q ss_pred             cccCHHHHHHHHHHHHhcC
Q 008530          292 LTYTEQEVKQWCEERRKNY  310 (562)
Q Consensus       292 l~~t~eeI~~WreERrKN~  310 (562)
                      +...||-|++|+|++++.-
T Consensus       101 ~~~epE~IRkWkeeQ~~rl  119 (216)
T KOG4031|consen  101 LRDEPEKIRKWKEEQMKRL  119 (216)
T ss_pred             cccChHHHHHHHHHHHHHH
Confidence            5678999999999998753


No 5  
>KOG4264 consensus Nucleo-cytoplasmic protein MLN51 [General function prediction only]
Probab=50.36  E-value=12  Score=42.64  Aligned_cols=28  Identities=21%  Similarity=0.275  Sum_probs=24.1

Q ss_pred             cccceeeeccCCCccccccccccccccC
Q 008530          534 EQMKVYIAGKGNTNDEHVRLEEEEGEII  561 (562)
Q Consensus       534 ~~~~~~~~~~~~~~d~~~~~~~eegeii  561 (562)
                      -....||-+.+...+.-+++|+-||+|.
T Consensus       132 ~~np~yIpk~g~fy~hddsTe~~eg~v~  159 (694)
T KOG4264|consen  132 VENPAYIPKTGRFYMHDDSTENREGDVN  159 (694)
T ss_pred             ccCccccccccccccccccccccccccc
Confidence            3467899999999998899999999984


No 6  
>KOG1677 consensus CCCH-type Zn-finger protein [General function prediction only]
Probab=49.78  E-value=9.5  Score=38.69  Aligned_cols=30  Identities=10%  Similarity=-0.052  Sum_probs=24.8

Q ss_pred             CCCCCCcceeccCCCCcccCCCCccchhhhc
Q 008530          378 MPLNKRGRFQNNYDKRGRYKRKDQFSKEQKL  408 (562)
Q Consensus       378 ~~~~K~CKF~nrGg~RgRcgRKcRFsh~~k~  408 (562)
                      +-+++-|.+|.+.| .|.||..|+|.|....
T Consensus       174 ~~kt~lC~~f~~tG-~C~yG~rC~F~H~~~~  203 (332)
T KOG1677|consen  174 KYKTKLCPKFQKTG-LCKYGSRCRFIHGEPE  203 (332)
T ss_pred             CCCCcCCCccccCC-CCCCCCcCeecCCCcc
Confidence            44889999999974 5779999999998753


No 7  
>KOG2185 consensus Predicted RNA-processing protein, contains G-patch domain [RNA processing and modification]
Probab=41.58  E-value=11  Score=41.62  Aligned_cols=27  Identities=19%  Similarity=0.158  Sum_probs=21.4

Q ss_pred             CCCCcceeccCCCCcccCCCCccchhhhc
Q 008530          380 LNKRGRFQNNYDKRGRYKRKDQFSKEQKL  408 (562)
Q Consensus       380 ~~K~CKF~nrGg~RgRcgRKcRFsh~~k~  408 (562)
                      .-++|+||..+-  ||++-.|||+|-.-+
T Consensus       139 sMkpC~ffLeg~--CRF~enCRfSHG~~V  165 (486)
T KOG2185|consen  139 SMKPCKFFLEGR--CRFGENCRFSHGLDV  165 (486)
T ss_pred             hhccchHhhccc--cccCcccccccCccc
Confidence            346899998875  569999999997654


No 8  
>KOG0943 consensus Predicted ubiquitin-protein ligase/hyperplastic discs protein, HECT superfamily [Posttranslational modification, protein turnover, chaperones]
Probab=34.45  E-value=23  Score=44.17  Aligned_cols=14  Identities=57%  Similarity=0.750  Sum_probs=9.3

Q ss_pred             cccccccccccccc
Q 008530          547 NDEHVRLEEEEGEI  560 (562)
Q Consensus       547 ~d~~~~~~~eegei  560 (562)
                      +|+++.-|.-||||
T Consensus      1781 gdeheQDeqvegei 1794 (3015)
T KOG0943|consen 1781 GDEHEQDEQVEGEI 1794 (3015)
T ss_pred             cccccccccccccc
Confidence            45666666667887


No 9  
>PTZ00415 transmission-blocking target antigen s230; Provisional
Probab=34.19  E-value=23  Score=45.23  Aligned_cols=16  Identities=25%  Similarity=0.160  Sum_probs=8.3

