BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 008568
         (561 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3C5I|A Chain A, Crystal Structure Of Plasmodium Knowlesi Choline Kinase,
           Pkh_134520
 pdb|3C5I|B Chain B, Crystal Structure Of Plasmodium Knowlesi Choline Kinase,
           Pkh_134520
 pdb|3C5I|C Chain C, Crystal Structure Of Plasmodium Knowlesi Choline Kinase,
           Pkh_134520
 pdb|3C5I|D Chain D, Crystal Structure Of Plasmodium Knowlesi Choline Kinase,
           Pkh_134520
          Length = 369

 Score = 30.4 bits (67), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 27/55 (49%), Gaps = 11/55 (20%)

Query: 307 ICLNSVGSWNNELWIHVSKPPENAYIKQIFEGFTNVAEELGFKVGLKHKKINISN 361
           ICL  V  WN     H ++  +N  +KQI  G TN      F+VGLK +  N  N
Sbjct: 20  ICLEKVPEWN-----HFTE--DNLRVKQILSGLTNQL----FEVGLKEETANNYN 63


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.322    0.138    0.411 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 14,741,928
Number of Sequences: 62578
Number of extensions: 536303
Number of successful extensions: 1060
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 1060
Number of HSP's gapped (non-prelim): 1
length of query: 561
length of database: 14,973,337
effective HSP length: 104
effective length of query: 457
effective length of database: 8,465,225
effective search space: 3868607825
effective search space used: 3868607825
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 54 (25.4 bits)