Citrus Sinensis ID: 008684


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------
MDGYSGKRAIDGLVVSRKSSGIVLRDTVNNREKNAQICSRIGCSSRLNSMKGTQIGCSEKAKSSRPSFGSSSSGKEIIGSSSRTCSVLSKAGKSSTNPKKKQPSQLETDSSETSSVHDEPDVSELVVPPGKIQRGLLPTSEDSDSREVILMEEGRSSVASNSRSRRTFHQRSGVGSRDVLVGSSVSLASRNTSPATSTNTSRRGLRNLRCSSISDIIPSSSSSSTLSDSSLSRRRDMVKKRNSEGESSSSSGGKTTSETSSEMRNHGSNYGISICDSRRARNWPPNRDNGVASVRTRRSTNSNSRARLSNQGNGNSLAPNESSVVISRVPESEIPVDSSVPTSSLRFSAETPSIRPSSYSRPGSSGGGLRGLMPGSPSDVGGITGSVINRDNFARYNIDGIAEVLLALERIEQDEELSYEQLLVLETNLLLNGLSFHDQHRDMRLDIDNMSYEELLALEERMGTVSTALTDEAILKCLKTSIYQPAPLDVALSCSGNNDDVKCSICQEEYVVGEEVGRLHCQHRYHVLCIQQWLRLTNWCPICKAPAESAPSSPSSS
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccccccccccccccccccccHHHHHHHHHHcccccccccHHHHHHHcccEEccccccccccccccccccccccEEccccccccEEEEEccccccHHHHHHHHHHcccccccccccccccccccccc
cccccccccccccEEEcccccEEEEccccccccccccccccccccEcccccccccccccccccccccccccccccEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccEEEcccccccccccccEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHcccccccHHHHEEEcccHHcccccccccccccccccccccHHHHHHHHHHcccccccccHHHHHHHccccEEcccccccccccccccccccEEEEEHHcccccccEEEcccccHHHHHHHHHHHHHcccccEEcEEcccccccccc
mdgysgkraidGLVVSRKSSGIVLRDTVNNREKNAQICSrigcssrlnsmkgtqigcsekakssrpsfgssssgkeiigsssrtcsvlskagksstnpkkkqpsqletdssetssvhdepdvselvvppgkiqrgllptsedsdsrEVILMEEgrssvasnsrsrrtfhqrsgvgsrdvlVGSSVslasrntspatstntsrrglrnlrcssisdiipsssssstlsdsslSRRRDMVKkrnsegesssssggkttseTSSEmrnhgsnygisicdsrrarnwppnrdngvasvrtrrstnsnsrarlsnqgngnslapnessvvisrvpeseipvdssvptsslrfsaetpsirpssysrpgssggglrglmpgspsdvggitgsvinrdnfarynIDGIAEVLLALERIEQDEELSYEQLLVLETNLLlnglsfhdqhrdmrldidnMSYEELLALEERMGTVSTALTDEAILKCLKtsiyqpapldvalscsgnnddvkcsicqeeyvvgeevgrlhcqhRYHVLCIQQWLRltnwcpickapaesapsspsss
mdgysgkraidglvvsrkssgivlrdtvnnreknaqicsrigcssrlnsMKGTQIGcsekakssrpsfgssssgkeiigsssrtCSVLskagksstnpkkkqpsqletdssetssvhdepdvselvvppgkiqrgllptsedsdsrEVILMEegrssvasnsrsrrtfhqrsgvgsrdvlvgssvslasrntspatstntsrrglrnLRCSsisdiipsssssstlsdsslsrrRDMVkkrnsegesssssggkttsetssemrnhgsnygisicdsrrarnwppnrdngvasvrtrrstnsnsrarlsnqgngnslapneSSVVISRVPeseipvdssvptsslrfsaetpsirpssysrpgSSGGGLRGLMPGSPSDVGGITGSVINRDNFARYNIDGIAEVLLALERIEQDEELSYEQLLVLETNLLLNGLSFHDQHRDMRLDIDNMSYEELLALEERMGTVSTALTDEAILKCLKTSIYQPAPLDVALSCSGNNDDVKCSICQEEYVVGEEVGRLHCQHRYHVLCIQQWLRLTNWCPICKapaesapsspsss
MDGYSGKRAIDGLVVSRKSSGIVLRDTVNNREKNAQICSRIGCSSRLNSMKGTQIGCSEKAkssrpsfgssssgkeiigsssrTCSVLSKAGKSSTNPKKKQPSQLETDSSETSSVHDEPDVSELVVPPGKIQRGLLPTSEDSDSREVILMEEGrssvasnsrsrrTFHQRSGVGSRDVLVGSSVSLASRNTSPATSTNTSRRGLRNLRCssisdiipsssssstlsdsslsrrrdMVKKRNsegesssssggkttsetsseMRNHGSNYGISICDSRRARNWPPNRDNGvasvrtrrstnsnsrarLSNQGNGNSLAPNESSVVISRVPESEIPVDSSVPTSSLRFSAETpsirpssysrpgssggglrglmpgspsDVGGITGSVINRDNFARYNIDGIAEVLLALERIEQDEELSYEQllvletnlllnglSFHDQHRDMRLDIDNMSYEELLALEERMGTVSTALTDEAILKCLKTSIYQPAPLDVALSCSGNNDDVKCSICQEEYVVGEEVGRLHCQHRYHVLCIQQWLRLTNWCPICKapaesapsspsss
************LVV*****GIVLRDTV******AQICSRIGC*************************************************************************************************************************************************************************************************************************************************************************************************************************************************GGITGSVINRDNFARYNIDGIAEVLLALERIEQDEELSYEQLLVLETNLLLNGLSFHDQHRDMRLDIDNMSYEELLALEERMGTVSTALTDEAILKCLKTSIYQPAPLDVALSCSGNNDDVKCSICQEEYVVGEEVGRLHCQHRYHVLCIQQWLRLTNWCPICK*************
*******************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************NLLLN********RDMRLDIDNMSYEELLALEERMGTVSTALTDEAILKCLKTSIYQPA************DDVKCSICQEEYVVGEEVGRLHCQHRYHVLCIQQWLRLTNWCPIC**************
MDGYSGKRAIDGLVVSRKSSGIVLRDTVNNREKNAQICSRIGCSSRLNSMKGTQ********************************************************************SELVVPPGKIQRGLLPTSEDSDSREVILMEE***********************RDVLVGSSVSLA**************RGLRNLRCSSISDI************************************************NHGSNYGISICDSRRARNWPPNRDNG*********************************VVISRVPE*************************************LRGLMPGSPSDVGGITGSVINRDNFARYNIDGIAEVLLALERIEQDEELSYEQLLVLETNLLLNGLSFHDQHRDMRLDIDNMSYEELLALEERMGTVSTALTDEAILKCLKTSIYQPAPLDVALSCSGNNDDVKCSICQEEYVVGEEVGRLHCQHRYHVLCIQQWLRLTNWCPICKA************
**********DGLVVSRKSSGIVLRDTVNNREKNAQICSRIGCSSRLNS*K*******************************************************************************KIQRG*******S***E*****************************************************************************************************************************************************************************************************************************************GGITGSVINRDNFARYNIDGIAEVLLALERIEQDEELSYEQLLVLETNLLLNGLSFHDQHRDMRLDIDNMSYEELLALEERMGTVSTALTDEAILKCLKTSIYQP**************DVKCSICQEEYVVGEEVGRLHCQHRYHVLCIQQWLRLTNWCPICKAPAE*********
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDGYSGKRAIDGLVVSRKSSGIVLRDTVNNREKNAQICSRIGCSSRLNSMKGTQIGCSEKAKSSRPSFGSSSSGKEIIGSSSRTCSVLSKAGKSSTNPKKKQPSQLETDSSETSSVHDEPDVSELVVPPGKIQRGLLPTSEDSDSREVILMEEGRSSVASNSRSRRTFHQRSGVGSRDVLVGSSVSLASRNTSPATSTNTSRRGLRNLRCSSISDIIPSSSSSSTLSDSSLSRRRDMVKKRNSEGESSSSSGGKTTSETSSEMRNHGSNYGISICDSRRARNWPPNRDNGVASVRTRRSTNSNSRARLSNQGNGNSLAPNESSVVISRVPESEIPVDSSVPTSSLRFSAETPSIRPSSYSRPGSSGGGLRGLMPGSPSDVGGITGSVINRDNFARYNIDGIAEVLLALERIEQDEELSYEQLLVLETNLLLNGLSFHDQHRDMRLDIDNMSYEELLALEERMGTVSTALTDEAILKCLKTSIYQPAPLDVALSCSGNNDDVKCSICQEEYVVGEEVGRLHCQHRYHVLCIQQWLRLTNWCPICKAPAESAPSSPSSS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query557 2.2.26 [Sep-21-2011]
Q8L649248 E3 ubiquitin ligase BIG B no no 0.183 0.411 0.361 6e-11
E9QAU8347 RING finger protein 165 O yes no 0.170 0.273 0.373 9e-11
Q6ZSG1346 RING finger protein 165 O yes no 0.170 0.274 0.373 1e-10
Q5R476986 E3 ubiquitin-protein liga yes no 0.199 0.112 0.319 4e-10
Q6ZNA4994 E3 ubiquitin-protein liga no no 0.199 0.111 0.315 5e-10
Q99ML9989 E3 ubiquitin-protein liga no no 0.199 0.112 0.315 5e-10
Q9LT17340 E3 ubiquitin ligase BIG B no no 0.186 0.305 0.348 7e-10
Q0V9R0954 E3 ubiquitin-protein liga no no 0.168 0.098 0.314 2e-09
Q66J97967 E3 ubiquitin-protein liga N/A no 0.168 0.097 0.314 2e-09
Q6NRV8959 E3 ubiquitin-protein liga N/A no 0.168 0.098 0.314 2e-09
>sp|Q8L649|BB_ARATH E3 ubiquitin ligase BIG BROTHER OS=Arabidopsis thaliana GN=BB PE=1 SV=1 Back     alignment and function desciption
 Score = 69.7 bits (169), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 39/108 (36%), Positives = 57/108 (52%), Gaps = 6/108 (5%)