Q ss_pred             CCCCCCCcceeccCCC
Q 008530          377 TMPLNKRGRFQNNYDK  392 (562)
Q Consensus       377 k~~~~K~CKF~nrGg~  392 (562)
                      +....++..|+..||.
T Consensus        59 ~~~~~~~~~~~~~g~~   74 (2849)
T PTZ00415         59 KEGKNKKECFDKNGGI   74 (2849)
T ss_pred             ccCCCcccccccCCCE
Confidence            3334455556656554


No 10 
>PF10446 DUF2457:  Protein of unknown function (DUF2457);  InterPro: IPR018853  This entry represents a family of uncharacterised proteins. 
Probab=33.80  E-value=20  Score=39.89  Aligned_cols=7  Identities=14%  Similarity=0.173  Sum_probs=3.3

Q ss_pred             HHHHHHH
Q 008530          445 TFRFMAI  451 (562)
Q Consensus       445 cIRFLV~  451 (562)
                      +||=|.+
T Consensus        37 ~IRkLge   43 (458)
T PF10446_consen   37 AIRKLGE   43 (458)
T ss_pred             HHhhhhH
Confidence            3555543


No 11 
>KOG3671 consensus Actin regulatory protein (Wiskott-Aldrich syndrome protein) [Signal transduction mechanisms; Cytoskeleton]
Probab=31.42  E-value=42  Score=38.13  Aligned_cols=10  Identities=20%  Similarity=0.494  Sum_probs=8.0

Q ss_pred             HHHHHHHHHH
Q 008530          438 DKSHLLQTFR  447 (562)
Q Consensus       438 Ern~LLQcIR  447 (562)
                      -|..||.-||
T Consensus       494 gR~~LmaqIR  503 (569)
T KOG3671|consen  494 GRDALMAQIR  503 (569)
T ss_pred             cHHHHHHHHH
Confidence            5677899998


No 12 
>KOG1492 consensus C3H1-type Zn-finger protein [General function prediction only]
Probab=29.00  E-value=24  Score=36.64  Aligned_cols=27  Identities=19%  Similarity=0.176  Sum_probs=20.5

Q ss_pred             CCCCCcceeccCCCCcccCCC--Cccchhhhc
Q 008530          379 PLNKRGRFQNNYDKRGRYKRK--DQFSKEQKL  408 (562)
Q Consensus       379 ~~~K~CKF~nrGg~RgRcgRK--cRFsh~~k~  408 (562)
                      +..--||||+..|-   ||++  |||+|++..
T Consensus       204 psavycryynangi---cgkgaacrfvheptr  232 (377)
T KOG1492|consen  204 PSAVYCRYYNANGI---CGKGAACRFVHEPTR  232 (377)
T ss_pred             CceeEEEEecCCCc---ccCCceeeeeccccc
Confidence            44457999998876   6666  999998753


No 13 
>PF01086 Clathrin_lg_ch:  Clathrin light chain;  InterPro: IPR000996 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment. These vesicles have specific coat proteins (such as clathrin or coatomer) that are important for cargo selection and direction of transport []. Clathrin coats contain both clathrin (acts as a scaffold) and adaptor complexes that link clathrin to receptors in coated vesicles. Clathrin-associated protein complexes are believed to interact with the cytoplasmic tails of membrane proteins, leading to their selection and concentration. The two major types of clathrin adaptor complexes are the heterotetrameric adaptor protein (AP) complexes, and the monomeric GGA (Golgi-localising, Gamma-adaptin ear domain homology, ARF-binding proteins) adaptors [, ].  Clathrin is a trimer composed of three heavy chains and three light chains, each monomer projecting outwards like a leg; this three-legged structure is known as a triskelion [, ]. The heavy chains form the legs, their N-terminal beta-propeller regions extending outwards, while their C-terminal alpha-alpha-superhelical regions form the central hub of the triskelion. Peptide motifs can bind between the beta-propeller blades. The light chains appear to have a regulatory role, and may help orient the assembly and disassembly of clathrin coats as they interact with hsc70 uncoating ATPase []. Clathrin triskelia self-polymerise into a curved lattice by twisting individual legs together. The clathrin lattice forms around a vesicle as it buds from the TGN, plasma membrane or endosomes, acting to stabilise the vesicle and facilitate the budding process []. The multiple blades created when the triskelia polymerise are involved in multiple protein interactions, enabling the recruitment of different cargo adaptors and membrane attachment proteins [].  This entry represents clathrin light chains, which are more divergent in sequence than the heavy chains []. In higher eukaryotes, two genes encode distinct but related light chains, each of which can yield two separate forms via alternative splicing. In yeast there is a single light chain whose sequence is only distantly related to that of higher eukaryotes. Clathrin light chains have a conserved acidic N-terminal domain, a central coiled-coil domain and a conserved C-terminal domain.  More information about these proteins can be found at Protein of the Month: Clathrin [].; GO: 0005198 structural molecule activity, 0006886 intracellular protein transport, 0016192 vesicle-mediated transport, 0030130 clathrin coat of trans-Golgi network vesicle, 0030132 clathrin coat of coated pit; PDB: 3LVG_E 3LVH_D.
Probab=28.24  E-value=69  Score=32.02  Aligned_cols=27  Identities=26%  Similarity=0.486  Sum_probs=19.3

