Citrus Sinensis ID: 008668


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------
MGNCFACVRPSPETKSKAKTKTDSKTRRKKRATKDRKSNPYSTSPITNPIHSPAPIRVLKDIVPLSHRTRITDKYILGRELGRGEFGITYLCTDRETKEDLACKSISKRKLRTAIDVEDVRREVMIMSTLPHHPNVIKLRATYEDAENVHLVMELCEGGELFDRIVARGHYSERAAAGVARIIMEVVRMCHENGVMHRDLKPENFLFANKKENSPLKAIDFGLSVFFKSGEKFSEIVGSPYYMAPEVLKRNYGPEVDVWSAGVILYILLCGVPPFWAETEQGVALAILRGLIDFKREPWPQISESAKSLVRQMLESDPKKRLTAQQVLEHPWLQNAKKASNVPLGDIVRARLRQFSVMNRFKKRALRVIAEHLSVEEVEVIRDMFKLMDTDSDGKVSYEELKAGLRKVGSQLAEPEMKMLMEVADVDGNGVLDYGEFVAVTIHLQKMENDEHFRRAFMFFDKDGSGYIESDELREALADESGETENDVLNDIMREVDTDKDGRISYEEFVAMMKTGTDWRKASRQYSRERFKSLSLNLMKDGSLQLHDAATGQAIAV
cccccccccccccccccccccccccHHHccccccccccccccccccccccccccccccccccccccccccccccEECccccccccccEEEEEECcccccEEEEEEEEccccccHHHHHHHHHHHHHHHcccccccEEEEEEEEEEcccEEEEEEcccccHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccEEEEccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHcccccccccHHHHHHHHHcccccccccccccccHHHHHHHHHHccccccccccHHHHccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccccccHHHHHHHHHHHcccccHHHHHHHHHHHcccccccECHHHHHHHHccHHHHccHHHHHHHHHHHcccccccccHHHHHHHHHcccccccHHHHHHHHHHccccccccccHHHHHHHHHcccccccccHHHHHHcccccccccccccccccccccccccccc
******************************************************************HRTRITDKYILGRELGRGEFGITYLCTDRETKEDLACKSISKRKLRTAIDVEDVRREVMIMSTLPHHPNVIKLRATYEDAENVHLVMELCEGGELFDRIVARGHYSERAAAGVARIIMEVVRMCHENGVMHRDLKPENFLFANKKENSPLKAIDFGLSVFFKSGEKFSEIVGSPYYMAPEVLKRNYGPEVDVWSAGVILYILLCGVPPFWAETEQGVALAILRGLIDFKREPWPQISESAKSLVRQMLESDPKKRLTAQQVLEHPWLQNAKKASNVPLGDIVRARLRQFSVMNRFKKRALRVIAEHLSVEEVEVIRDMFKLMDTDSDGKVSYEELKAGLRKVGSQLAEPEMKMLMEVADVDGNGVLDYGEFVAVTIHLQKMENDEHFRRAFMFFDKDGSGYIESDELREALADES*ETENDVLNDIMREVDTDKDGRISYEEFVAMMKT******************************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGNCFACVRPSPETKSKAKTKTDSKTRRKKRATKDRKSNPYSTSPITNPIHSPAPIRVLKDIVPLSHRTRITDKYILGRELGRGEFGITYLCTDRETKEDLACKSISKRKLRTAIDVEDVRREVMIMSTLPHHPNVIKLRATYEDAENVHLVMELCEGGELFDRIVARGHYSERAAAGVARIIMEVVRMCHENGVMHRDLKPENFLFANKKENSPLKAIDFGLSVFFKSGEKFSEIVGSPYYMAPEVLKRNYGPEVDVWSAGVILYILLCGVPPFWAETEQGVALAILRGLIDFKREPWPQISESAKSLVRQMLESDPKKRLTAQQVLEHPWLQNAKKASNVPLGDIVRARLRQFSVMNRFKKRALRVIAEHLSVEEVEVIRDMFKLMDTDSDGKVSYEELKAGLRKVGSQLAEPEMKMLMEVADVDGNGVLDYGEFVAVTIHLQKMENDEHFRRAFMFFDKDGSGYIESDELREALADESGETENDVLNDIMREVDTDKDGRISYEEFVAMMKTGTDWRKASRQYSRERFKSLSLNLMKDGSLQLHDAATGQAIAV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Calcium-dependent protein kinase 30 May play a role in signal transduction pathways that involve calcium as a second messenger. May be a positive regulator controlling stress signal transduction. Acts as a calcium sensor involved in the hormone-signaling pathways.confidentQ9SSF8
Calcium-dependent protein kinase 4 Regulates the production of reactive oxygen species (ROS) by NADPH oxidase.probableA5A7I7
Calcium-dependent protein kinase 10 May play a role in signal transduction pathways that involve calcium as a second messenger. May be a positive regulator controlling stress signal transduction.probableQ9M9V8

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
2.-.-.-Transferases.probable
2.7.-.-Transferring phosphorous-containing groups.probable
2.7.11.-Protein-serine/threonine kinases.probable
2.7.11.1Transferred entry: 2.7.11.19.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2W4O, chain A
Confidence level:very confident
Coverage over the Query: 67-108,124-222,239-359
View the alignment between query and template
View the model in PyMOL
Template: 1Y1X, chain A
Confidence level:very confident
Coverage over the Query: 379-544
View the alignment between query and template
View the model in PyMOL
Template: 3Q5I, chain A
Confidence level:very confident
Coverage over the Query: 66-516
View the alignment between query and template
View the model in PyMOL