Query: 445 LDIDNMSYEELLALEERMGTVSTALTDEAILKCLKTSIYQPAPLDVALSCSGNNDDVKCS 504
           +D D M+YEEL+ L E +GT S  L+ E +++ L T  Y+   +      S      +C 
Sbjct: 145 IDPDTMTYEELVELGEAVGTESRGLSQE-LIETLPTKKYKFGSI-----FSRKRAGERCV 198

Query: 505 ICQEEYVVGEEVGRLHCQHRYHVLCIQQWLRLTNWCPICKAPAESAPS 552
           ICQ +Y +GE    L C+H YH  CI +WL +   CP+C +     PS
Sbjct: 199 ICQLKYKIGERQMNLPCKHVYHSECISKWLSINKVCPVCNSEVFGEPS 246




E3 ubiquitin-ligase that limits organ size, and possibly seed size, in a dose-dependent manner. Negatively regulates the duration of cell proliferation in leaves and petals independently of the major phytohormones (e.g. auxin, cytokinin, gibberellin, brassinosteroids, ethylene, abscisic acid, jasmonic acid), probably by targeting growth stimulators for degradation.
Arabidopsis thaliana (taxid: 3702)
EC: 6EC: .EC: 3EC: .EC: 2EC: .EC: -
>sp|E9QAU8|RN165_MOUSE RING finger protein 165 OS=Mus musculus GN=Rnf165 PE=2 SV=1 Back     alignment and function description
>sp|Q6ZSG1|RN165_HUMAN RING finger protein 165 OS=Homo sapiens GN=RNF165 PE=1 SV=1 Back     alignment and function description
>sp|Q5R476|RN111_PONAB E3 ubiquitin-protein ligase Arkadia OS=Pongo abelii GN=RNF111 PE=2 SV=1 Back     alignment and function description
>sp|Q6ZNA4|RN111_HUMAN E3 ubiquitin-protein ligase Arkadia OS=Homo sapiens GN=RNF111 PE=1 SV=3 Back     alignment and function description
>sp|Q99ML9|RN111_MOUSE E3 ubiquitin-protein ligase Arkadia OS=Mus musculus GN=Rnf111 PE=1 SV=1 Back     alignment and function description
>sp|Q9LT17|BBR_ARATH E3 ubiquitin ligase BIG BROTHER-related OS=Arabidopsis thaliana GN=BBR PE=2 SV=1 Back     alignment and function description
>sp|Q0V9R0|RN111_XENTR E3 ubiquitin-protein ligase arkadia OS=Xenopus tropicalis GN=rnf111 PE=2 SV=1 Back     alignment and function description
>sp|Q66J97|R111C_XENLA E3 ubiquitin-protein ligase arkadia-C OS=Xenopus laevis GN=rnf111-c PE=2 SV=1 Back     alignment and function description
>sp|Q6NRV8|R111B_XENLA E3 ubiquitin-protein ligase arkadia-B OS=Xenopus laevis GN=rnf111-b PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query557
225429764550 PREDICTED: uncharacterized protein LOC10 0.967 0.98 0.616 1e-173
255548564554 ring finger protein, putative [Ricinus c 0.976 0.981 0.611 1e-167
356515537541 PREDICTED: uncharacterized protein LOC10 0.964 0.992 0.561 1e-159
356507825542 PREDICTED: uncharacterized protein LOC10 0.964 0.990 0.540 1e-151
356554417534 PREDICTED: uncharacterized protein LOC10 0.953 0.994 0.549 1e-149
224115668543 predicted protein [Populus trichocarpa] 0.965 0.990 0.579 1e-147
356561875532 PREDICTED: uncharacterized protein LOC10 0.937 0.981 0.540 1e-146
449499531549 PREDICTED: LOW QUALITY PROTEIN: uncharac 0.971 0.985 0.503 1e-131
449441992549 PREDICTED: uncharacterized protein LOC10 0.971 0.985 0.503 1e-131
296081756403 unnamed protein product [Vitis vinifera] 0.714 0.987 0.526 1e-120
>gi|225429764|ref|XP_002280551.1| PREDICTED: uncharacterized protein LOC100245643 [Vitis vinifera] Back     alignment and taxonomy information
 Score =  613 bits (1582), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 343/556 (61%), Positives = 422/556 (75%), Gaps = 17/556 (3%)