Q ss_pred             HHHHHHHHHHHHhcCCChHHHHHHHHH
Q 008530          296 EQEVKQWCEERRKNYPTKANINKKLTE  322 (562)
Q Consensus       296 ~eeI~~WreERrKN~PT~anIe~K~~e  322 (562)
                      ++-|+.|||+|.+.-=-+...++++++
T Consensus       111 ~e~ireWre~~~~~i~ekD~~e~~kk~  137 (225)
T PF01086_consen  111 PEAIREWREERDKRIEEKDAEEEEKKE  137 (225)
T ss_dssp             TTHHHHHHHHHTTTSTHHHHHHHHHHH
T ss_pred             hHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            788999999999876555555544433


No 14 
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism]
Probab=27.02  E-value=2.2e+02  Score=34.95  Aligned_cols=16  Identities=31%  Similarity=0.310  Sum_probs=10.0

Q ss_pred             cCCCcccccccccccc
Q 008530          543 KGNTNDEHVRLEEEEG  558 (562)
Q Consensus       543 ~~~~~d~~~~~~~eeg  558 (562)
                      +-+..++.+.++||.+
T Consensus      1001 ~~~~~k~~~~sde~~~ 1016 (1018)
T KOG2002|consen 1001 KKDRNKELNDSDEESE 1016 (1018)
T ss_pred             ccccchhhcccccccc
Confidence            4455777778875443


No 15 
>PRK10947 global DNA-binding transcriptional dual regulator H-NS; Provisional
Probab=26.61  E-value=2.1e+02  Score=27.13  Aligned_cols=22  Identities=18%  Similarity=0.298  Sum_probs=16.3

Q ss_pred             HHHHHHHHHHHHHhhCCccccC
Q 008530          337 RREQLKEILAKQAELGVEVAEI  358 (562)
Q Consensus       337 RRqqLKEVLAKQaELG~e~aEi  358 (562)
                      |...|.++.+.-.+.|+.+.|+
T Consensus        54 r~~kl~~~r~~m~~~Gis~~eL   75 (135)
T PRK10947         54 RTRKLQQYREMLIADGIDPNEL   75 (135)
T ss_pred             HHHHHHHHHHHHHHcCCCHHHH
Confidence            3345777777788899888886


No 16 
>PF05178 Kri1:  KRI1-like family;  InterPro: IPR018034 The Kri1 protein is also known as KRR1-interacting protein 1. The Saccharomyces cerevisiae member of this family is found to be required for the assembly of preribosomal 40S subunits in the nucleolus []. KRR1 is highly expressed in dividing cells and its expression ceases almost completely when cells enter the stationary phase.
Probab=25.45  E-value=1e+02  Score=27.76  Aligned_cols=46  Identities=24%  Similarity=0.393  Sum_probs=27.5

Q ss_pred             HHHHHhhcCchhhhHHHHHHHHHHHHHHHH-HHhhCCccccCCcccc
Q 008530          318 KKLTEKQSNSDVIDKEAKMRREQLKEILAK-QAELGVEVAEIPSYYL  363 (562)
Q Consensus       318 ~K~~ek~sqs~~~D~EAk~RRqqLKEVLAK-QaELG~e~aEiPs~yL  363 (562)
                      +|.+++....+.+.+-...+|+++.+.|.+ +...|..-..+....|
T Consensus         3 RK~~Ek~~k~eElkrlK~lK~~Ei~~kl~kik~~~G~~~~~~~~~dl   49 (101)
T PF05178_consen    3 RKEEEKQEKEEELKRLKNLKRKEIEEKLEKIKEVAGLEDIDLDEEDL   49 (101)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhCCCccCCCHHHh
Confidence            344444444445566666777777777887 6677765445544444


