Query         008770
Match_columns 554
No_of_seqs    176 out of 322
Neff          3.3 
Searched_HMMs 46136
Date          Thu Mar 28 16:21:36 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/008770.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/008770hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF03110 SBP:  SBP domain;  Int 100.0 1.2E-37 2.5E-42  261.7  -0.7   78  171-248     1-78  (79)
  2 PF14901 Jiv90:  Cleavage induc  34.6      17 0.00037   32.8   0.7   18  209-226    26-43  (94)
  3 PRK00241 nudC NADH pyrophospha  24.2      31 0.00066   35.1   0.6   36  184-220    92-127 (256)
  4 PF09297 zf-NADH-PPase:  NADH p  23.5      36 0.00077   24.2   0.6   31  189-220     1-31  (32)
  5 COG2816 NPY1 NTP pyrophosphohy  17.2      50  0.0011   34.8   0.4   36  184-220   104-139 (279)
  6 TIGR03831 YgiT_finger YgiT-typ  16.5      73  0.0016   23.2   1.0   20  199-218    21-40  (46)
  7 TIGR01674 phage_lambda_G phage  14.7      80  0.0017   30.4   1.0   19  515-534    10-28  (138)
  8 PRK06424 transcription factor;  14.4      92   0.002   29.7   1.3   21  201-221    14-34  (144)
  9 PF14776 UNC-79:  Cation-channe  14.0   1E+02  0.0022   35.2   1.8   28  191-218   262-298 (525)
 10 PF05485 THAP:  THAP domain;  I  13.7      90   0.002   25.5   1.0   13  190-202    48-60  (84)

No 1  
>PF03110 SBP:  SBP domain;  InterPro: IPR004333 The SBP plant protein domain is a sequence specific DNA-binding domain []. Proteins with this domain probably function as transcription factors involved in the control of early flower development. The domain contains 10 conserved cysteine and histidine residues that probably are zinc ligands.; GO: 0003677 DNA binding, 0005634 nucleus; PDB: 1UL4_A 1WJ0_A 1UL5_A.
Probab=100.00  E-value=1.2e-37  Score=261.74  Aligned_cols=78  Identities=65%  Similarity=1.149  Sum_probs=63.2

Q ss_pred             CcccCCCchhccCChhhhccccchhhhcCCCeEEECCccchhhhhhhccccccccccccchHHHHHhhHHhhhcCCCC
Q 008770          171 YCQVYGCNKDLSSSKDYHKRHKVCEAHSKAAKVIVNEIEQRFCQQCSRFHFLDEFDDGKRSCRKRLAGHNERRRKPQV  248 (554)
Q Consensus       171 ~CQVdGC~~dLs~~k~Y~rRhrVCe~H~kA~~V~v~G~~qRFCQQCsrFH~L~eFDg~kRSCR~rL~~hn~RRRk~q~  248 (554)
                      +||||||++||+.+|.||+||||||.|+|||+|+++|.++||||||+|||+|+||||.|||||++|++||+||||+++
T Consensus         1 ~CqV~gC~~dL~~~k~Y~rR~rICe~H~ka~~V~~~G~~~RFCQQC~rfh~l~eFdg~kRSCr~~L~~h~~RRr~~~~   78 (79)
T PF03110_consen    1 RCQVDGCGADLSGAKEYHRRYRICEEHAKAPVVVVDGVEQRFCQQCGRFHPLSEFDGGKRSCRARLARHNERRRKRQQ   78 (79)
T ss_dssp             C-SSTTEE-EETS--SSCCCTT--HHHHTHSEEEETTEEEEE-TTTSSEEETTCB-SSTTSBSTTTT-SSS---S-S-
T ss_pred             CCcCCCCCcchhhhHHHhhccCcchhhcCCCeEEECChhHHHHHHHHcCCCHHHHcchhhhHHHHHHHHHHHhccccC
Confidence            599999999999999999999999999999999999999999999999999999999999999999999999999875


No 2  
>PF14901 Jiv90:  Cleavage inducing molecular chaperone
Probab=34.55  E-value=17  Score=32.76  Aligned_cols=18  Identities=39%  Similarity=0.654  Sum_probs=14.0

Q ss_pred             cchhhhhhhccccccccc
Q 008770          209 EQRFCQQCSRFHFLDEFD  226 (554)
Q Consensus       209 ~qRFCQQCsrFH~L~eFD  226 (554)
                      .-|+||+|..+|+..+=|
T Consensus        26 ~AR~C~~C~~~H~Ak~gD   43 (94)
T PF14901_consen   26 AARYCQDCKIRHPAKEGD   43 (94)
T ss_pred             hhHhHHHhhhhcccccCC
Confidence            459999999999865543


No 3  
>PRK00241 nudC NADH pyrophosphatase; Reviewed
Probab=24.17  E-value=31  Score=35.11  Aligned_cols=36  Identities=11%  Similarity=0.303  Sum_probs=27.5