Query: 1   MDGYSGKRAIDGLVVSRKSSG----IVLRDTVNNREKNAQICSRIGCSSRLNSMKGTQIG 56
           MD YSGKRAI+ LVVSRK SG    ++LRDT NNR++NAQ C+R+GC  RLNSMKGTQ+G
Sbjct: 1   MDEYSGKRAINELVVSRKGSGLRPGVILRDTANNRDRNAQFCNRLGCRGRLNSMKGTQLG 60

Query: 57  CSEKAKSSRPSFGSSSSGKEIIGSSSRTCSVLSKAGKSSTNPKKKQPSQLETDSSETSSV 116
             EK KSSRPS  +SSSGKEIIGSSS T   + K+ ++   P+KK  + LETDSSETSSV
Sbjct: 61  SLEKPKSSRPSSFTSSSGKEIIGSSSSTGPSVRKSLQT---PRKKLSAHLETDSSETSSV 117

Query: 117 HDEPDVSELVVPPGKIQRGLLPTSEDSDSREVILMEEGRSSVASNSRSRRTFHQRSGVGS 176
            DE +V EL+ PPGKIQRG  P ++D++S E+  ME G SS+ASN+R RR FHQ+SG  +
Sbjct: 118 PDESEVLELIPPPGKIQRGHHPKADDTESSEITPMEVGSSSIASNTRPRRNFHQKSGFTN 177

Query: 177 RDVLVGSSVSLASRNTSPAT--STNTSRRGLRNLRCSSISDIIPSSSSSSTLSDSSLSRR 234
           +  L+GSSV+LAS+          N SR GLRNLRC+SISD +PS SSS    +S+L+R+
Sbjct: 178 QATLMGSSVALASKTAGQVARHGANASRYGLRNLRCNSISDAMPSCSSS----ESNLTRK 233

Query: 235 RDMVKKRNSEGESSSSSGGKTTSETSSEM-RNHGSNYGISICDSRRARNWPPNRDNGVAS 293
           +D+ KKR SE ESSSS+ GK +   SSE  RN  S+YG+SI DSRR+RNW P+RDNGVAS
Sbjct: 234 KDIGKKRLSEIESSSSARGKKSGGPSSEYGRNSISSYGVSISDSRRSRNWTPSRDNGVAS 293

Query: 294 VRTRRSTNSN-SRARLSNQGNGNSLAPNESSVVISRVPESEIPVDSSVPTSSLRFSAETP 352
           VRTRRS N N SR   SNQG  N+L P E S+ I ++P+ EI + ++ P+ S +FS  +P
Sbjct: 294 VRTRRSINGNTSRPSSSNQGIRNNLLPTEPSITIPQMPQPEISIGANDPSLSHQFSIGSP 353

Query: 353 SIRPSSYSRPGSSGGGLRGLMPGSPSDVGGITGSVINRDNFARYNIDGIAEVLLALERIE 412
           S   +SYS+  SS   L  +MP SP++VG I+ S +NRD+  RYN+DGIAEVLLALERIE
Sbjct: 354 SSFLNSYSQSDSSSENLHSIMPISPTEVG-ISRSSMNRDSLRRYNMDGIAEVLLALERIE 412

Query: 413 QDEELSYEQLLVLETNLLLNGLSFHDQHRDMRLDIDNMSYEELLALEERMGTVSTALTDE 472
           QDEEL+YEQLLVLETNL L GLSFHDQHR+MRLDIDNMSYEELLALEE+MGTVSTALT+E
Sbjct: 413 QDEELTYEQLLVLETNLFLGGLSFHDQHREMRLDIDNMSYEELLALEEKMGTVSTALTEE 472

Query: 473 AILKCLKTSIYQPAPLDVA-LSCSGNNDDVKCSICQEEYVVGEEVGRLHCQHRYHVLCIQ 531
           A+ KCL+ SIY   P +   + C+G+ DDVKCSICQEEY+VG+EVG+L C+H YHV CI 
Sbjct: 473 ALSKCLERSIYHTLPTEPGTMDCAGDGDDVKCSICQEEYMVGDEVGKLQCEHGYHVACIH 532

Query: 532 QWLRLTNWCPICKAPA 547
           QWLRL NWCP+CKA A
Sbjct: 533 QWLRLKNWCPVCKASA 548




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|255548564|ref|XP_002515338.1| ring finger protein, putative [Ricinus communis] gi|223545282|gb|EEF46787.1| ring finger protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|356515537|ref|XP_003526456.1| PREDICTED: uncharacterized protein LOC100819874 [Glycine max] Back     alignment and taxonomy information
>gi|356507825|ref|XP_003522664.1| PREDICTED: uncharacterized protein LOC100787213 [Glycine max] Back     alignment and taxonomy information
>gi|356554417|ref|XP_003545543.1| PREDICTED: uncharacterized protein LOC100812055 [Glycine max] Back     alignment and taxonomy information
>gi|224115668|ref|XP_002332113.1| predicted protein [Populus trichocarpa] gi|222874933|gb|EEF12064.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356561875|ref|XP_003549202.1| PREDICTED: uncharacterized protein LOC100803211 [Glycine max] Back     alignment and taxonomy information
>gi|449499531|ref|XP_004160841.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101224320 [Cucumis sativus] Back     alignment and taxonomy information
>gi|449441992|ref|XP_004138766.1| PREDICTED: uncharacterized protein LOC101206272 [Cucumis sativus] Back     alignment and taxonomy information
>gi|296081756|emb|CBI20761.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms


Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00032325001
SubName- Full=Chromosome chr4 scaffold_6, whole genome shotgun sequence; (509 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query557
pfam1363946 pfam13639, zf-RING_2, Ring finger domain 2e-14
cd0016245 cd00162, RING, RING-finger (Really Interesting New 1e-10
pfam1267873 pfam12678, zf-rbx1, RING-H2 zinc finger 3e-09
smart0018440 smart00184, RING, Ring finger 2e-08
pfam1392345 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RI 4e-07
pfam0009740 pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING 1e-05
COG5540374 COG5540, COG5540, RING-finger-containing ubiquitin 2e-05
COG5243 491 COG5243, HRD1, HRD ubiquitin ligase complex, ER me 1e-04
COG519488 COG5194, APC11, Component of SCF ubiquitin ligase 2e-04
>gnl|CDD|222279 pfam13639, zf-RING_2, Ring finger domain Back     alignment and domain information
 Score = 67.4 bits (165), Expect = 2e-14
 Identities = 22/44 (50%), Positives = 30/44 (68%)

Query: 503 CSICQEEYVVGEEVGRLHCQHRYHVLCIQQWLRLTNWCPICKAP 546
           C IC +E+  GEEV  L C H +H  C+ +WLR +N CP+C+AP
Sbjct: 3   CPICLDEFEPGEEVVVLPCGHVFHKECLDKWLRSSNTCPLCRAP 46


Length = 46

>gnl|CDD|238093 cd00162, RING, RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>gnl|CDD|221705 pfam12678, zf-rbx1, RING-H2 zinc finger Back     alignment and domain information
>gnl|CDD|214546 smart00184, RING, Ring finger Back     alignment and domain information
>gnl|CDD|206094 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RING finger) Back     alignment and domain information
>gnl|CDD|215715 pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING finger) Back     alignment and domain information
>gnl|CDD|227827 COG5540, COG5540, RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|227568 COG5243, HRD1, HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|227521 COG5194, APC11, Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 557
KOG4628348 consensus Predicted E3 ubiquitin ligase [Posttrans 99.55
PF1363944 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 99.47
PF1267873 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 99.19
COG5243 491 HRD1 HRD ubiquitin ligase complex, ER membrane com 99.17
COG5540374 RING-finger-containing ubiquitin ligase [Posttrans 99.16
PHA02929238 N1R/p28-like protein; Provisional 99.15
cd0016245 RING RING-finger (Really Interesting New Gene) dom 98.92
PF1392050 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); 98.87
PF1392339 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); 98.84
PLN03208 193 E3 ubiquitin-protein ligase RMA2; Provisional 98.83
KOG0802 543 consensus E3 ubiquitin ligase [Posttranslational m 98.79
KOG0317293 consensus Predicted E3 ubiquitin ligase, integral 98.77
PF1286185 zf-Apc11: Anaphase-promoting complex subunit 11 RI 98.71
KOG0823 230 consensus Predicted E3 ubiquitin ligase [Posttrans 98.69
smart0018439 RING Ring finger. E3 ubiquitin-protein ligase acti 98.66
PHA02926242 zinc finger-like protein; Provisional 98.6
PF1463444 zf-RING_5: zinc-RING finger domain 98.58
PF0009741 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I 98.58
smart0050463 Ubox Modified RING finger domain. Modified RING fi 98.57
KOG0320187 consensus Predicted E3 ubiquitin ligase [Posttrans 98.53
PF1522742 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 98.5
TIGR00599 397 rad18 DNA repair protein rad18. This family is bas 98.48
COG519488 APC11 Component of SCF ubiquitin ligase and anapha 98.33
smart0074449 RINGv The RING-variant domain is a C4HC3 zinc-fing 98.21
PF1344543 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. 98.19
KOG149384 consensus Anaphase-promoting complex (APC), subuni 98.17
KOG0828636 consensus Predicted E3 ubiquitin ligase [Posttrans 98.17
COG5574271 PEX10 RING-finger-containing E3 ubiquitin ligase [ 98.14
KOG1734328 consensus Predicted RING-containing E3 ubiquitin l 98.11
KOG2177 386 consensus Predicted E3 ubiquitin ligase [Posttrans 98.1
KOG2164 513 consensus Predicted E3 ubiquitin ligase [Posttrans 98.09
KOG0287 442 consensus Postreplication repair protein RAD18 [Re 98.03
PF0456473 U-box: U-box domain; InterPro: IPR003613 Quality c 97.95
KOG0827 465 consensus Predicted E3 ubiquitin ligase [Posttrans 97.89
PF1179370 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. 97.88
COG5432 391 RAD18 RING-finger-containing E3 ubiquitin ligase [ 97.87
KOG0804 493 consensus Cytoplasmic Zn-finger protein BRAP2 (BRC 97.86
TIGR00570 309 cdk7 CDK-activating kinase assembly factor MAT1. A 97.83
COG52191525 Uncharacterized conserved protein, contains RING Z 97.76
KOG2930114 consensus SCF ubiquitin ligase, Rbx1 component [Po 97.69
KOG4265349 consensus Predicted E3 ubiquitin ligase [Posttrans 97.6
KOG0825 1134 consensus PHD Zn-finger protein [General function 97.55
KOG0311 381 consensus Predicted E3 ubiquitin ligase [Posttrans 97.48
KOG1645 463 consensus RING-finger-containing E3 ubiquitin liga 97.42
KOG4445 368 consensus Uncharacterized conserved protein, conta 97.4
KOG1039 344 consensus Predicted E3 ubiquitin ligase [Posttrans 97.26
PF1483565 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM 97.23
KOG1428 3738 consensus Inhibitor of type V adenylyl cyclases/Ne 97.17
KOG417262 consensus Predicted E3 ubiquitin ligase [Posttrans 96.96
KOG0824 324 consensus Predicted E3 ubiquitin ligase [Posttrans 96.95
KOG0978698 consensus E3 ubiquitin ligase involved in syntaxin 96.79
KOG4275350 consensus Predicted E3 ubiquitin ligase [Posttrans 96.74
PF1178957 zf-Nse: Zinc-finger of the MIZ type in Nse subunit 96.68
KOG1941518 consensus Acetylcholine receptor-associated protei 96.54
KOG4159 398 consensus Predicted E3 ubiquitin ligase [Posttrans 96.52
KOG0297 391 consensus TNF receptor-associated factor [Signal t 96.48
KOG1785 563 consensus Tyrosine kinase negative regulator CBL [ 96.42
KOG3970 299 consensus Predicted E3 ubiquitin ligase [Posttrans 96.28
KOG2660 331 consensus Locus-specific chromosome binding protei 96.24
PF1290647 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A. 95.96
KOG2879298 consensus Predicted E3 ubiquitin ligase [Posttrans 95.88
PF05883134 Baculo_RING: Baculovirus U-box/Ring-like domain; I 95.72
KOG0801205 consensus Predicted E3 ubiquitin ligase [Posttrans 95.63
PF10367109 Vps39_2: Vacuolar sorting protein 39 domain 2; Int 95.53
COG5152259 Uncharacterized conserved protein, contains RING a 95.36
KOG1814 445 consensus Predicted E3 ubiquitin ligase [Posttrans 95.35
KOG1002 791 consensus Nucleotide excision repair protein RAD16 95.26
KOG4692489 consensus Predicted E3 ubiquitin ligase [Posttrans 95.24
KOG0827 465 consensus Predicted E3 ubiquitin ligase [Posttrans 95.11
KOG3039303 consensus Uncharacterized conserved protein [Funct 95.04
KOG1940276 consensus Zn-finger protein [General function pred 94.86
PHA02862156 5L protein; Provisional 94.84
KOG1571355 consensus Predicted E3 ubiquitin ligase [Posttrans 94.83
PHA03096284 p28-like protein; Provisional 94.48
KOG2114933 consensus Vacuolar assembly/sorting protein PEP5/V 94.47
PHA02825162 LAP/PHD finger-like protein; Provisional 94.33
KOG1813313 consensus Predicted E3 ubiquitin ligase [Posttrans 94.09
COG5222427 Uncharacterized conserved protein, contains RING Z 93.98
KOG4185 296 consensus Predicted E3 ubiquitin ligase [Posttrans 93.89
PF04641260 Rtf2: Rtf2 RING-finger 93.87
KOG3268234 consensus Predicted E3 ubiquitin ligase [Posttrans 93.6
COG5236 493 Uncharacterized conserved protein, contains RING Z 93.54
PF10272358 Tmpp129: Putative transmembrane protein precursor; 93.05
PF1457048 zf-RING_4: RING/Ubox like zinc-binding domain; PDB 92.98
KOG1952 950 consensus Transcription factor NF-X1, contains NFX 92.94
PF0874643 zf-RING-like: RING-like domain; InterPro: IPR01485 92.81
COG5175 480 MOT2 Transcriptional repressor [Transcription] 91.71
PF0385450 zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc 91.36
KOG1001 674 consensus Helicase-like transcription factor HLTF/ 90.63
KOG0298 1394 consensus DEAD box-containing helicase-like transc 89.94
PF07800162 DUF1644: Protein of unknown function (DUF1644); In 89.6
KOG2932 389 consensus E3 ubiquitin ligase involved in ubiquiti 89.5
KOG2034911 consensus Vacuolar sorting protein PEP3/VPS18 [Int 88.68
KOG1609 323 consensus Protein involved in mRNA turnover and st 88.5
KOG0826357 consensus Predicted E3 ubiquitin ligase involved i 87.91
PF1444755 Prok-RING_4: Prokaryotic RING finger family 4 87.7
KOG03091081 consensus Conserved WD40 repeat-containing protein 87.21
KOG0825 1134 consensus PHD Zn-finger protein [General function 85.95
KOG3002 299 consensus Zn finger protein [General function pred 85.66
KOG1829580 consensus Uncharacterized conserved protein, conta 85.65
COG5220 314 TFB3 Cdk activating kinase (CAK)/RNA polymerase II 85.65
COG5183 1175 SSM4 Protein involved in mRNA turnover and stabili 83.94
KOG1812 384 consensus Predicted E3 ubiquitin ligase [Posttrans 82.96
KOG3053 293 consensus Uncharacterized conserved protein [Funct 81.88
KOG0269839 consensus WD40 repeat-containing protein [Function 80.81
>KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
Probab=99.55  E-value=3.2e-15  Score=156.10  Aligned_cols=78  Identities=31%  Similarity=0.731  Sum_probs=61.3

