BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 008674
(557 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|1NKQ|A Chain A, Crystal Structure Of Yeast Ynq8, A Fumarylacetoacetate
Hydrolase Family Protein
pdb|1NKQ|B Chain B, Crystal Structure Of Yeast Ynq8, A Fumarylacetoacetate
Hydrolase Family Protein
pdb|1NKQ|C Chain C, Crystal Structure Of Yeast Ynq8, A Fumarylacetoacetate
Hydrolase Family Protein
pdb|1NKQ|D Chain D, Crystal Structure Of Yeast Ynq8, A Fumarylacetoacetate
Hydrolase Family Protein
pdb|1NKQ|E Chain E, Crystal Structure Of Yeast Ynq8, A Fumarylacetoacetate
Hydrolase Family Protein
pdb|1NKQ|F Chain F, Crystal Structure Of Yeast Ynq8, A Fumarylacetoacetate
Hydrolase Family Protein
Length = 259
Score = 30.4 bits (67), Expect = 2.7, Method: Compositional matrix adjust.
Identities = 17/55 (30%), Positives = 30/55 (54%), Gaps = 1/55 (1%)
Query: 248 AERIRQVQQSSARQPSTYVLPTPIDAKVPISSSVAPRTRPSNPSGRTYNLSHSSP 302
A I+++ S+ +QP ++ PT P+SSS+ TRP+N + N ++P
Sbjct: 20 AAHIKELNNSTPKQPFFFLKPTS-SIVTPLSSSLVKTTRPANSTFNGLNEDGTNP 73
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.311 0.126 0.348
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 13,598,132
Number of Sequences: 62578
Number of extensions: 481122
Number of successful extensions: 747
Number of sequences better than 100.0: 8
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 8
Number of HSP's that attempted gapping in prelim test: 747
Number of HSP's gapped (non-prelim): 8
length of query: 557
length of database: 14,973,337
effective HSP length: 104
effective length of query: 453
effective length of database: 8,465,225
effective search space: 3834746925
effective search space used: 3834746925
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 54 (25.4 bits)