No 17 
>KOG3241 consensus Uncharacterized conserved protein [Function unknown]
Probab=23.14  E-value=1.7e+02  Score=29.73  Aligned_cols=36  Identities=22%  Similarity=0.174  Sum_probs=20.9

Q ss_pred             ccccccccccCH----HHHHHHHHHHHhcCC-ChHHHHHHH
Q 008530          285 KKRKSLALTYTE----QEVKQWCEERRKNYP-TKANINKKL  320 (562)
Q Consensus       285 ~krks~~l~~t~----eeI~~WreERrKN~P-T~anIe~K~  320 (562)
                      |.|...+.+++.    .|.-.|+-.=.|.-| |.+.+=.|+
T Consensus        33 ~~r~na~~itgVCqRCkEqieWk~KY~KYKpLt~akkC~kC   73 (227)
T KOG3241|consen   33 GGRFNASEITGVCQRCKEQIEWKRKYGKYKPLTEAKKCQKC   73 (227)
T ss_pred             hceehhhHhhhHHHHHHHHHHHHHHhccccccchhHHHHHH
Confidence            456656666665    577788776666666 333333333


No 18 
>PF12728 HTH_17:  Helix-turn-helix domain
Probab=22.39  E-value=43  Score=25.14  Aligned_cols=16  Identities=25%  Similarity=0.677  Sum_probs=14.2

Q ss_pred             cccCHHHHHHHHHHHH
Q 008530          292 LTYTEQEVKQWCEERR  307 (562)
Q Consensus       292 l~~t~eeI~~WreERr  307 (562)
                      +.++.+||.+|+++||
T Consensus        36 ~~~~~~~l~~~~~~~~   51 (51)
T PF12728_consen   36 WRIPKSDLDRWLERRR   51 (51)
T ss_pred             EEEeHHHHHHHHHhCc
Confidence            6789999999999875


No 19 
>PRK10328 DNA binding protein, nucleoid-associated; Provisional
Probab=21.33  E-value=2.9e+02  Score=26.18  Aligned_cols=23  Identities=22%  Similarity=0.330  Sum_probs=16.1

Q ss_pred             HHHHHHHHHHHHHHhhCCccccC
Q 008530          336 MRREQLKEILAKQAELGVEVAEI  358 (562)
Q Consensus       336 ~RRqqLKEVLAKQaELG~e~aEi  358 (562)
                      .|...|.++.+.-++.|+.+.|+
T Consensus        53 er~~~l~~i~~~~~~~Git~eeL   75 (134)
T PRK10328         53 ERQEKINTWLELMKADGINPEEL   75 (134)
T ss_pred             HHHHHHHHHHHHHHHhCCCHHHH
Confidence            34445666666678899888876


No 20 
>COG0620 MetE Methionine synthase II (cobalamin-independent) [Amino acid transport and metabolism]
Probab=21.12  E-value=1.8e+02  Score=30.90  Aligned_cols=46  Identities=17%  Similarity=0.344  Sum_probs=29.9

Q ss_pred             CCChHHHHHHHHHhhcCchhhhHHHHHHHHHHHHHHHHHHhhCCcc
Q 008530          310 YPTKANINKKLTEKQSNSDVIDKEAKMRREQLKEILAKQAELGVEV  355 (562)
Q Consensus       310 ~PT~anIe~K~~ek~sqs~~~D~EAk~RRqqLKEVLAKQaELG~e~  355 (562)
                      ||...-|.+..++-.+-.-..++-.+..+...++++++|.+.|+++
T Consensus        13 fPr~~~l~~a~~~~~~G~i~~ee~~~~~~~~i~~~i~~q~~~Gldv   58 (330)
T COG0620          13 FPRPEELRKAREKWKKGEISEEEYEEILREAIRRAIKDQEEAGLDV   58 (330)
T ss_pred             CCCChhHHHHHHHHHhCCCCHHHHHHHHHHHHHHHHHHHHhcCCcE
Confidence            6666666654443222222234446677788999999999999884


Done!