Citrus Sinensis ID: 008835


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-
MLWIRLLSFSNQPMTECLQRDKIAAQFHQLTEQIEAALSDIPYDKLDLSEEVREQIELVHVQFRRAKGRPDSPDLQLDHDLAVAQKERDPDPAILGRLSEKLHLRTINDLKNESLAFHELVISSGGDPGDCFEEISSLLRKLKDFVLIENPEVDITEGEKGLMKHRSPVIPDDFRCPISLELMKDPVIVSTGQTYERSCIQKWLDAGHKTCPKTQQTLLHTALTPNYVLKSLIALWCENNGVELPKNQGACRSKKPGTCVSDCDRAAIDALLGKLANGNVEEQRAAAGELRLLAKRNADNRVCIAEAGAIPLLVELLSSTDPRTQEHAVTALLNLSINDSNKGTIVNAGAIPDIVDVLKNGSMEARENAAATLFSLSVIDENKVAIGAAGAIPALIRLLCDGTPRGKKDAATAIFNLSIYQGNKARAVRAGIVPPLMRFLKDAGGGMVDEALAILAILASHQEGKTAIGQAEPIPVLMEVIRTGSPRNRENAAAVLWAICTGDAEQLKIARELDAEEALKELSESGTDRAKRKAGSILELLQRIDMAVNSQ
cHHHHHHHcccccEEEEEccHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHccccccHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccEEccccccccHHHHHHHHHcccccccccccccccccccccHHHHHHHHHHHHHcccccccccccccccccccccccccHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHccHHHHHHHHcccHHHHHHHHccccHHHHHHHHHHHHHcccccccHHHHHcccccHHHHHHHHcccHHHHHHHHHHHHHHccccccHHHHHHcccHHHHHHHHcccccHHHHHHHHHHHHHccccccHHHHHHcccHHHHHHHHHccccHHHHHHHHHHHHHHccHHHHHHHHccccHHHHHHHHHccccHHHHHHHHHHHHHHcccHHHHHHHHHcccHHHHHHHHHHccHHHHHHHHHHHHHHHcccHHHccc
MLWIRLLSFSNQPMTECLQRDKIAAQFHQLTEQIEAALSDIPYDKLDLSEEVREQIELVHVQFRRAK**P**P*LQLD****************LGRLSEKLHLRTINDLKNESLAFHELVISSGGDPGDCFEEISSLLRKLKDFVLIE*****************SPVIPDDFRCPISLELMKDPVIVSTGQTYERSCIQKWLDAGHKTCPKTQQTLLHTALTPNYVLKSLIALWCENNGVELP*************C*SDCDRAAIDALLGKLANGNVEEQRAAAGELRLLAKRNADNRVCIAEAGAIPLLVELLSSTDPRTQEHAVTALLNLSINDSNKGTIVNAGAIPDIVDVLKNGSMEARENAAATLFSLSVIDENKVAIGAAGAIPALIRLLCDGTPRGKKDAATAIFNLSIYQGNKARAVRAGIVPPLMRFLKDAGGGMVDEALAILAILASHQEGKTAIGQAEPIPVLMEVIRTGSPRNRENAAAVLWAICTGDAEQLKIARELDAEEALKELSESGTDRAKRKAGSILELLQ*********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLWIRLLSFSNQPMTECLQRDKIAAQFHQLTEQIEAALSDIPYDKLDLSEEVREQIELVHVQFRRAKGRPDSPDLQLDHDLAVAQKERDPDPAILGRLSEKLHLRTINDLKNESLAFHELVISSGGDPGDCFEEISSLLRKLKDFVLIENPEVDITEGEKGLMKHRSPVIPDDFRCPISLELMKDPVIVSTGQTYERSCIQKWLDAGHKTCPKTQQTLLHTALTPNYVLKSLIALWCENNGVELPKNQGACRSKKPGTCVSDCDRAAIDALLGKLANGNVEEQRAAAGELRLLAKRNADNRVCIAEAGAIPLLVELLSSTDPRTQEHAVTALLNLSINDSNKGTIVNAGAIPDIVDVLKNGSMEARENAAATLFSLSVIDENKVAIGAAGAIPALIRLLCDGTPRGKKDAATAIFNLSIYQGNKARAVRAGIVPPLMRFLKDAGGGMVDEALAILAILASHQEGKTAIGQAEPIPVLMEVIRTGSPRNRENAAAVLWAICTGDAEQLKIARELDAEEALKELSESGTDRAKRKAGSILELLQRIDMAVNSQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
U-box domain-containing protein 14 Functions as an E3 ubiquitin ligase with specific E2 ubiquitin-conjugating enzymes. Undergoes auto-ubiquitination.confidentQ8VZ40
U-box domain-containing protein 12 Possesses E3 ubiquitin-protein ligase in vitro.probableQ5VRH9

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1WA5, chain B
Confidence level:very confident
Coverage over the Query: 264-544
View the alignment between query and template
View the model in PyMOL
Template: 2C2L, chain A
Confidence level:very confident
Coverage over the Query: 166-243
View the alignment between query and template
View the model in PyMOL
Template: 4EPO, chain C
Confidence level:probable
Coverage over the Query: 165-255
View the alignment between query and template
View the model in PyMOL