Q ss_pred             ChhhhccccchhhhcCCCeEEECCccchhhhhhhccc
Q 008770          184 SKDYHKRHKVCEAHSKAAKVIVNEIEQRFCQQCSRFH  220 (554)
Q Consensus       184 ~k~Y~rRhrVCe~H~kA~~V~v~G~~qRFCQQCsrFH  220 (554)
                      +..+|++||-|..+-....+ ..+...|.|..|++.|
T Consensus        92 l~~w~~~~~fC~~CG~~~~~-~~~~~~~~C~~c~~~~  127 (256)
T PRK00241         92 LAEFYRSHRFCGYCGHPMHP-SKTEWAMLCPHCRERY  127 (256)
T ss_pred             HHHHhhcCccccccCCCCee-cCCceeEECCCCCCEE
Confidence            34799999999988776554 4566678999998654


No 4  
>PF09297 zf-NADH-PPase:  NADH pyrophosphatase zinc ribbon domain;  InterPro: IPR015376 This domain has a zinc ribbon structure and is often found between two NUDIX domains.; GO: 0016787 hydrolase activity, 0046872 metal ion binding; PDB: 1VK6_A 2GB5_A.
Probab=23.47  E-value=36  Score=24.23  Aligned_cols=31  Identities=23%  Similarity=0.378  Sum_probs=17.3

Q ss_pred             ccccchhhhcCCCeEEECCccchhhhhhhccc
Q 008770          189 KRHKVCEAHSKAAKVIVNEIEQRFCQQCSRFH  220 (554)
Q Consensus       189 rRhrVCe~H~kA~~V~v~G~~qRFCQQCsrFH  220 (554)
                      ++||-|... -+|++.+.+...|-|+.|+..|
T Consensus         1 ~~~rfC~~C-G~~t~~~~~g~~r~C~~Cg~~~   31 (32)
T PF09297_consen    1 RNHRFCGRC-GAPTKPAPGGWARRCPSCGHEH   31 (32)
T ss_dssp             HTTSB-TTT---BEEE-SSSS-EEESSSS-EE
T ss_pred             CCCcccCcC-CccccCCCCcCEeECCCCcCEe
Confidence            356666653 5677777777888888887643


No 5  
>COG2816 NPY1 NTP pyrophosphohydrolases containing a Zn-finger, probably nucleic-acid-binding [DNA replication, recombination, and repair]
Probab=17.18  E-value=50  Score=34.80  Aligned_cols=36  Identities=17%  Similarity=0.360  Sum_probs=29.6

Q ss_pred             ChhhhccccchhhhcCCCeEEECCccchhhhhhhccc
Q 008770          184 SKDYHKRHKVCEAHSKAAKVIVNEIEQRFCQQCSRFH  220 (554)
Q Consensus       184 ~k~Y~rRhrVCe~H~kA~~V~v~G~~qRFCQQCsrFH  220 (554)
                      +-.+|++||.|.. +-++....+|...|-|++|+.-|
T Consensus       104 l~~w~~~~RFCg~-CG~~~~~~~~g~~~~C~~cg~~~  139 (279)
T COG2816         104 LLEWYRSHRFCGR-CGTKTYPREGGWARVCPKCGHEH  139 (279)
T ss_pred             HHHHHhhCcCCCC-CCCcCccccCceeeeCCCCCCcc
Confidence            3468999999985 56788888999999999998643


No 6  
>TIGR03831 YgiT_finger YgiT-type zinc finger domain. This domain model describes a small domain with two copies of a putative zinc-binding motif CXXC (usually CXXCG). Most member proteins consist largely of this domain or else carry an additional C-terminal helix-turn-helix domain, resembling that of the phage protein Cro and modeled by pfam01381.
Probab=16.52  E-value=73  Score=23.20  Aligned_cols=20  Identities=15%  Similarity=0.584  Sum_probs=17.4

Q ss_pred             CCCeEEECCccchhhhhhhc
Q 008770          199 KAAKVIVNEIEQRFCQQCSR  218 (554)
Q Consensus       199 kA~~V~v~G~~qRFCQQCsr  218 (554)
                      +...+++.+.+.++|.+|+.
T Consensus        21 ~~~~~~i~~vp~~~C~~CGE   40 (46)
T TIGR03831        21 GGELIVIENVPALVCPQCGE   40 (46)
T ss_pred             CCEEEEEeCCCccccccCCC
Confidence            55678899999999999986


No 7  
>TIGR01674 phage_lambda_G phage minor tail protein G. This model describes a family of bacteriophage proteins including G of phage lambda. This protein has been described as undergoing a translational frameshift at a Gly-Lys dipeptide near the C-terminus of protein G from phage lambda, with about 4 % efficiency, to produce tail assembly protein G-T. The Lys of the Gly-Lys pair is the conserved second-to-last residue of seed alignment for this family.
Probab=14.71  E-value=80  Score=30.41  Aligned_cols=19  Identities=47%  Similarity=0.856  Sum_probs=16.7

