BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 008570
         (561 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3DWB|A Chain A, Structure Of Human Ece-1 Complexed With Phosphoramidon
          Length = 670

 Score = 29.6 bits (65), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 18/68 (26%), Positives = 33/68 (48%), Gaps = 5/68 (7%)

Query: 179 VLFAFIYGLGFATLMASISHVALFEGKTIWQMWRKTTAAVKQQFGDVHTRLMKKNY---- 234
           V++   Y    +TL+ +     L     IW + RKT++ + Q+F D   + M+  Y    
Sbjct: 268 VVYDKEYLEQISTLINTTDRC-LLNNYMIWNLVRKTSSFLDQRFQDADEKFMEVMYGTKK 326

Query: 235 EAVPQWWF 242
            ++P+W F
Sbjct: 327 TSLPRWKF 334


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.329    0.142    0.485 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 16,257,538
Number of Sequences: 62578
Number of extensions: 643012
Number of successful extensions: 1388
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 1388
Number of HSP's gapped (non-prelim): 2
length of query: 561
length of database: 14,973,337
effective HSP length: 104
effective length of query: 457
effective length of database: 8,465,225
effective search space: 3868607825
effective search space used: 3868607825
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 54 (25.4 bits)