Q ss_pred             CCHHHHHhhccceeccCCCcccccccCCCCCCccccccccccccCceeEEeCCCCcchHHHHHHHHhcCC-CCCCCCCCC
Q 008684          469 LTDEAILKCLKTSIYQPAPLDVALSCSGNNDDVKCSICQEEYVVGEEVGRLHCQHRYHVLCIQQWLRLTN-WCPICKAPA  547 (557)
Q Consensus       469 LSee~I~k~Lp~~~y~~~~~e~~~~~~~~~ed~~CsICLEeF~~geeV~~LPCgH~FH~~CI~~WL~~k~-SCPVCR~eV  547 (557)
                      +.+..+ +.++...|+..+       ..... ..|+||||+|..||+++.|||.|.||..||++||.++. .|||||.++
T Consensus       207 ~~k~~l-~~~p~~~f~~~~-------~~~~~-~~CaIClEdY~~GdklRiLPC~H~FH~~CIDpWL~~~r~~CPvCK~di  277 (348)
T KOG4628|consen  207 LIKRLL-KKLPVRTFTKGD-------DEDAT-DTCAICLEDYEKGDKLRILPCSHKFHVNCIDPWLTQTRTFCPVCKRDI  277 (348)
T ss_pred             hHHHHH-hhCCcEEecccc-------ccCCC-ceEEEeecccccCCeeeEecCCCchhhccchhhHhhcCccCCCCCCcC
Confidence            344444 557777777543       11222 68999999999999999999999999999999999985 599999998


Q ss_pred             CCCCCCCC
Q 008684          548 ESAPSSPS  555 (557)
Q Consensus       548 ~~s~ss~p  555 (557)
                      ......++
T Consensus       278 ~~~~~~~~  285 (348)
T KOG4628|consen  278 RTDSGSEP  285 (348)
T ss_pred             CCCCCCCC
Confidence            88776544