Q ss_pred             CCCCcchhhhhhhhhHHHHH
Q 008770          515 EDGATIDLLKLSSQLQRVEH  534 (554)
Q Consensus       515 e~~~tidllqlss~l~rve~  534 (554)
                      -+|.+|-|.+|| -|||+|+
T Consensus        10 ~nG~sVtLsELS-ALQRiey   28 (138)
T TIGR01674        10 CNGSSVTLFELS-ALQRIEH   28 (138)
T ss_pred             eCCEEEEehhhh-HHHHHHH
Confidence            479999999996 5999997


No 8  
>PRK06424 transcription factor; Provisional
Probab=14.36  E-value=92  Score=29.65  Aligned_cols=21  Identities=24%  Similarity=0.659  Sum_probs=18.6

Q ss_pred             CeEEECCccchhhhhhhcccc
Q 008770          201 AKVIVNEIEQRFCQQCSRFHF  221 (554)
Q Consensus       201 ~~V~v~G~~qRFCQQCsrFH~  221 (554)
                      -.|+|+|.+.+-|..|.+|=.
T Consensus        14 ~~v~ieg~~l~vC~~Ca~~G~   34 (144)
T PRK06424         14 TKVMIDGAILNVCDDCAKFGT   34 (144)
T ss_pred             eEEEEcCeeeehhHHHHHcCC
Confidence            478999999999999999854


No 9  
>PF14776 UNC-79:  Cation-channel complex subunit UNC-79
Probab=14.02  E-value=1e+02  Score=35.21  Aligned_cols=28  Identities=36%  Similarity=0.649  Sum_probs=21.1

Q ss_pred             ccchhhhcCCCeEEE---------CCccchhhhhhhc
Q 008770          191 HKVCEAHSKAAKVIV---------NEIEQRFCQQCSR  218 (554)
Q Consensus       191 hrVCe~H~kA~~V~v---------~G~~qRFCQQCsr  218 (554)
                      +|-|.-+.|..+|+-         ++++.|+||||..
T Consensus       262 nK~C~S~~k~AvvtCFS~eCt~~~gn~PiRlC~~Ch~  298 (525)
T PF14776_consen  262 NKNCRSSDKSAVVTCFSTECTSYNGNRPIRLCQQCHS  298 (525)
T ss_pred             CCCCcCCCCCeEEEEechhhccccCCCcchhHHHHhh
Confidence            456667777777763         7788999999964


No 10 
>PF05485 THAP:  THAP domain;  InterPro: IPR006612 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  C2H2-type (classical) zinc fingers (Znf) were the first class to be characterised. They contain a short beta hairpin and an alpha helix (beta/beta/alpha structure), where a single zinc atom is held in place by Cys(2)His(2) (C2H2) residues in a tetrahedral array. C2H2 Znf's can be divided into three groups based on the number and pattern of fingers: triple-C2H2 (binds single ligand), multiple-adjacent-C2H2 (binds multiple ligands), and separated paired-C2H2 []. C2H2 Znf's are the most common DNA-binding motifs found in eukaryotic transcription factors, and have also been identified in prokaryotes []. Transcription factors usually contain several Znf's (each with a conserved beta/beta/alpha structure) capable of making multiple contacts along the DNA, where the C2H2 Znf motifs recognise DNA sequences by binding to the major groove of DNA via a short alpha-helix in the Znf, the Znf spanning 3-4 bases of the DNA []. C2H2 Znf's can also bind to RNA and protein targets []. The THAP domain is an ~90-residue domain restricted to animals, which is shared between the THAP family of cellular DNA-binding proteins, and transposases from mobile genomic parasites. The defined THAP domain includes: a C2CH signature (consensus: C-x(2,4)-C-x(35,50)-C-x(2)-H); three additional key residues that are strictly conserved in all THAP domains that have been found to date (THAP1 amino acids P26, W36, F58); a C-terminal AVPTIF box; and several other conserved amino acid positions with distinct physicochemical properties (e.g. hydrophobic and polar). The THAP domain can be found in one or more copies and can be associated with other domains, such as the C2H2-type zinc finger. The THAP domain is supposed to be a DNA-binding domain (DBD) [, ].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003676 nucleic acid binding; PDB: 3KDE_C 2D8R_A 2JM3_A 2KO0_A 2JTG_A 2L1G_A.
Probab=13.70  E-value=90  Score=25.47  Aligned_cols=13  Identities=15%  Similarity=0.562  Sum_probs=6.8

Q ss_pred             cccchhhhcCCCe
Q 008770          190 RHKVCEAHSKAAK  202 (554)
Q Consensus       190 RhrVCe~H~kA~~  202 (554)
                      ..+||..|.....
T Consensus        48 ~~~ICs~HF~~~~   60 (84)
T PF05485_consen   48 NSRICSRHFEPDD   60 (84)
T ss_dssp             TSEEEGGGSTGGG
T ss_pred             CccchhhhCchhh
Confidence            3456666655443


Done!