BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 008754
         (554 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2R6G|F Chain F, The Crystal Structure Of The E. Coli Maltose Transporter
 pdb|3PUY|F Chain F, Crystal Structure Of An Outward-Facing Mbp-Maltose
           Transporter Complex Bound To Amp-Pnp After Crystal
           Soaking Of The Pretranslocation State
 pdb|3PUZ|F Chain F, Crystal Structure Of A Pre-Translocation State Mbp-Maltose
           Transporter Complex Bound To Amp-Pnp
 pdb|3PV0|F Chain F, Crystal Structure Of A Pre-Translocation State Mbp-Maltose
           Transporter Complex Without Nucleotide
 pdb|3PUV|F Chain F, Crystal Structure Of An Outward-Facing Mbp-Maltose
           Transporter Complex Bound To Adp-Vo4
 pdb|3PUW|F Chain F, Crystal Structure Of An Outward-Facing Mbp-Maltose
           Transporter Complex Bound To Adp-Alf4
 pdb|3PUX|F Chain F, Crystal Structure Of An Outward-Facing Mbp-Maltose
           Transporter Complex Bound To Adp-Bef3
 pdb|3RLF|F Chain F, Crystal Structure Of The Maltose-Binding ProteinMALTOSE
           TRANSPORTER Complex In An Outward-Facing Conformation
           Bound To Mgamppnp
          Length = 514

 Score = 31.2 bits (69), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 23/38 (60%)

Query: 481 LAIPFFGLVMSLIGSLLTMLVTLILPCLCFLSILRGKA 518
           LAI  + +V SLI   LT+ V ++L CL     LRGKA
Sbjct: 278 LAIFVWTVVFSLITVFLTVAVGMVLACLVQWEALRGKA 315


>pdb|3FH6|F Chain F, Crystal Structure Of The Resting State Maltose Transporter
           From E. Coli
 pdb|3FH6|H Chain H, Crystal Structure Of The Resting State Maltose Transporter
           From E. Coli
          Length = 480

 Score = 30.8 bits (68), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 23/38 (60%)

Query: 481 LAIPFFGLVMSLIGSLLTMLVTLILPCLCFLSILRGKA 518
           LAI  + +V SLI   LT+ V ++L CL     LRGKA
Sbjct: 244 LAIFVWTVVFSLITVFLTVAVGMVLACLVQWEALRGKA 281


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.324    0.137    0.414 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 13,722,962
Number of Sequences: 62578
Number of extensions: 514022
Number of successful extensions: 989
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 986
Number of HSP's gapped (non-prelim): 3
length of query: 554
length of database: 14,973,337
effective HSP length: 104
effective length of query: 450
effective length of database: 8,465,225
effective search space: 3809351250
effective search space used: 3809351250
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 54 (25.4 bits)