>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A Back     alignment and domain information
>PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02929 N1R/p28-like protein; Provisional Back     alignment and domain information
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A Back     alignment and domain information
>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A Back     alignment and domain information
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional Back     alignment and domain information
>KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information
>KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00184 RING Ring finger Back     alignment and domain information
>PHA02926 zinc finger-like protein; Provisional Back     alignment and domain information
>PF14634 zf-RING_5: zinc-RING finger domain Back     alignment and domain information
>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>smart00504 Ubox Modified RING finger domain Back     alignment and domain information
>KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A Back     alignment and domain information
>TIGR00599 rad18 DNA repair protein rad18 Back     alignment and domain information
>COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] Back     alignment and domain information
>smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins Back     alignment and domain information
>PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A Back     alignment and domain information
>KOG1493 consensus Anaphase-promoting complex (APC), subunit 11 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0828 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1734 consensus Predicted RING-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair] Back     alignment and domain information
>PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis Back     alignment and domain information
>KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A Back     alignment and domain information
>COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] Back     alignment and domain information
>TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 Back     alignment and domain information
>COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG2930 consensus SCF ubiquitin ligase, Rbx1 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4265 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0825 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG0311 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4445 consensus Uncharacterized conserved protein, contains RWD domain [Function unknown] Back     alignment and domain information
>KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B Back     alignment and domain information
>KOG1428 consensus Inhibitor of type V adenylyl cyclases/Neuronal presynaptic protein Highwire/PAM/RPM-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4172 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0824 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4275 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>KOG4159 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0297 consensus TNF receptor-associated factor [Signal transduction mechanisms] Back     alignment and domain information
>KOG1785 consensus Tyrosine kinase negative regulator CBL [Defense mechanisms] Back     alignment and domain information
>KOG3970 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2660 consensus Locus-specific chromosome binding proteins [Function unknown] Back     alignment and domain information
>PF12906 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A Back     alignment and domain information
>KOG2879 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF05883 Baculo_RING: Baculovirus U-box/Ring-like domain; InterPro: IPR008573 This family consists of several Baculovirus proteins of around 130 residues in length Back     alignment and domain information
>KOG0801 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10367 Vps39_2: Vacuolar sorting protein 39 domain 2; InterPro: IPR019453 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 Back     alignment and domain information
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] Back     alignment and domain information
>KOG1814 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] Back     alignment and domain information
>KOG4692 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3039 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1940 consensus Zn-finger protein [General function prediction only] Back     alignment and domain information
>PHA02862 5L protein; Provisional Back     alignment and domain information
>KOG1571 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA03096 p28-like protein; Provisional Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PHA02825 LAP/PHD finger-like protein; Provisional Back     alignment and domain information
>KOG1813 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG4185 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04641 Rtf2: Rtf2 RING-finger Back     alignment and domain information
>KOG3268 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>PF10272 Tmpp129: Putative transmembrane protein precursor; InterPro: IPR018801 This entry consists of proteins conserved from worms to humans Back     alignment and domain information
>PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B Back     alignment and domain information
>KOG1952 consensus Transcription factor NF-X1, contains NFX-type Zn2+-binding and R3H domains [Transcription] Back     alignment and domain information
>PF08746 zf-RING-like: RING-like domain; InterPro: IPR014857 This is a zinc finger domain that is related to the C3HC4 RING finger domain (IPR001841 from INTERPRO) Back     alignment and domain information
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information
>PF03854 zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG0298 consensus DEAD box-containing helicase-like transcription factor/DNA repair protein [Replication, recombination and repair] Back     alignment and domain information
>PF07800 DUF1644: Protein of unknown function (DUF1644); InterPro: IPR012866 This family consists of sequences found in a number of hypothetical plant proteins of unknown function Back     alignment and domain information
>KOG2932 consensus E3 ubiquitin ligase involved in ubiquitination of E-cadherin complex [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2034 consensus Vacuolar sorting protein PEP3/VPS18 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1609 consensus Protein involved in mRNA turnover and stability [RNA processing and modification] Back     alignment and domain information
>KOG0826 consensus Predicted E3 ubiquitin ligase involved in peroxisome organization [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14447 Prok-RING_4: Prokaryotic RING finger family 4 Back     alignment and domain information
>KOG0309 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0825 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG3002 consensus Zn finger protein [General function prediction only] Back     alignment and domain information
>KOG1829 consensus Uncharacterized conserved protein, contains C1, PH and RUN domains [Signal transduction mechanisms] Back     alignment and domain information
>COG5220 TFB3 Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit TFB3 [Cell division and chromosome partitioning / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>COG5183 SSM4 Protein involved in mRNA turnover and stability [RNA processing and modification] Back     alignment and domain information
>KOG1812 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3053 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0269 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query557
2ect_A78 Solution Structure Of The Zinc Finger, C3hc4 Type ( 4e-06
2l0b_A91 Solution Nmr Structure Of Zinc Finger Domain Of E3 3e-05
2kiz_A69 Solution Structure Of Arkadia Ring-H2 Finger Domain 9e-05
1iym_A55 Ring-H2 Finger Domain Of El5 Length = 55 6e-04
2ep4_A74 Solution Structure Of Ring Finger From Human Ring F 7e-04
>pdb|2ECT|A Chain A, Solution Structure Of The Zinc Finger, C3hc4 Type (Ring Finger) Domain Of Ring Finger Protein 126 Length = 78 Back     alignment and structure

Iteration: 1

Score = 49.7 bits (117), Expect = 4e-06, Method: Compositional matrix adjust. Identities = 18/44 (40%), Positives = 29/44 (65%) Query: 501 VKCSICQEEYVVGEEVGRLHCQHRYHVLCIQQWLRLTNWCPICK 544 ++C +C+E+Y +GE V +L C H +H CI WL + CP+C+ Sbjct: 16 LECPVCKEDYALGESVRQLPCNHLFHDSCIVPWLEQHDSCPVCR 59
>pdb|2L0B|A Chain A, Solution Nmr Structure Of Zinc Finger Domain Of E3 Ubiquitin-Protein Ligase Praja-1 From Homo Sapiens, Northeast Structural Genomics Consortium (Nesg) Target Hr4710b Length = 91 Back     alignment and structure
>pdb|2KIZ|A Chain A, Solution Structure Of Arkadia Ring-H2 Finger Domain Length = 69 Back     alignment and structure
>pdb|1IYM|A Chain A, Ring-H2 Finger Domain Of El5 Length = 55 Back     alignment and structure
>pdb|2EP4|A Chain A, Solution Structure Of Ring Finger From Human Ring Finger Protein 24 Length = 74 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query557
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 2e-18
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 4e-18
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 5e-18
2ect_A78 Ring finger protein 126; metal binding protein, st 8e-18
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 1e-15
2ecm_A55 Ring finger and CHY zinc finger domain- containing 6e-15
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 1e-14
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 2e-13
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 3e-12
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-11
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 9e-06
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 1e-10
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 2e-10
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 2e-10
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 9e-10
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 8e-08
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 1e-07
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 1e-07
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 1e-07
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 1e-07
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 1e-07
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 1e-07
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 5e-07
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 2e-06
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 5e-06
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 7e-06
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 1e-05
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 1e-05
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 3e-05
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 4e-05
3nw0_A238 Non-structural maintenance of chromosomes element 4e-05
4epo_C149 E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 5e-05
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 6e-05
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 7e-05
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 9e-05
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 2e-04
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 6e-04
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 74 Back     alignment and structure
 Score = 78.7 bits (194), Expect = 2e-18
 Identities = 17/60 (28%), Positives = 29/60 (48%)

