BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 008803
         (553 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2XOC|A Chain A, C-terminal Cysteine-rich Domain Of Human Chfr Bound To
           Madpr
 pdb|2XOC|B Chain B, C-terminal Cysteine-rich Domain Of Human Chfr Bound To
           Madpr
 pdb|2XOY|A Chain A, C-Terminal Cysteine-Rich Domain Of Human Chfr Bound To
           P(1), P(2)-Diadenosine-5'-Pyrophosphate
 pdb|2XOY|B Chain B, C-Terminal Cysteine-Rich Domain Of Human Chfr Bound To
           P(1), P(2)-Diadenosine-5'-Pyrophosphate
 pdb|2XOZ|A Chain A, C-Terminal Cysteine Rich Domain Of Human Chfr Bound To Amp
 pdb|2XOZ|B Chain B, C-Terminal Cysteine Rich Domain Of Human Chfr Bound To Amp
          Length = 261

 Score = 29.6 bits (65), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 29/58 (50%), Gaps = 1/58 (1%)

Query: 177 SLQGLQGYKVFISIALILGDGLYNFCKVLSRTLVGLFYQVRTRNASSDLPVAENSSPE 234
           SL  LQ     +S   + GD +  +C  L R+   L YQ R    +S+LPVA  S P+
Sbjct: 175 SLVALQRGVFLLSDYRVTGDTVLCYCCGL-RSFRELTYQYRQNIPASELPVAVTSRPD 231


>pdb|2XP0|A Chain A, C-Terminal Cysteine-Rich Domain Of Human Chfr
 pdb|2XP0|B Chain B, C-Terminal Cysteine-Rich Domain Of Human Chfr
          Length = 274

 Score = 29.6 bits (65), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 29/58 (50%), Gaps = 1/58 (1%)

Query: 177 SLQGLQGYKVFISIALILGDGLYNFCKVLSRTLVGLFYQVRTRNASSDLPVAENSSPE 234
           SL  LQ     +S   + GD +  +C  L R+   L YQ R    +S+LPVA  S P+
Sbjct: 188 SLVALQRGVFLLSDYRVTGDTVLCYCCGL-RSFRELTYQYRQNIPASELPVAVTSRPD 244


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.327    0.141    0.446 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 14,536,223
Number of Sequences: 62578
Number of extensions: 531700
Number of successful extensions: 1113
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 1113
Number of HSP's gapped (non-prelim): 2
length of query: 553
length of database: 14,973,337
effective HSP length: 104
effective length of query: 449
effective length of database: 8,465,225
effective search space: 3800886025
effective search space used: 3800886025
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 54 (25.4 bits)