Query: 498 NDDVKCSICQEEYVVGEEVGRLHCQHRYHVLCIQQWLRLTNWCPICKAPAESAPSSPSSS 557
           N    C++C E++   +E+G   C+H +H  C+ +WL +   CP+C  P          S
Sbjct: 13  NLHELCAVCLEDFKPRDELGICPCKHAFHRKCLIKWLEVRKVCPLCNMPVLQLAQLSGPS 72


>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Length = 91 Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 78 Back     alignment and structure
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Length = 55 Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Length = 55 Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Length = 68 Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Length = 71 Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Length = 64 Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Length = 108 Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Length = 133 Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Length = 100 Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Length = 381 Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66 Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Length = 117 Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Length = 106 Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Length = 99 Back     alignment and structure
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 94 Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, chromosomal protein, DNA repair, metal-binding; 2.12A {Homo sapiens} Length = 115 Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Length = 114 Back     alignment and structure
>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Length = 238 Back     alignment and structure
>4epo_C E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 ubiquitin ligase, protein binding complex; 4.80A {Homo sapiens} Length = 149 Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Length = 124 Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Length = 170 Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Length = 118 Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Length = 389 Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Length = 78 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query557
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 99.63
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 99.57
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 99.52
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 99.52
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 99.49
2ect_A78 Ring finger protein 126; metal binding protein, st 99.47
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 99.42
2ecm_A55 Ring finger and CHY zinc finger domain- containing 99.41
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 99.4
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 99.38
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 99.36
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 99.33
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 99.32
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 99.31
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 99.27
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 99.26
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 99.26
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 99.26
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 99.25
2ysl_A73 Tripartite motif-containing protein 31; ring-type 99.19
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 99.18
4ayc_A138 E3 ubiquitin-protein ligase RNF8; DNA damage, K63 99.18
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 99.17
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 99.17
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 99.16
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 99.13
2ecw_A85 Tripartite motif-containing protein 30; metal bind 99.12
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 99.1
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 99.1
2ysj_A63 Tripartite motif-containing protein 31; ring-type 99.08
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 99.07
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 99.07
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 99.06
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 99.04
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 99.04
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 99.04
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 99.03
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 99.03
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 99.03
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 99.02
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 98.98
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 98.95
1z6u_A150 NP95-like ring finger protein isoform B; structura 98.91
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 98.9
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 98.88
2kr4_A85 Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri 98.85
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 98.85
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 98.84
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 98.81
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 98.8
2kre_A100 Ubiquitin conjugation factor E4 B; U-box domain, E 98.78
1wgm_A98 Ubiquitin conjugation factor E4A; ubiquitinating e 98.77
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 98.76
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 98.73
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 98.69
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 98.68
4ic3_A74 E3 ubiquitin-protein ligase XIAP; ring domain, zin 98.68
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.61
2yu4_A94 E3 SUMO-protein ligase NSE2; SP-ring domain, struc 98.59
1vyx_A60 ORF K3, K3RING; zinc-binding protein, ring domain, 98.56
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 98.56
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 98.56
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 98.48
2ea5_A68 Cell growth regulator with ring finger domain prot 98.41
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 98.39
2f42_A179 STIP1 homology and U-box containing protein 1; cha 98.36
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 98.34
3htk_C267 E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- 98.21
3t6p_A345 Baculoviral IAP repeat-containing protein 2; ring, 98.2
2bay_A61 PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l 98.17
3vk6_A101 E3 ubiquitin-protein ligase hakai; HYB, phosphotyr 97.73
3nw0_A238 Non-structural maintenance of chromosomes element 97.59
2ko5_A99 Ring finger protein Z; lassa fever virus-Z, negati 95.6
2jun_A101 Midline-1; B-BOX, TRIM, ring finger, alternative s 94.74
2lri_C66 Autoimmune regulator; Zn binding protein domain, a 93.23
1wil_A89 KIAA1045 protein; ring finger domain, structural g 89.41
2l5u_A61 Chromodomain-helicase-DNA-binding protein 4; CHD4, 80.56
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Back     alignment and structure
Probab=99.63  E-value=3.2e-16  Score=132.46  Aligned_cols=78  Identities=26%  Similarity=0.632  Sum_probs=65.2

Q ss_pred             CCCCCCCHHHHHhhccceeccCCCcccccccCCCCCCccccccccccccCceeEEeCCCCcchHHHHHHHHhcCCCCCCC
Q 008684          464 TVSTALTDEAILKCLKTSIYQPAPLDVALSCSGNNDDVKCSICQEEYVVGEEVGRLHCQHRYHVLCIQQWLRLTNWCPIC  543 (557)
Q Consensus       464 ~vstgLSee~I~k~Lp~~~y~~~~~e~~~~~~~~~ed~~CsICLEeF~~geeV~~LPCgH~FH~~CI~~WL~~k~SCPVC  543 (557)
                      ....+++++.| +.|+...+....       ....++..|+||+++|..++.+..|||+|.||..||..||..+.+||+|
T Consensus        12 ~~~~~~s~~~i-~~lp~~~~~~~~-------~~~~~~~~C~IC~~~~~~~~~~~~l~C~H~Fh~~Ci~~wl~~~~~CP~C   83 (91)
T 2l0b_A           12 VANPPASKESI-DALPEILVTEDH-------GAVGQEMCCPICCSEYVKGDVATELPCHHYFHKPCVSIWLQKSGTCPVC   83 (91)
T ss_dssp             SCCCCCCHHHH-HTSCEEECCTTC-------SSSSSCSEETTTTEECCTTCEEEEETTTEEEEHHHHHHHHTTTCBCTTT
T ss_pred             cCCCCCCHHHH-HhCCCeeecccc-------cccCCCCCCcccChhhcCCCcEEecCCCChHHHHHHHHHHHcCCcCcCc
Confidence            34567888887 458877776433       3355678999999999999999999999999999999999999999999


Q ss_pred             CCCCCC
Q 008684          544 KAPAES  549 (557)
Q Consensus       544 R~eV~~  549 (557)
                      |..+.+
T Consensus        84 r~~~~~   89 (91)
T 2l0b_A           84 RCMFPP   89 (91)
T ss_dssp             CCBSSC
T ss_pred             CccCCC
Confidence            998875



>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Back     alignment and structure
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} Back     alignment and structure
>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Back     alignment and structure
>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Back     alignment and structure
>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Back     alignment and structure
>4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C Back     alignment and structure
>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Back     alignment and structure
>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Back     alignment and structure
>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B Back     alignment and structure
>2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A Back     alignment and structure
>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Back     alignment and structure
>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Back     alignment and structure
>2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens} Back     alignment and structure
>2lri_C Autoimmune regulator; Zn binding protein domain, apeced, transcription; NMR {Homo sapiens} Back     alignment and structure
>1wil_A KIAA1045 protein; ring finger domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: g.50.1.3 Back     alignment and structure
>2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 557
d1iyma_55 g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sati 9e-16
d1chca_68 g.44.1.1 (A:) Immediate early protein, IEEHV {Equi 1e-11
d3dplr188 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of S 3e-11
d1vyxa_60 g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal do 3e-10
d1g25a_65 g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapi 7e-10
d1fbva479 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [Ta 8e-10
d1ur6b_52 g.44.1.1 (B:) Not-4 N-terminal RING finger domain 2e-09
d1bora_56 g.44.1.1 (A:) Acute promyelocytic leukaemia proto- 5e-09
d1wima_94 g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA016 1e-06
d1rmda286 g.44.1.1 (A:1-86) V(D)J recombination activating p 2e-06
d1jm7a_103 g.44.1.1 (A:) brca1 RING domain {Human (Homo sapie 2e-05
d1v87a_114 g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mou 3e-05
d1jm7b_97 g.44.1.1 (B:) bard1 RING domain {Human (Homo sapie 9e-05
d2c2la280 g.44.1.2 (A:225-304) STIP1 homology and U box-cont 8e-04
d1t1ha_78 g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cre 0.002
d2baya156 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 { 0.003
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Length = 55 Back     information, alignment and structure

class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: EL5 RING-H2 domain
species: Rice (Oryza sativa) [TaxId: 4530]
 Score = 69.5 bits (170), Expect = 9e-16
 Identities = 18/49 (36%), Positives = 26/49 (53%), Gaps = 1/49 (2%)

Query: 499 DDVKCSICQEEYVVGEEVGRL-HCQHRYHVLCIQQWLRLTNWCPICKAP 546
           D V+C++C  E   GEE   L  C H +H  C+  WL   + CP+C+  
Sbjct: 4   DGVECAVCLAELEDGEEARFLPRCGHGFHAECVDMWLGSHSTCPLCRLT 52


>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Length = 68 Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Length = 60 Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Length = 52 Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Length = 56 Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 114 Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 97 Back     information, alignment and structure
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 80 Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 78 Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 56 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query557
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 99.61
d1v87a_114 Deltex protein 2 RING-H2 domain {Mouse (Mus muscul 99.42
d1chca_68 Immediate early protein, IEEHV {Equine herpesvirus 99.38
d3dplr188 RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase 99.34
d1ur6b_52 Not-4 N-terminal RING finger domain {Human (Homo s 99.29
d1g25a_65 TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 99.28
d1fbva479 CBL {Human (Homo sapiens) [TaxId: 9606]} 99.25
d1bora_56 Acute promyelocytic leukaemia proto-oncoprotein PM 99.07
d2baya156 Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac 99.05
d1rmda286 V(D)J recombination activating protein 1 (RAG1), d 99.04
d1jm7a_103 brca1 RING domain {Human (Homo sapiens) [TaxId: 96 99.0
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 98.94
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 98.84
d1t1ha_78 E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi 98.81
d2c2la280 STIP1 homology and U box-containing protein 1, STU 98.78
d1wgma_98 Ubiquitin conjugation factor E4A {Human (Homo sapi 98.58
d1wima_94 UbcM4-interacting protein 4 (KIAA0161) {Human (Hom 98.46
d1f62a_51 Williams-Beuren syndrome transcription factor, WST 90.82
d1we9a_64 PHD finger protein At5g26210 {Thale cress (Arabido 88.23
d1fp0a170 Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo 85.23
d1wila_89 Hypothetical protein KIAA1045 {Human (Homo sapiens 84.26
d1wewa_78 Sumoylation ligase E3, SIZ1 {Thale cress (Arabidop 81.97
d1mm2a_61 Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606 81.39
d1wema_76 Death associated transcription factor 1, Datf1 (DI 81.02
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: EL5 RING-H2 domain
species: Rice (Oryza sativa) [TaxId: 4530]
Probab=99.61  E-value=1.2e-16  Score=123.14  Aligned_cols=51  Identities=35%  Similarity=0.865  Sum_probs=46.7

Q ss_pred             CCCccccccccccccCceeEEeC-CCCcchHHHHHHHHhcCCCCCCCCCCCC
Q 008684          498 NDDVKCSICQEEYVVGEEVGRLH-CQHRYHVLCIQQWLRLTNWCPICKAPAE  548 (557)
Q Consensus       498 ~ed~~CsICLEeF~~geeV~~LP-CgH~FH~~CI~~WL~~k~SCPVCR~eV~  548 (557)
                      +++.+|+||+++|..++.+..++ |+|.||..||.+||+.+++||+||+.|.
T Consensus         3 ed~~~C~ICl~~~~~~~~~~~l~~C~H~Fh~~Ci~~Wl~~~~~CP~CR~~i~   54 (55)
T d1iyma_           3 DDGVECAVCLAELEDGEEARFLPRCGHGFHAECVDMWLGSHSTCPLCRLTVV   54 (55)
T ss_dssp             CCSCCCTTTCCCCCTTSCCEECSSSCCEECTTHHHHTTTTCCSCSSSCCCSC
T ss_pred             CCCCCCeEECccccCCCEEEEeCCCCCcccHHHHHHHHHhCCcCCCCCCEeE
Confidence            45667999999999999998885 9999999999999999999999999875



>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wila_ g.50.1.3 (A:) Hypothetical protein KIAA1045 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wewa_ g.50.1.2 (A:) Sumoylation ligase E3, SIZ1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wema_ g.50.1.2 (A:) Death associated transcription factor 1, Datf1 (DIO-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure