Citrus Sinensis ID: 008846


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-
MDTLCLKSGIHGITSPISVGGPLEVRSNSAQQQVTAAVGKSAGVAPPQKRASSGFFSFRYPLKSLWPGGGSWGSKRYKGIALEDAVLAESGEKGVVAGDADANANARGDNGTSSSSHTDGQKGNWVLKILHVTSLWKDREEMEQEQGQGLEKQMDAAVNGQPNDNREDVDEDEEECEACKINDDDEIEFDGDSFSRLLRKVSLAEAKLYAQMSYLGTLAYCIPKIKPGNLLKYRGLHFITSSIEKKELALKAEKDQMSSEKPEADRKIEDEAEGKEQKNNGYRISASSAYHIAASAASYLHYHTRSILPFSKTERGKDSPEMDNGSDDNTSIMDSDVASFMATTDSVTAVVAAKEEVKQAVADDLKSTRLSPCEWFICDDDQSATRFFVIQGSESLASWQANLLFEPVQFEGLEVVVHRGIYEAAKGIYEQMLPEVHAHLKACGKHATFRFTGHSLGGSLSVLINLMLLIRGEVPASSLLPVITFGAPSIMCGGDHLLRKLGLPRSHVQSITLHRDIVPRAFSCNYPNHVAELLKAVNRNFRNHPCLNNQV
cccccccccccccccccccccccccccccccccEEEEEcccccccccccccccccccccccccccccccccccccccccccccHHHHHccccccccccccccccccccccccccccccccccccHHHHHHHcccccccHHHHHHHHccccHHHHHHHcccccccccccccccccccccccccccccccccHHHHHHHHHHccHHHHHHHHHHHHHHHHccccccccccccccccccEEEEccHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccHHHHHcccccccEEEcHHHHHHHHHHccccccccccEEEEEEEccccEEEEEEEccccHHHHHHccccccccccccccHHcHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEcccHHHHHHHHHHHHHHHcccccccccccEEEEcccccccccHHHHHHHccccccEEEEEEccccccccccccccHHHHHHHHHHHccccccccccccc
cccEEcccccccccccEEEEEcEEEccccccccEEEEEEEccccccccccccccEEEEEccccccccccccccccccEEEEEccEEEEEcccccccccHcccccccccccccccccccccccccHHHHHHHHHHHcccccHHHcccccccccccccccccccccccccccccccccccccccccccEEEcHHHHHHHHccccHHHHHHHHHHHHHHHHHHHcccccHHHHHHHcccEEEEccHHHHHHHHHHHHcccccccccccHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccHHHEcccccHHHEEccHHHHHHHHHHHccccccccEEEEEEcccccEEEEEEEcccHHHHHHHHHcccccEEccccEEEccHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEccccHHHHHHHHHHHHHHHccccHHHcccEEEccccEEEccHHHHHHHHccccHHHHEEEEcccccccEEcccccHHHHHHHHHHcccccccccccccc
mdtlclksgihgitspisvggplevrsnsaQQQVTAAVgksagvappqkrassgffsfryplkslwpgggswgskrykgiaLEDAVLaesgekgvvagdadananargdngtsssshtdgqkgnWVLKILHVTSLWKDREEMEQEQGQGLEKQMDAAvngqpndnredvdedeeeceackindddeiefdgdSFSRLLRKVSLAEAKLYAQMSYLGTlaycipkikpgnllkyrglhfITSSIEKKELALKAEKDqmssekpeadrkiedeaegkeqknngyrisaSSAYHIAASAASYLHyhtrsilpfsktergkdspemdngsddntsimdSDVASFMATTDSVTAVVAAKEEVKQAVADdlkstrlspcewficdddqsaTRFFVIQGSESLASWQANLlfepvqfeGLEVVVHRGIYEAAKGIYEQMLPEVHAHLKACgkhatfrftghslgGSLSVLINLMLLIrgevpassllpvitfgapsimcggdhllrklglprshvqsitlhrdivprafscnypNHVAELLKAVNRnfrnhpclnnqv
mdtlclksgihgitspisvGGPLEVRSNSAQQQVTAAvgksagvappqKRASSGFFSFRYPLKSLWPGGGSWGSKRYKGIALEDAVLAESGEKGVVAGDADANANARgdngtsssshtdgqkgnwVLKILHVTSLWKDREEMEQEQGQGLEKQMDAAVNGQPNDNREDVDEDEEECEAckindddeiefDGDSFSRLLRKVSLAEAKLYAQMSYLGTLAYCIPKIKPGNLLKYRGLHFITSSIEKKELALKAekdqmssekpeadrkiedeaegkeqknngyRISASSAYHIAASAASYLHYHTRSILpfsktergkdspemdngsddntSIMDSDVASFMATTDSVTAVVAAKEEVKQAvaddlkstrlspCEWFICDDDQSATRFFVIQGSESLASWQANLLFEPVQFEGLEVVVHRGIYEAAKGIYEQMLPEVHAHLKACGKHATFRFTGHSLGGSLSVLINLMLLIRGEVPASSLLPVITFGAPSIMCGGDHLLRKLGLPRSHVQSITLHRDIVPRAFSCNYPNHVAELLKAVNrnfrnhpclnnqv
MDTLCLKSGIHGITSPISVGGPLEVRSNSAQQQVTAAVGKSAGVAPPQKRASSGFFSFRYPLKSLWPGGGSWGSKRYKGIALEDAVLAESGEKGVVagdadananargdngTSSSSHTDGQKGNWVLKILHVTSLWKDReemeqeqgqglekqmDAAVNGQPNDNRedvdedeeeceACKINDDDEIEFDGDSFSRLLRKVSLAEAKLYAQMSYLGTLAYCIPKIKPGNLLKYRGLHFITSSIekkelalkaekDQMSSEKPEADRKIEDEAEGKEQKNNGYRisassayhiaasaasylhyhTRSILPFSKTERGKDSPEMDNGSDDNTSIMDSDVASFMattdsvtavvaakeevkqavaDDLKSTRLSPCEWFICDDDQSATRFFVIQGSESLASWQANLLFEPVQFEGLEVVVHRGIYEAAKGIYEQMLPEVHAHLKACGKHATFRFTGHSLGGSLSVLINLMLLIRGEVPASSLLPVITFGAPSIMCGGDHLLRKLGLPRSHVQSITLHRDIVPRAFSCNYPNHVAELLKAVNRNFRNHPCLNNQV
********GIHGI****************************************GFFSFRYPLKSLWPGGGSWGSKRYKGIALEDAVLA**********************************GNWVLKILHVTSLWK*************************************************IEFDGDSFSRLLRKVSLAEAKLYAQMSYLGTLAYCIPKIKPGNLLKYRGLHFITSSI********************************************SAYHIAASAASYLHYHTRSILP********************************ATTDSVTAVVAAKEEVKQAVADDLKSTRLSPCEWFICDDDQSATRFFVIQGSESLASWQANLLFEPVQFEGLEVVVHRGIYEAAKGIYEQMLPEVHAHLKACGKHATFRFTGHSLGGSLSVLINLMLLIRGEVPASSLLPVITFGAPSIMCGGDHLLRKLGLPRSHVQSITLHRDIVPRAFSCNYPNHVAELLKAVNRNFRNH*******
***LC**SGIHGITSPIS***************************************FRYPL**************************************************************WVLKILH*****************************QPNDNREDVDEDEEECEACKINDDDEIEFDGDSFSRLLRKVSLAEAKLYAQMSYLGTLAYCIPKIKPGNLLKYRGLHFI****************************************************IAASAA*********************************SIMDSDVASFMATTDSVTAVVAAKEEVKQAVADDLKSTRLSPCEWFICDDDQSATRFFVIQGSESLASWQANLLFEPVQFEGLEVVVHRGIYEAAKGIYEQMLPEVHAHLKACGKHATFRFTGHSLGGSLSVLINLMLLIRGEVPASSLLPVITFGAPSIMCGGDHLLRKLGLPRSHVQSITLHRDIVPRAFSCNYPNHVAELLKAVNRNFRNHPCLN***
MDTLCLKSGIHGITSPISVGGPLE************************KRASSGFFSFRYPLKSLWPGGGSWGSKRYKGIALEDAVLAESGEKGVVAGDADANANA*************GQKGNWVLKILHVTSLWKD*****************AAVNG*****************ACKINDDDEIEFDGDSFSRLLRKVSLAEAKLYAQMSYLGTLAYCIPKIKPGNLLKYRGLHFITSSIEKKELAL***************************KNNGYRISASSAYHIAASAASYLHYHTRSILPFSKT***********GSDDNTSIMDSDVASFMATTDSVTAVVAAKEEVKQAVADDLKSTRLSPCEWFICDDDQSATRFFVIQGSESLASWQANLLFEPVQFEGLEVVVHRGIYEAAKGIYEQMLPEVHAHLKACGKHATFRFTGHSLGGSLSVLINLMLLIRGEVPASSLLPVITFGAPSIMCGGDHLLRKLGLPRSHVQSITLHRDIVPRAFSCNYPNHVAELLKAVNRNFRNHPCLNNQV
**TLCLKSGIHGITSPISVGGPLEVRSNSAQQQVTAAVGKSAGVAPPQKRASSGFFSFRYPLKSLWPGGGSWGSKRYKGIALEDAVLAESG*******************************GNWVLKILHVTSLWK*************************************ECEACKINDDDEIEFDGDSFSRLLRKVSLAEAKLYAQMSYLGTLAYCIPKIKPGNLLKYRGLHFITSSIEKKELA*********************************RISASSAYHIAASAASYLHYHTRSILPF****************************SF***TDSVTAVVAAKEEVKQAVADDLKSTRLSPCEWFICDDDQSATRFFVIQGSESLASWQANLLFEPVQFEGLEVVVHRGIYEAAKGIYEQMLPEVHAHLKACGKHATFRFTGHSLGGSLSVLINLMLLIRGEVPASSLLPVITFGAPSIMCGGDHLLRKLGLPRSHVQSITLHRDIVPRAFSCNYPNHVAELLKAVNRNFRNHPCL****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDTLCLKSGIHGITSPISVGGPLEVRSNSAQQQVTAAVGKSAGVAPPQKRASSGFFSFRYPLKSLWPGGGSWGSKRYKGIALEDAVLAESGEKGVVAGDADANANARGDNGTSSSSHTDGQKGNWVLKILHVTSLWKDREEMEQEQGQGLEKQMDAAVNGQPNDNREDVDEDEEECEACKINDDDEIEFDGDSFSRLLRKVSLAEAKLYAQMSYLGTLAYCIPKIKPGNLLKYRGLHFITSSIEKKELALKAEKDQMSSEKPEADRKIEDEAEGKEQKNNGYRISASSAYHIAASAASYLHYHTRSILPFSKTERGKDSPEMDNGSDDNTSIMDSDVASFMATTDSVTAVVAAKEEVKQAVADDLKSTRLSPCEWFICDDDQSATRFFVIQGSESLASWQANLLFEPVQFEGLEVVVHRGIYEAAKGIYEQMLPEVHAHLKACGKHATFRFTGHSLGGSLSVLINLMLLIRGEVPASSLLPVITFGAPSIMCGGDHLLRKLGLPRSHVQSITLHRDIVPRAFSCNYPNHVAELLKAVNRNFRNHPCLNNQV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query551 2.2.26 [Sep-21-2011]
P19515363 Lipase OS=Rhizomucor mieh N/A no 0.235 0.358 0.301 4e-06
P61872392 Lipase OS=Rhizopus oryzae N/A no 0.264 0.372 0.253 0.0002
P61871392 Lipase OS=Rhizopus niveus N/A no 0.264 0.372 0.253 0.0002
>sp|P19515|LIP_RHIMI Lipase OS=Rhizomucor miehei PE=1 SV=2 Back     alignment and function desciption
 Score = 53.5 bits (127), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 44/146 (30%), Positives = 73/146 (50%), Gaps = 16/146 (10%)

Query: 381 DQSATRFFVIQGSESLASWQANLLFEPVQFEGLE-VVVHRGIYEAAKGIYEQMLPEVHAH 439
           D   T + V +GS S+ +W A+L F PV +  +    VH+G  ++   +  +++  V   
Sbjct: 164 DSEKTIYIVFRGSSSIRNWIADLTFVPVSYPPVSGTKVHKGFLDSYGEVQNELVATVLDQ 223

Query: 440 LKACGKHATFR--FTGHSLGGSLSVLINLMLLIRGEVPASSLLPVITFGAPSIMCGGD-- 495
            K   ++ +++   TGHSLGG+ ++L  L L  R E  +SS L + T G P +   GD  
Sbjct: 224 FK---QYPSYKVAVTGHSLGGATALLCALDLYQREEGLSSSNLFLYTQGQPRV---GDPA 277

Query: 496 --HLLRKLGLPRSHVQSITLHRDIVP 519
             + +   G+P     +    RDIVP
Sbjct: 278 FANYVVSTGIPYRRTVN---ERDIVP 300





Rhizomucor miehei (taxid: 4839)
EC: 3EC: .EC: 1EC: .EC: 1EC: .EC: 3
>sp|P61872|LIP_RHIOR Lipase OS=Rhizopus oryzae PE=1 SV=1 Back     alignment and function description
>sp|P61871|LIP_RHINI Lipase OS=Rhizopus niveus PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query551
255548495 727 triacylglycerol lipase, putative [Ricinu 0.941 0.713 0.674 0.0
357442301 680 Lipase [Medicago truncatula] gi|35548047 0.911 0.738 0.592 1e-171
356500082 704 PREDICTED: uncharacterized protein LOC10 0.921 0.721 0.615 1e-171
356534852 755 PREDICTED: uncharacterized protein LOC10 0.934 0.682 0.576 1e-169
225437523 717 PREDICTED: uncharacterized protein LOC10 0.936 0.719 0.637 1e-169
147788961 740 hypothetical protein VITISV_016652 [Viti 0.936 0.697 0.637 1e-169
449436753 714 PREDICTED: uncharacterized protein LOC10 0.936 0.722 0.596 1e-168
449533453621 PREDICTED: uncharacterized protein LOC10 0.936 0.830 0.596 1e-168
297743960620 unnamed protein product [Vitis vinifera] 0.820 0.729 0.607 1e-160
356503921 701 PREDICTED: uncharacterized protein LOC10 0.921 0.724 0.569 1e-157
>gi|255548495|ref|XP_002515304.1| triacylglycerol lipase, putative [Ricinus communis] gi|223545784|gb|EEF47288.1| triacylglycerol lipase, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  679 bits (1753), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 381/565 (67%), Positives = 435/565 (76%), Gaps = 46/565 (8%)

Query: 1   MDTLCLKSGIHGITSPISVGG---PLEVRSNSAQQQVTAAVGKSAGVAPPQKRASSGFFS 57
           MD+LCLK GIH IT  ISVGG    LEVR+N++Q   T          PPQK AS   FS
Sbjct: 1   MDSLCLKPGIHSITPSISVGGGGAALEVRANASQVSAT----------PPQKAASR--FS 48

Query: 58  FRYPLKSLWPGGG--SWGSKRYKGIALEDAVLAESGEKGVVAGDADANANARGDNGTSSS 115
           FRYPL+S WPGGG  +  + RY G+A++DAVL E+ E      D+D           S S
Sbjct: 49  FRYPLQSFWPGGGKSNNNNNRYNGMAVDDAVLVENKE------DSDTK---------SMS 93

Query: 116 SHTDGQKGN-WVLKILHVTSLWKDREEMEQEQGQGLEKQMDAAVNGQPNDNREDVDEDEE 174
           S ++ Q GN WVLKILHV SL KD EE    +        D     + N    + +E EE
Sbjct: 94  SLSEVQNGNNWVLKILHVRSLRKDEEERSGGEESDNNGGRDVV---EMNGGVNNEEEVEE 150

Query: 175 ECEACKINDDDE--IEFDGDSFSRLLRKVSLAEAKLYAQMSYLGTLAYCIPKIKPGNLLK 232
            C+AC+++DDDE  IEFD DSFSRLL+KVSLAEAKLYAQMSYLG LAYCIP+IK GNLLK
Sbjct: 151 HCDACRVDDDDEKGIEFDKDSFSRLLKKVSLAEAKLYAQMSYLGNLAYCIPRIKAGNLLK 210

Query: 233 YRGLHFITSSIEKKELALKAEKDQMSSEKPEADRKI-----EDEAEGKEQKNNGYRISAS 287
           YRGLH++TSSI+K+EL++K EK Q+S+E  EA+ +      E EAE KEQKNNGY ISAS
Sbjct: 211 YRGLHYVTSSIDKRELSMKTEKIQVSAEDQEAEAEAKKGVPEKEAEVKEQKNNGYHISAS 270

Query: 288 SAYHIAASAASYLHYHTRSILPF--SKTERGKDSPEMDNGSDDNTSIMDSDVASFMATTD 345
           +AY IAASAASYLH HT+SILPF  SK+E G DSPE  NG + N + ++S+VAS MATTD
Sbjct: 271 AAYQIAASAASYLHSHTKSILPFKSSKSEAGNDSPEGSNGGNKNVNSINSEVASLMATTD 330

Query: 346 SVTAVVAAKEEVKQAVADDLKSTRLSPCEWFICDDDQSATRFFVIQGSESLASWQANLLF 405
           SVTAVVAAKEEVKQAVADDL ST  SPCEWFICDDDQ  TR+FVIQGSESLASWQANLLF
Sbjct: 331 SVTAVVAAKEEVKQAVADDLSSTHSSPCEWFICDDDQ-GTRYFVIQGSESLASWQANLLF 389

Query: 406 EPVQFEGLEVVVHRGIYEAAKGIYEQMLPEVHAHLKACGKHATFRFTGHSLGGSLSVLIN 465
           EPVQFEGL+V+VHRGIYEAAKG+YEQMLPEV  HLK+CG+ ATFRFTGHSLGGSLS+LIN
Sbjct: 390 EPVQFEGLDVLVHRGIYEAAKGMYEQMLPEVRTHLKSCGRRATFRFTGHSLGGSLSLLIN 449

Query: 466 LMLLIRGEVPASSLLPVITFGAPSIMCGGDHLLRKLGLPRSHVQSITLHRDIVPRAFSCN 525
           LML IR EVP S+LLPVITFGAPS+MCGGD LLRKLGLPRSHVQ+I +HRDIVPRAFSCN
Sbjct: 450 LMLFIRNEVPVSALLPVITFGAPSVMCGGDSLLRKLGLPRSHVQAIAMHRDIVPRAFSCN 509

Query: 526 YPNHVAELLKAVNRNFRNHPCLNNQ 550
           YPNHVAELLKAVN +FRNHPCLNNQ
Sbjct: 510 YPNHVAELLKAVNGSFRNHPCLNNQ 534




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|357442301|ref|XP_003591428.1| Lipase [Medicago truncatula] gi|355480476|gb|AES61679.1| Lipase [Medicago truncatula] Back     alignment and taxonomy information
>gi|356500082|ref|XP_003518863.1| PREDICTED: uncharacterized protein LOC100807834 [Glycine max] Back     alignment and taxonomy information
>gi|356534852|ref|XP_003535965.1| PREDICTED: uncharacterized protein LOC100786628 [Glycine max] Back     alignment and taxonomy information
>gi|225437523|ref|XP_002270132.1| PREDICTED: uncharacterized protein LOC100267577 [Vitis vinifera] Back     alignment and taxonomy information
>gi|147788961|emb|CAN73724.1| hypothetical protein VITISV_016652 [Vitis vinifera] Back     alignment and taxonomy information
>gi|449436753|ref|XP_004136157.1| PREDICTED: uncharacterized protein LOC101220023 [Cucumis sativus] Back     alignment and taxonomy information
>gi|449533453|ref|XP_004173690.1| PREDICTED: uncharacterized protein LOC101226119, partial [Cucumis sativus] Back     alignment and taxonomy information
>gi|297743960|emb|CBI36930.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356503921|ref|XP_003520748.1| PREDICTED: uncharacterized protein LOC100788786 [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query551
TAIR|locus:2196045 713 AT1G02660 [Arabidopsis thalian 0.769 0.594 0.519 7.8e-110
TAIR|locus:2081720 649 AT3G62590 [Arabidopsis thalian 0.500 0.425 0.561 1.2e-102
TAIR|locus:2076785 649 AT3G61680 [Arabidopsis thalian 0.335 0.285 0.627 1.1e-76
DICTYBASE|DDB_G0277473287 DDB_G0277473 [Dictyostelium di 0.263 0.505 0.284 4e-06
TAIR|locus:2196045 AT1G02660 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1085 (387.0 bits), Expect = 7.8e-110, P = 7.8e-110
 Identities = 231/445 (51%), Positives = 280/445 (62%)

Query:   112 TSSSSHTDGQKGNWVLKILHVTSLWKDRXXXXXXXXXXXXXXXDAAVNGQPNDNRXXXXX 171
             T+    T+ + G+WVLKIL V S WK                 D  V  + +D       
Sbjct:    94 TAVEMDTERRNGSWVLKILDVQSTWKHEEEEDDDEVEDEDGDEDEEV--ELDD--AVVSE 149

Query:   172 XXXXXXACKINDDD-----EIEFDGDSFSRLLRKVSLAEAKLYAQMSYLGTLAYCIPKIK 226
                    C + +DD     + + D +SFS+LLR+V+L E+KLYAQ+SYLG LAY I KIK
Sbjct:   150 DDGGCDVCSVLEDDGNEANKFQLDRESFSKLLRRVTLPESKLYAQLSYLGNLAYSISKIK 209

Query:   227 PGNLLKYRGLHFITSSIXXXXXXXXXXXDQMSSE-KPEADRKIEDEAEGKEQKNNGYRXX 285
             P NL KY GL F+TSS             ++S E KP  +   E+E E +E+KN   +  
Sbjct:   210 PANLSKYYGLRFVTSSAEKTESALKAENGEVSGETKPIVEA--EEEVE-EEEKNKSRKIS 266

Query:   286 XXXXXXXXXXXXXXXXXXTRSILPFSKTERGKDSPEMDNGSDDNTSIMDSDVASFMXXXX 345
                               T +ILPF+ + + ++S + D    +  S   SDVA       
Sbjct:   267 ASAAYEIVASAASYLHSRTNNILPFNSSSKAENSDKHDVNLTNAES--SSDVA------Y 318

Query:   346 XXXXXXXXXXXXXXXXXDDLKSTRLSPCEWFICDDDQSATRFFVIQGSESLASWQANLLF 405
                              DDLKST  SPC+WFICDDDQS TRF VIQGSESLASWQANLLF
Sbjct:   319 SVTSVVAAEEDVKQAVADDLKSTISSPCDWFICDDDQSHTRFVVIQGSESLASWQANLLF 378

Query:   406 EPVQFEGLEVVVHRGIYEAAKGIYEQMLPEVHAHLKACGKHATFRFTGHSLGGSLSVLIN 465
             EP++FEGL  +VHRGIYEAAKG+YEQMLPEV AH+K  G  A FRFTGHSLGGSLS+L+N
Sbjct:   379 EPIEFEGLGAIVHRGIYEAAKGMYEQMLPEVKAHIKTHGTSAKFRFTGHSLGGSLSLLLN 438

Query:   466 LMLLIRGEVPASSLLPVITFGAPSIMCGGDHLLRKLGLPRSHVQSITLHRDIVPRAFSCN 525
             LMLL+RGEVPASSLLPVIT+GAP ++CGGD LL+KLGLP+SHVQ+I +HRDIVPRAFSCN
Sbjct:   439 LMLLVRGEVPASSLLPVITYGAPFVLCGGDRLLKKLGLPKSHVQAIVMHRDIVPRAFSCN 498

Query:   526 YPNHVAELLKAVNRNFRNHPCLNNQ 550
             YP HVAELLKAVN NFR+HPCLN Q
Sbjct:   499 YPYHVAELLKAVNGNFRSHPCLNKQ 523


GO:0004806 "triglyceride lipase activity" evidence=IEA;ISS
GO:0005576 "extracellular region" evidence=ISM
GO:0006629 "lipid metabolic process" evidence=IEA;ISS
TAIR|locus:2081720 AT3G62590 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2076785 AT3G61680 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0277473 DDB_G0277473 [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.1.1LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00028087001
SubName- Full=Chromosome chr7 scaffold_42, whole genome shotgun sequence; (648 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query551
cd00519229 cd00519, Lipase_3, Lipase (class 3) 4e-32
pfam01764141 pfam01764, Lipase_3, Lipase (class 3) 1e-30
cd00741153 cd00741, Lipase, Lipase 8e-18
PLN02934515 PLN02934, PLN02934, triacylglycerol lipase 4e-07
PLN03037 525 PLN03037, PLN03037, lipase class 3 family protein; 0.001
>gnl|CDD|238287 cd00519, Lipase_3, Lipase (class 3) Back     alignment and domain information
 Score =  122 bits (309), Expect = 4e-32
 Identities = 51/160 (31%), Positives = 70/160 (43%), Gaps = 9/160 (5%)

Query: 371 SPCEWFICDDDQSATRFFVIQGSESLASWQANLLFEPVQFEGL---EVVVHRGIYEAAKG 427
              + ++  D    T     +G+ SLA W  +L F PV  +        VH G Y A K 
Sbjct: 50  YDTQGYVAVDHDRKTIVIAFRGTVSLADWLTDLDFSPVPLDPPLCSGGKVHSGFYSAYKS 109

Query: 428 IYEQMLPEVHAHLKACGKHATFRFTGHSLGGSLSVLINLMLLIRGEVPASSLLPVITFGA 487
           +Y Q+LPE+ + LK          TGHSLGG+L+ L+ L L +RG     S + V TFG 
Sbjct: 110 LYNQVLPELKSALKQY-PDYKIIVTGHSLGGALASLLALDLRLRG---PGSDVTVYTFGQ 165

Query: 488 PSIMCGGDHLLRKLGLPRSHVQSITLHRDIVPRAFSCNYP 527
           P    G       L   +  V  +    DIVPR    +  
Sbjct: 166 PR--VGNAAFAEYLESTKGRVYRVVHGNDIVPRLPPGSLT 203


Lipases are esterases that can hydrolyze long-chain acyl-triglycerides into di- and monoglycerides, glycerol, and free fatty acids at a water/lipid interface. A typical feature of lipases is "interfacial activation," the process of becoming active at the lipid/water interface, although several examples of lipases have been identified that do not undergo interfacial activation . The active site of a lipase contains a catalytic triad consisting of Ser - His - Asp/Glu, but unlike most serine proteases, the active site is buried inside the structure. A "lid" or "flap" covers the active site, making it inaccessible to solvent and substrates. The lid opens during the process of interfacial activation, allowing the lipid substrate access to the active site. . Length = 229

>gnl|CDD|216688 pfam01764, Lipase_3, Lipase (class 3) Back     alignment and domain information
>gnl|CDD|238382 cd00741, Lipase, Lipase Back     alignment and domain information
>gnl|CDD|215504 PLN02934, PLN02934, triacylglycerol lipase Back     alignment and domain information
>gnl|CDD|215547 PLN03037, PLN03037, lipase class 3 family protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 551
cd00519229 Lipase_3 Lipase (class 3). Lipases are esterases t 99.97
PLN02310405 triacylglycerol lipase 99.96
PF01764140 Lipase_3: Lipase (class 3); InterPro: IPR002921 Tr 99.95
PLN02408365 phospholipase A1 99.95
PLN02454414 triacylglycerol lipase 99.95
PLN02934515 triacylglycerol lipase 99.95
PLN02324415 triacylglycerol lipase 99.95
PLN02802509 triacylglycerol lipase 99.95
PLN02571413 triacylglycerol lipase 99.95
PLN02753 531 triacylglycerol lipase 99.94
PLN02719 518 triacylglycerol lipase 99.94
PLN03037 525 lipase class 3 family protein; Provisional 99.94
PLN02761 527 lipase class 3 family protein 99.94
PLN02162475 triacylglycerol lipase 99.94
PLN00413479 triacylglycerol lipase 99.94
PLN02847 633 triacylglycerol lipase 99.93
KOG4569336 consensus Predicted lipase [Lipid transport and me 99.92
cd00741153 Lipase Lipase. Lipases are esterases that can hydr 99.7
PF11187224 DUF2974: Protein of unknown function (DUF2974); In 99.42
COG5153425 CVT17 Putative lipase essential for disintegration 98.75
KOG4540425 consensus Putative lipase essential for disintegra 98.75
COG3675332 Predicted lipase [Lipid metabolism] 98.44
KOG2088 596 consensus Predicted lipase/calmodulin-binding heat 97.92
COG3675332 Predicted lipase [Lipid metabolism] 97.44
PF06259177 Abhydrolase_8: Alpha/beta hydrolase; InterPro: IPR 96.5
PF07819225 PGAP1: PGAP1-like protein; InterPro: IPR012908 The 96.47
PF05057217 DUF676: Putative serine esterase (DUF676); InterPr 96.17
PF01083179 Cutinase: Cutinase; InterPro: IPR000675 Aerial pla 96.15
PF00975229 Thioesterase: Thioesterase domain; InterPro: IPR00 95.6
KOG2088 596 consensus Predicted lipase/calmodulin-binding heat 95.33
TIGR01607332 PST-A Plasmodium subtelomeric family (PST-A). Thes 94.95
KOG2564343 consensus Predicted acetyltransferases and hydrola 94.91
COG2267298 PldB Lysophospholipase [Lipid metabolism] 94.56
PLN02965255 Probable pheophorbidase 94.09
COG3208244 GrsT Predicted thioesterase involved in non-riboso 93.77
PF12697228 Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3 93.61
PHA02857276 monoglyceride lipase; Provisional 93.49
TIGR02427251 protocat_pcaD 3-oxoadipate enol-lactonase. Members 93.47
cd00707275 Pancreat_lipase_like Pancreatic lipase-like enzyme 93.38
PRK11126242 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxyl 93.32
PRK10749330 lysophospholipase L2; Provisional 93.32
PF06028255 DUF915: Alpha/beta hydrolase of unknown function ( 93.31
TIGR03695251 menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene 93.29
PLN02733 440 phosphatidylcholine-sterol O-acyltransferase 92.75
PLN02211273 methyl indole-3-acetate methyltransferase 92.62
PLN02824294 hydrolase, alpha/beta fold family protein 92.61
PLN02298330 hydrolase, alpha/beta fold family protein 92.59
PRK10673255 acyl-CoA esterase; Provisional 92.52
PF11288207 DUF3089: Protein of unknown function (DUF3089); In 92.48
PF00561230 Abhydrolase_1: alpha/beta hydrolase fold A web pag 92.41
PRK10985324 putative hydrolase; Provisional 92.26
PLN02385349 hydrolase; alpha/beta fold family protein 92.26
TIGR03611257 RutD pyrimidine utilization protein D. This protei 92.21
PRK10566249 esterase; Provisional 92.18
KOG3724 973 consensus Negative regulator of COPII vesicle form 92.09
PF05277345 DUF726: Protein of unknown function (DUF726); Inte 91.9
PRK11071190 esterase YqiA; Provisional 91.87
TIGR02240276 PHA_depoly_arom poly(3-hydroxyalkanoate) depolymer 91.79
TIGR01250288 pro_imino_pep_2 proline-specific peptidases, Bacil 91.78
PF12695145 Abhydrolase_5: Alpha/beta hydrolase family; PDB: 3 91.31
COG3319257 Thioesterase domains of type I polyketide synthase 91.28
TIGR03230 442 lipo_lipase lipoprotein lipase. Members of this pr 91.16
KOG1455313 consensus Lysophospholipase [Lipid transport and m 90.92
PRK00870302 haloalkane dehalogenase; Provisional 90.85
TIGR03056278 bchO_mg_che_rel putative magnesium chelatase acces 90.69
PF02450 389 LCAT: Lecithin:cholesterol acyltransferase; InterP 90.47
PF05728187 UPF0227: Uncharacterised protein family (UPF0227); 90.31
TIGR01836 350 PHA_synth_III_C poly(R)-hydroxyalkanoic acid synth 90.26
PF00326213 Peptidase_S9: Prolyl oligopeptidase family This fa 90.19
PRK08775 343 homoserine O-acetyltransferase; Provisional 89.86
TIGR03101266 hydr2_PEP hydrolase, ortholog 2, exosortase system 89.71
PLN02511 388 hydrolase 89.57
TIGR02821275 fghA_ester_D S-formylglutathione hydrolase. This m 89.46
TIGR03343282 biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-die 89.07
PLN02442283 S-formylglutathione hydrolase 88.57
COG4782377 Uncharacterized protein conserved in bacteria [Fun 88.4
PRK14875371 acetoin dehydrogenase E2 subunit dihydrolipoyllysi 88.38
PRK03204286 haloalkane dehalogenase; Provisional 88.37
PLN02652395 hydrolase; alpha/beta fold family protein 88.29
TIGR01392 351 homoserO_Ac_trn homoserine O-acetyltransferase. Th 88.27
PRK03592295 haloalkane dehalogenase; Provisional 88.14
TIGR01840212 esterase_phb esterase, PHB depolymerase family. Th 88.12
PF05990233 DUF900: Alpha/beta hydrolase of unknown function ( 88.01
TIGR01738245 bioH putative pimeloyl-BioC--CoA transferase BioH. 87.74
TIGR03100274 hydr1_PEP hydrolase, ortholog 1, exosortase system 87.69
PLN02894 402 hydrolase, alpha/beta fold family protein 87.66
PRK11460232 putative hydrolase; Provisional 87.5
PF07859211 Abhydrolase_3: alpha/beta hydrolase fold A web pag 87.1
PF08237225 PE-PPE: PE-PPE domain; InterPro: IPR013228 The hum 87.07
PRK13604 307 luxD acyl transferase; Provisional 87.07
PLN00021313 chlorophyllase 86.88
TIGR01249 306 pro_imino_pep_1 proline iminopeptidase, Neisseria- 86.82
PRK10162318 acetyl esterase; Provisional 86.75
PRK05855 582 short chain dehydrogenase; Validated 86.5
PF05448320 AXE1: Acetyl xylan esterase (AXE1); InterPro: IPR0 86.44
PRK06489 360 hypothetical protein; Provisional 86.44
PRK10349256 carboxylesterase BioH; Provisional 86.25
TIGR01838 532 PHA_synth_I poly(R)-hydroxyalkanoic acid synthase, 85.95
PLN02679 360 hydrolase, alpha/beta fold family protein 85.9
PF02230216 Abhydrolase_2: Phospholipase/Carboxylesterase; Int 85.64
PRK00175 379 metX homoserine O-acetyltransferase; Provisional 85.33
smart00824212 PKS_TE Thioesterase. Peptide synthetases are invol 85.1
PF03959212 FSH1: Serine hydrolase (FSH1); InterPro: IPR005645 84.1
PF00756251 Esterase: Putative esterase; InterPro: IPR000801 T 84.01
PF05677365 DUF818: Chlamydia CHLPS protein (DUF818); InterPro 83.05
PRK07581 339 hypothetical protein; Validated 82.96
PLN02578354 hydrolase 82.62
PF00151331 Lipase: Lipase; InterPro: IPR013818 Triglyceride l 81.06
PLN03087 481 BODYGUARD 1 domain containing hydrolase; Provision 80.65
PRK05077414 frsA fermentation/respiration switch protein; Revi 80.58
COG0596282 MhpC Predicted hydrolases or acyltransferases (alp 80.36
COG4814288 Uncharacterized protein with an alpha/beta hydrola 80.14
>cd00519 Lipase_3 Lipase (class 3) Back     alignment and domain information
Probab=99.97  E-value=2.3e-29  Score=243.12  Aligned_cols=150  Identities=35%  Similarity=0.542  Sum_probs=131.8

Q ss_pred             CCCceEEEEEeCCCCeEEEEEccCCCHHHHHHhcCCcceecC---CCCeeEcHHHHHHHHHHHHHHHHHHHHHHHhcCCC
Q 008846          370 LSPCEWFICDDDQSATRFFVIQGSESLASWQANLLFEPVQFE---GLEVVVHRGIYEAAKGIYEQMLPEVHAHLKACGKH  446 (551)
Q Consensus       370 ~s~c~~fIa~D~~~~tIVIAFRGT~Sl~DWltDL~f~~v~fe---g~g~kVHrGFy~aa~~ly~qll~~L~~~Lks~gp~  446 (551)
                      ...+.+||+.|+..+.++|+||||.++.||++|+.+.++++.   +.+++||+||+.++..+++++...+.+++++ +|+
T Consensus        49 ~~~~~~~i~~~~~~~~ivva~RGT~~~~d~~~d~~~~~~~~~~~~~~~~~vh~Gf~~~~~~~~~~~~~~~~~~~~~-~p~  127 (229)
T cd00519          49 QYDTQGYVAVDHDRKTIVIAFRGTVSLADWLTDLDFSPVPLDPPLCSGGKVHSGFYSAYKSLYNQVLPELKSALKQ-YPD  127 (229)
T ss_pred             CCCceEEEEEECCCCeEEEEEeCCCchHHHHHhcccccccCCCCCCCCcEEcHHHHHHHHHHHHHHHHHHHHHHhh-CCC
Confidence            345668999999999999999999999999999999888875   4789999999999999999999999887776 589


Q ss_pred             ceEEEeecChhHHHHHHHHHHHHHcCCCCCCCcccEEEeCCCcCCCCChHHHHHcCCCCCcEEEEEECCCcccccCCCC
Q 008846          447 ATFRFTGHSLGGSLSVLINLMLLIRGEVPASSLLPVITFGAPSIMCGGDHLLRKLGLPRSHVQSITLHRDIVPRAFSCN  525 (551)
Q Consensus       447 ~kIiVTGHSLGGALAsLaAL~L~~~~~~p~~~~v~VyTFGSPrVmcGnd~fa~~l~~~~~~I~RVVn~~DIVPrLP~~~  525 (551)
                      ++|+||||||||++|+|+++++..+.  + ...+.+||||+|++  |+..+++........++||+|..|+||+||+..
T Consensus       128 ~~i~vtGHSLGGaiA~l~a~~l~~~~--~-~~~i~~~tFg~P~v--g~~~~a~~~~~~~~~~~rvv~~~D~Vp~lp~~~  201 (229)
T cd00519         128 YKIIVTGHSLGGALASLLALDLRLRG--P-GSDVTVYTFGQPRV--GNAAFAEYLESTKGRVYRVVHGNDIVPRLPPGS  201 (229)
T ss_pred             ceEEEEccCHHHHHHHHHHHHHHhhC--C-CCceEEEEeCCCCC--CCHHHHHHhhccCCCEEEEEECCCcccccCccc
Confidence            99999999999999999999997543  1 23578999999999  888888865555677999999999999999875



Lipases are esterases that can hydrolyze long-chain acyl-triglycerides into di- and monoglycerides, glycerol, and free fatty acids at a water/lipid interface. A typical feature of lipases is "interfacial activation," the process of becoming active at the lipid/water interface, although several examples of lipases have been identified that do not undergo interfacial activation . The active site of a lipase contains a catalytic triad consisting of Ser - His - Asp/Glu, but unlike most serine proteases, the active site is buried inside the structure. A "lid" or "flap" covers the active site, making it inaccessible to solvent and substrates. The lid opens during the process of interfacial activation, allowing the lipid substrate access to the active site.

>PLN02310 triacylglycerol lipase Back     alignment and domain information
>PF01764 Lipase_3: Lipase (class 3); InterPro: IPR002921 Triglyceride lipases are lipolytic enzymes that hydrolyse ester linkages of triglycerides [] Back     alignment and domain information
>PLN02408 phospholipase A1 Back     alignment and domain information
>PLN02454 triacylglycerol lipase Back     alignment and domain information
>PLN02934 triacylglycerol lipase Back     alignment and domain information
>PLN02324 triacylglycerol lipase Back     alignment and domain information
>PLN02802 triacylglycerol lipase Back     alignment and domain information
>PLN02571 triacylglycerol lipase Back     alignment and domain information
>PLN02753 triacylglycerol lipase Back     alignment and domain information
>PLN02719 triacylglycerol lipase Back     alignment and domain information
>PLN03037 lipase class 3 family protein; Provisional Back     alignment and domain information
>PLN02761 lipase class 3 family protein Back     alignment and domain information
>PLN02162 triacylglycerol lipase Back     alignment and domain information
>PLN00413 triacylglycerol lipase Back     alignment and domain information
>PLN02847 triacylglycerol lipase Back     alignment and domain information
>KOG4569 consensus Predicted lipase [Lipid transport and metabolism] Back     alignment and domain information
>cd00741 Lipase Lipase Back     alignment and domain information
>PF11187 DUF2974: Protein of unknown function (DUF2974); InterPro: IPR024499 This family of proteins has no known function Back     alignment and domain information
>COG5153 CVT17 Putative lipase essential for disintegration of autophagic bodies inside the vacuole [Intracellular trafficking and secretion / Lipid metabolism] Back     alignment and domain information
>KOG4540 consensus Putative lipase essential for disintegration of autophagic bodies inside the vacuole [Intracellular trafficking, secretion, and vesicular transport; Lipid transport and metabolism] Back     alignment and domain information
>COG3675 Predicted lipase [Lipid metabolism] Back     alignment and domain information
>KOG2088 consensus Predicted lipase/calmodulin-binding heat-shock protein [Lipid transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>COG3675 Predicted lipase [Lipid metabolism] Back     alignment and domain information
>PF06259 Abhydrolase_8: Alpha/beta hydrolase; InterPro: IPR010427 This is a family of uncharacterised proteins found in Actinobacteria Back     alignment and domain information
>PF07819 PGAP1: PGAP1-like protein; InterPro: IPR012908 The sequences found in this family are similar to PGAP1 (Q765A7 from SWISSPROT) Back     alignment and domain information
>PF05057 DUF676: Putative serine esterase (DUF676); InterPro: IPR007751 This domain, whose function is unknown, is found within a group of putative lipases Back     alignment and domain information
>PF01083 Cutinase: Cutinase; InterPro: IPR000675 Aerial plant organs are protected by a cuticle composed of an insoluble polymeric structural compound, cutin, which is a polyester composed of hydroxy and hydroxyepoxy fatty acids [] Back     alignment and domain information
>PF00975 Thioesterase: Thioesterase domain; InterPro: IPR001031 Thioesterase domains often occur integrated in or associated with peptide synthetases which are involved in the non-ribosomal synthesis of peptide antibiotics [] Back     alignment and domain information
>KOG2088 consensus Predicted lipase/calmodulin-binding heat-shock protein [Lipid transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>TIGR01607 PST-A Plasmodium subtelomeric family (PST-A) Back     alignment and domain information
>KOG2564 consensus Predicted acetyltransferases and hydrolases with the alpha/beta hydrolase fold [General function prediction only] Back     alignment and domain information
>COG2267 PldB Lysophospholipase [Lipid metabolism] Back     alignment and domain information
>PLN02965 Probable pheophorbidase Back     alignment and domain information
>COG3208 GrsT Predicted thioesterase involved in non-ribosomal peptide biosynthesis [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PF12697 Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3LLC_A 3A2N_E 3A2M_A 3A2L_A 3AFI_F 3C5V_A 3C5W_P 3E0X_A 2ZJF_A 3QYJ_A Back     alignment and domain information
>PHA02857 monoglyceride lipase; Provisional Back     alignment and domain information
>TIGR02427 protocat_pcaD 3-oxoadipate enol-lactonase Back     alignment and domain information
>cd00707 Pancreat_lipase_like Pancreatic lipase-like enzymes Back     alignment and domain information
>PRK11126 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase; Provisional Back     alignment and domain information
>PRK10749 lysophospholipase L2; Provisional Back     alignment and domain information
>PF06028 DUF915: Alpha/beta hydrolase of unknown function (DUF915); InterPro: IPR010315 This family consists of bacterial proteins of unknown function, which are hydrolase-like Back     alignment and domain information
>TIGR03695 menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Back     alignment and domain information
>PLN02733 phosphatidylcholine-sterol O-acyltransferase Back     alignment and domain information
>PLN02211 methyl indole-3-acetate methyltransferase Back     alignment and domain information
>PLN02824 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>PLN02298 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>PRK10673 acyl-CoA esterase; Provisional Back     alignment and domain information
>PF11288 DUF3089: Protein of unknown function (DUF3089); InterPro: IPR021440 This family of proteins has no known function Back     alignment and domain information
>PF00561 Abhydrolase_1: alpha/beta hydrolase fold A web page of Esterases and alpha/beta hydrolases Back     alignment and domain information
>PRK10985 putative hydrolase; Provisional Back     alignment and domain information
>PLN02385 hydrolase; alpha/beta fold family protein Back     alignment and domain information
>TIGR03611 RutD pyrimidine utilization protein D Back     alignment and domain information
>PRK10566 esterase; Provisional Back     alignment and domain information
>KOG3724 consensus Negative regulator of COPII vesicle formation [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF05277 DUF726: Protein of unknown function (DUF726); InterPro: IPR007941 This family consists of several uncharacterised eukaryotic proteins Back     alignment and domain information
>PRK11071 esterase YqiA; Provisional Back     alignment and domain information
>TIGR02240 PHA_depoly_arom poly(3-hydroxyalkanoate) depolymerase Back     alignment and domain information
>TIGR01250 pro_imino_pep_2 proline-specific peptidases, Bacillus coagulans-type subfamily Back     alignment and domain information
>PF12695 Abhydrolase_5: Alpha/beta hydrolase family; PDB: 3D0K_B 2I3D_B 3DOH_B 3DOI_B 3PFB_A 3S2Z_B 3PFC_A 3QM1_A 3PF8_B 3PF9_A Back     alignment and domain information
>COG3319 Thioesterase domains of type I polyketide synthases or non-ribosomal peptide synthetases [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>TIGR03230 lipo_lipase lipoprotein lipase Back     alignment and domain information
>KOG1455 consensus Lysophospholipase [Lipid transport and metabolism] Back     alignment and domain information
>PRK00870 haloalkane dehalogenase; Provisional Back     alignment and domain information
>TIGR03056 bchO_mg_che_rel putative magnesium chelatase accessory protein Back     alignment and domain information
>PF02450 LCAT: Lecithin:cholesterol acyltransferase; InterPro: IPR003386 Lecithin:cholesterol acyltransferase (LACT), also known as phosphatidylcholine-sterol acyltransferase (2 Back     alignment and domain information
>PF05728 UPF0227: Uncharacterised protein family (UPF0227); InterPro: IPR008886 Despite being classed as uncharacterised proteins, the members of this family are almost certainly enzymes in that they contain a domain distantly related to IPR000073 from INTERPRO Back     alignment and domain information
>TIGR01836 PHA_synth_III_C poly(R)-hydroxyalkanoic acid synthase, class III, PhaC subunit Back     alignment and domain information
>PF00326 Peptidase_S9: Prolyl oligopeptidase family This family belongs to family S9 of the peptidase classification Back     alignment and domain information
>PRK08775 homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>TIGR03101 hydr2_PEP hydrolase, ortholog 2, exosortase system type 1 associated Back     alignment and domain information
>PLN02511 hydrolase Back     alignment and domain information
>TIGR02821 fghA_ester_D S-formylglutathione hydrolase Back     alignment and domain information
>TIGR03343 biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase Back     alignment and domain information
>PLN02442 S-formylglutathione hydrolase Back     alignment and domain information
>COG4782 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK14875 acetoin dehydrogenase E2 subunit dihydrolipoyllysine-residue acetyltransferase; Provisional Back     alignment and domain information
>PRK03204 haloalkane dehalogenase; Provisional Back     alignment and domain information
>PLN02652 hydrolase; alpha/beta fold family protein Back     alignment and domain information
>TIGR01392 homoserO_Ac_trn homoserine O-acetyltransferase Back     alignment and domain information
>PRK03592 haloalkane dehalogenase; Provisional Back     alignment and domain information
>TIGR01840 esterase_phb esterase, PHB depolymerase family Back     alignment and domain information
>PF05990 DUF900: Alpha/beta hydrolase of unknown function (DUF900); InterPro: IPR010297 This domain is associated with proteins of unknown function, which are hydrolase-like Back     alignment and domain information
>TIGR01738 bioH putative pimeloyl-BioC--CoA transferase BioH Back     alignment and domain information
>TIGR03100 hydr1_PEP hydrolase, ortholog 1, exosortase system type 1 associated Back     alignment and domain information
>PLN02894 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>PRK11460 putative hydrolase; Provisional Back     alignment and domain information
>PF07859 Abhydrolase_3: alpha/beta hydrolase fold A web page of Esterases and alpha/beta hydrolases Back     alignment and domain information
>PF08237 PE-PPE: PE-PPE domain; InterPro: IPR013228 The human pathogen Mycobacterium tuberculosis harbours a large number of genes that encode proteins whose N-termini contain the characteristic motifs Pro-Glu (PE) or Pro-Pro-Glu (PPE) Back     alignment and domain information
>PRK13604 luxD acyl transferase; Provisional Back     alignment and domain information
>PLN00021 chlorophyllase Back     alignment and domain information
>TIGR01249 pro_imino_pep_1 proline iminopeptidase, Neisseria-type subfamily Back     alignment and domain information
>PRK10162 acetyl esterase; Provisional Back     alignment and domain information
>PRK05855 short chain dehydrogenase; Validated Back     alignment and domain information
>PF05448 AXE1: Acetyl xylan esterase (AXE1); InterPro: IPR008391 This family consists of several bacterial acetyl xylan esterase proteins Back     alignment and domain information
>PRK06489 hypothetical protein; Provisional Back     alignment and domain information
>PRK10349 carboxylesterase BioH; Provisional Back     alignment and domain information
>TIGR01838 PHA_synth_I poly(R)-hydroxyalkanoic acid synthase, class I Back     alignment and domain information
>PLN02679 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>PF02230 Abhydrolase_2: Phospholipase/Carboxylesterase; InterPro: IPR003140 This entry represents the alpha/beta hydrolase domain found in phospholipases [], carboxylesterases [] and thioesterases Back     alignment and domain information
>PRK00175 metX homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>smart00824 PKS_TE Thioesterase Back     alignment and domain information
>PF03959 FSH1: Serine hydrolase (FSH1); InterPro: IPR005645 This entry represents proteins belonging to the AB hydrolase family Back     alignment and domain information
>PF00756 Esterase: Putative esterase; InterPro: IPR000801 This family contains several seemingly unrelated proteins, including human esterase D; mycobacterial antigen 85, which is responsible for the high affinity of mycobacteria to fibronectin; Corynebacterium glutamicum major secreted protein PS1; and hypothetical proteins from Escherichia coli, yeast, mycobacteria and Haemophilus influenzae Back     alignment and domain information
>PF05677 DUF818: Chlamydia CHLPS protein (DUF818); InterPro: IPR008536 This family of unknown function includes several Chlamydia CHLPS proteins and Legionella SidB proteins Back     alignment and domain information
>PRK07581 hypothetical protein; Validated Back     alignment and domain information
>PLN02578 hydrolase Back     alignment and domain information
>PF00151 Lipase: Lipase; InterPro: IPR013818 Triglyceride lipases (3 Back     alignment and domain information
>PLN03087 BODYGUARD 1 domain containing hydrolase; Provisional Back     alignment and domain information
>PRK05077 frsA fermentation/respiration switch protein; Reviewed Back     alignment and domain information
>COG0596 MhpC Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information
>COG4814 Uncharacterized protein with an alpha/beta hydrolase fold [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query551
3tgl_A269 Structure And Molecular Model Refinement Of Rhizomu 3e-07
4tgl_A269 Catalysis At The Interface: The Anatomy Of A Confor 4e-07
1tgl_A269 A Serine Protease Triad Forms The Catalytic Centre 4e-07
5tgl_A269 A Model For Interfacial Activation In Lipases From 5e-07
1tic_A269 Conformational Lability Of Lipases Observed In The 1e-05
>pdb|3TGL|A Chain A, Structure And Molecular Model Refinement Of Rhizomucor Miehei Triacylglyceride Lipase: A Case Study Of The Use Of Simulated Annealing In Partial Model Refinement Length = 269 Back     alignment and structure

Iteration: 1

Score = 53.5 bits (127), Expect = 3e-07, Method: Compositional matrix adjust. Identities = 49/170 (28%), Positives = 80/170 (47%), Gaps = 21/170 (12%) Query: 363 DDLK-----STRLSPCEWFICDDDQSATRFFVIQGSESLASWQANLLFEPVQFEGLE-VV 416 +DLK ST + + D T + V +GS S+ +W A+L F PV + + Sbjct: 47 EDLKIIKTWSTLIYDTNAMVARGDSEKTIYIVFRGSSSIRNWIADLTFVPVSYPPVSGTK 106 Query: 417 VHRGIYEAAKGIYEQMLPEVHAHLKACGKHATFR--FTGHSLGGSLSVLINLMLLIRGEV 474 VH+G ++ + +++ V K ++ +++ TGHSLGG+ +L L L R E Sbjct: 107 VHKGFLDSYGEVQNELVATVLDQFK---QYPSYKVAVTGHSLGGATVLLCALDLYQREEG 163 Query: 475 PASSLLPVITFGAPSIMCGGD----HLLRKLGLPRSHVQSITLHRDIVPR 520 +SS L + T G P + GD + + G+P + RDIVP Sbjct: 164 LSSSNLFLYTQGQPRV---GDPAFANYVVSTGIPYRRTVN---ERDIVPH 207
>pdb|4TGL|A Chain A, Catalysis At The Interface: The Anatomy Of A Conformational Change In A Triglyceride Lipase Length = 269 Back     alignment and structure
>pdb|1TGL|A Chain A, A Serine Protease Triad Forms The Catalytic Centre Of A Triacylglycerol Lipase Length = 269 Back     alignment and structure
>pdb|5TGL|A Chain A, A Model For Interfacial Activation In Lipases From The Structure Of A Fungal Lipase-Inhibitor Complex Length = 269 Back     alignment and structure
>pdb|1TIC|A Chain A, Conformational Lability Of Lipases Observed In The Absence Of An Oil-Water Interface: Crystallographic Studies Of Enzymes From The Fungi Humicola Lanuginosa And Rhizopus Delemar Length = 269 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query551
1tgl_A269 Triacyl-glycerol acylhydrolase; carboxylic esteras 6e-22
1tia_A279 Lipase; hydrolase(carboxylic esterase); 2.10A {Pen 9e-20
1lgy_A269 Lipase, triacylglycerol lipase; hydrolase (carboxy 2e-19
1tib_A269 Lipase; hydrolase(carboxylic esterase); 1.84A {The 1e-18
1uwc_A261 Feruloyl esterase A; hydrolase, serine esterase, x 7e-18
3o0d_A301 YALI0A20350P, triacylglycerol lipase; alpha/beta-h 2e-17
3ngm_A319 Extracellular lipase; secret lipase, hydrolase; 2. 2e-16
3g7n_A258 Lipase; hydrolase fold, hydrolase; HET: 1PE; 1.30A 8e-16
2yij_A419 Phospholipase A1-iigamma; hydrolase; 2.00A {Arabid 2e-14
3uue_A279 LIP1, secretory lipase (family 3); LID-domain, hyd 3e-13
2ory_A346 Lipase; alpha/beta hydrolase, hydrolase; 2.20A {Ph 1e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-04
>1tgl_A Triacyl-glycerol acylhydrolase; carboxylic esterase; 1.90A {Rhizomucor miehei} SCOP: c.69.1.17 PDB: 4tgl_A 5tgl_A* 3tgl_A Length = 269 Back     alignment and structure
 Score = 94.6 bits (235), Expect = 6e-22
 Identities = 41/149 (27%), Positives = 64/149 (42%), Gaps = 4/149 (2%)

Query: 373 CEWFICDDDQSATRFFVIQGSESLASWQANLLFEPVQFEGLEVV-VHRGIYEAAKGIYEQ 431
               +   D   T + V +GS S+ +W A+L F PV +  +    VH+G  ++   +  +
Sbjct: 62  TNAMVARGDSEKTIYIVFRGSSSIRNWIADLTFVPVSYPPVSGTKVHKGFLDSYGEVQNE 121

Query: 432 MLPEVHAHLKACGKHATFRFTGHSLGGSLSVLINLMLLIRGEVPASSLLPVITFGAPSIM 491
           ++  V    K          TGHSLGG+ ++L  L L  R E  +SS L + T G P + 
Sbjct: 122 LVATVLDQFKQY-PSYKVAVTGHSLGGATALLCALDLYQREEGLSSSNLFLYTQGQPRV- 179

Query: 492 CGGDHLLRKLGLPRSHVQSITLHRDIVPR 520
            G       +       +     RDIVP 
Sbjct: 180 -GNPAFANYVVSTGIPYRRTVNERDIVPH 207


>1tia_A Lipase; hydrolase(carboxylic esterase); 2.10A {Penicillium camemberti} SCOP: c.69.1.17 Length = 279 Back     alignment and structure
>1lgy_A Lipase, triacylglycerol lipase; hydrolase (carboxylic ester); 2.20A {Rhizopus niveus} SCOP: c.69.1.17 PDB: 1tic_A Length = 269 Back     alignment and structure
>1tib_A Lipase; hydrolase(carboxylic esterase); 1.84A {Thermomyces lanuginosus} SCOP: c.69.1.17 PDB: 1dt3_A 1dt5_A 1du4_A 1ein_A* 1dte_A 4dyh_A* 4ea6_A 1gt6_A* Length = 269 Back     alignment and structure
>1uwc_A Feruloyl esterase A; hydrolase, serine esterase, xylan degradation; HET: NAG FER; 1.08A {Aspergillus niger} SCOP: c.69.1.17 PDB: 1uza_A* 2hl6_A* 2ix9_A* 1usw_A* 2bjh_A* Length = 261 Back     alignment and structure
>3o0d_A YALI0A20350P, triacylglycerol lipase; alpha/beta-hydrolase, lipids binding, glycosylation, extracellular, hydrolase; HET: NAG; 1.70A {Yarrowia lipolytica} Length = 301 Back     alignment and structure
>3ngm_A Extracellular lipase; secret lipase, hydrolase; 2.80A {Gibberella zeae} Length = 319 Back     alignment and structure
>3g7n_A Lipase; hydrolase fold, hydrolase; HET: 1PE; 1.30A {Penicillium expansum} Length = 258 Back     alignment and structure
>2yij_A Phospholipase A1-iigamma; hydrolase; 2.00A {Arabidopsis thaliana} Length = 419 Back     alignment and structure
>3uue_A LIP1, secretory lipase (family 3); LID-domain, hydrolase; HET: NAG BMA MAN; 1.45A {Malassezia globosa} PDB: 3uuf_A* Length = 279 Back     alignment and structure
>2ory_A Lipase; alpha/beta hydrolase, hydrolase; 2.20A {Photobacterium SP} Length = 346 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query551
3g7n_A258 Lipase; hydrolase fold, hydrolase; HET: 1PE; 1.30A 99.97
3o0d_A301 YALI0A20350P, triacylglycerol lipase; alpha/beta-h 99.96
3ngm_A319 Extracellular lipase; secret lipase, hydrolase; 2. 99.96
1uwc_A261 Feruloyl esterase A; hydrolase, serine esterase, x 99.96
1lgy_A269 Lipase, triacylglycerol lipase; hydrolase (carboxy 99.96
3uue_A279 LIP1, secretory lipase (family 3); LID-domain, hyd 99.95
1tia_A279 Lipase; hydrolase(carboxylic esterase); 2.10A {Pen 99.95
1tib_A269 Lipase; hydrolase(carboxylic esterase); 1.84A {The 99.94
1tgl_A269 Triacyl-glycerol acylhydrolase; carboxylic esteras 99.94
2yij_A419 Phospholipase A1-iigamma; hydrolase; 2.00A {Arabid 99.89
2ory_A346 Lipase; alpha/beta hydrolase, hydrolase; 2.20A {Ph 99.92
2qub_A 615 Extracellular lipase; beta roll, alpha/beta hydrol 97.45
2z8x_A 617 Lipase; beta roll, calcium binding protein, RTX pr 96.64
3fle_A249 SE_1780 protein; structural genomics, APC61035.1, 95.64
3ds8_A254 LIN2722 protein; unkonwn function, structural geno 95.63
3ils_A265 PKS, aflatoxin biosynthesis polyketide synthase; A 95.59
3u0v_A239 Lysophospholipase-like protein 1; alpha, beta hydr 95.57
3lp5_A250 Putative cell surface hydrolase; structural genom 95.54
1pja_A 302 Palmitoyl-protein thioesterase 2 precursor; hydrol 94.95
2wfl_A264 Polyneuridine-aldehyde esterase; alkaloid metaboli 94.94
3rm3_A270 MGLP, thermostable monoacylglycerol lipase; alpha/ 94.92
3c6x_A257 Hydroxynitrilase; atomic resolution, hydroxynitril 94.9
3h04_A275 Uncharacterized protein; protein with unknown func 94.88
1isp_A181 Lipase; alpha/beta hydrolase fold, hydrolase; 1.30 94.87
3sty_A267 Methylketone synthase 1; alpha/beta hydrolase, dec 94.84
2qjw_A176 Uncharacterized protein XCC1541; putative hydrolas 94.82
3dkr_A251 Esterase D; alpha beta hydrolase, mechanism, catal 94.81
3qmv_A280 Thioesterase, REDJ; alpha/beta hydrolase fold, hyd 94.8
3dqz_A258 Alpha-hydroxynitrIle lyase-like protein; A/B-hydrl 94.8
4fle_A202 Esterase; structural genomics, PSI-biology, northe 94.7
2xmz_A269 Hydrolase, alpha/beta hydrolase fold family; menaq 94.67
1xkl_A273 SABP2, salicylic acid-binding protein 2; alpha-bet 94.61
3l80_A292 Putative uncharacterized protein SMU.1393C; alpha/ 94.54
1ufo_A238 Hypothetical protein TT1662; alpha-beta fold, hydr 94.51
1hkh_A279 Gamma lactamase; hydrolase, alpha/beta hydrolase, 94.45
3trd_A208 Alpha/beta hydrolase; cellular processes; 1.50A {C 94.4
4g9e_A279 AHL-lactonase, alpha/beta hydrolase fold protein; 94.34
3llc_A270 Putative hydrolase; structural genomics, joint cen 94.31
2h1i_A226 Carboxylesterase; structural genomics, PSI-2, prot 94.3
3bf7_A255 Esterase YBFF; thioesterase, helical CAP, hydrolas 94.29
3fsg_A272 Alpha/beta superfamily hydrolase; PF00561, MCSG, P 94.21
2psd_A 318 Renilla-luciferin 2-monooxygenase; alpha/beta-hydr 94.18
1g66_A207 Acetyl xylan esterase II; serine hydrolase, acetyl 94.18
1auo_A218 Carboxylesterase; hydrolase; 1.80A {Pseudomonas fl 94.17
3c5v_A 316 PME-1, protein phosphatase methylesterase 1; demet 94.15
2r8b_A251 AGR_C_4453P, uncharacterized protein ATU2452; APC6 94.15
1wom_A271 RSBQ, sigma factor SIGB regulation protein RSBQ; a 94.13
3hc7_A254 Gene 12 protein, GP12; alpha/beta sandwich, cell a 94.1
1qoz_A207 AXE, acetyl xylan esterase; hydrolase, xylan degra 94.08
2fuk_A220 XC6422 protein; A/B hydrolase, structural genomics 94.06
3ibt_A264 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, 94.03
1mtz_A293 Proline iminopeptidase; alpha-beta hydrolase, CAP 94.01
1azw_A 313 Proline iminopeptidase; aminopeptidase, serine pro 94.0
3b5e_A223 MLL8374 protein; NP_108484.1, carboxylesterase, st 93.99
3tjm_A283 Fatty acid synthase; thioesterase domain, fatty ac 93.99
3oos_A278 Alpha/beta hydrolase family protein; APC67239.0, p 93.96
3r0v_A262 Alpha/beta hydrolase fold protein; structural geno 93.91
1wm1_A 317 Proline iminopeptidase; complex with inhibitor, hy 93.91
3pe6_A303 Monoglyceride lipase; alpha-beta hydrolase fold, 2 93.9
3lcr_A319 Tautomycetin biosynthetic PKS; alpha-beta hydrolas 93.89
3e4d_A278 Esterase D; S-formylglutathione hydrolase, hydrola 93.88
3bwx_A285 Alpha/beta hydrolase; YP_496220.1, joint center fo 93.87
3fla_A267 RIFR; alpha-beta hydrolase thioesterase, hydrolase 93.86
2ocg_A254 Valacyclovir hydrolase; alpha beta hydrolase fold; 93.86
1j1i_A296 META cleavage compound hydrolase; carbazole degrad 93.85
3bdi_A207 Uncharacterized protein TA0194; NP_393672.1, predi 93.83
3kda_A301 CFTR inhibitory factor (CIF); alpha/beta hydrolase 93.81
1a8q_A274 Bromoperoxidase A1; haloperoxidase, oxidoreductase 93.8
3i6y_A280 Esterase APC40077; lipase, structural genomics, PS 93.8
3qvm_A282 OLEI00960; structural genomics, PSI-biology, midwe 93.79
3ia2_A271 Arylesterase; alpha-beta hydrolase fold, transitio 93.78
4b6g_A283 Putative esterase; hydrolase, formaldehyde detoxif 93.76
1a8s_A273 Chloroperoxidase F; haloperoxidase, oxidoreductase 93.71
2xua_A266 PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, cate 93.69
3tej_A329 Enterobactin synthase component F; nonribosomal pe 93.69
2qvb_A297 Haloalkane dehalogenase 3; RV2579, alpha-beta hydr 93.69
1u2e_A289 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase 93.68
1iup_A282 META-cleavage product hydrolase; aromatic compound 93.66
3v48_A268 Aminohydrolase, putative aminoacrylate hydrolase R 93.66
2puj_A286 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; 93.65
1brt_A277 Bromoperoxidase A2; haloperoxidase, oxidoreductase 93.64
3d7r_A326 Esterase; alpha/beta fold, hydrolase; 2.01A {Staph 93.62
3ls2_A280 S-formylglutathione hydrolase; psychrophilic organ 93.6
3bdv_A191 Uncharacterized protein DUF1234; DUF1234 family pr 93.6
1r3d_A264 Conserved hypothetical protein VC1974; structural 93.59
3fob_A281 Bromoperoxidase; structural genomics, IDP00046, ba 93.55
1q0r_A298 RDMC, aclacinomycin methylesterase; anthracycline, 93.53
2qru_A274 Uncharacterized protein; alpha/beta-hydrolase, str 93.53
1c4x_A285 BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-di 93.51
2yys_A286 Proline iminopeptidase-related protein; TTHA1809, 93.51
4dnp_A269 DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petu 93.48
3r40_A306 Fluoroacetate dehalogenase; FACD, defluorinase, al 93.47
1a88_A275 Chloroperoxidase L; haloperoxidase, oxidoreductase 93.47
3qit_A286 CURM TE, polyketide synthase; thioesterase, alpha/ 93.44
1ycd_A243 Hypothetical 27.3 kDa protein in AAP1-SMF2 interge 93.42
3om8_A266 Probable hydrolase; structural genomics, PSI-2, pr 93.4
3og9_A209 Protein YAHD A copper inducible hydrolase; alpha/b 93.38
2wue_A291 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolas 93.33
2dst_A131 Hypothetical protein TTHA1544; conserved hypotheti 93.33
1fj2_A232 Protein (acyl protein thioesterase 1); alpha/beta 93.31
2wj6_A276 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxid 93.3
1mj5_A302 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; 93.3
4f0j_A315 Probable hydrolytic enzyme; alpha/beta hydrolase f 93.29
2qs9_A194 Retinoblastoma-binding protein 9; B5T overexpresse 93.29
3cn9_A226 Carboxylesterase; alpha/beta hydrolase fold super- 93.27
1k8q_A 377 Triacylglycerol lipase, gastric; APHA beta hydrola 93.27
2cjp_A 328 Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tu 93.24
3u1t_A 309 DMMA haloalkane dehalogenase; alpha/beta-hydrolase 93.23
1zoi_A276 Esterase; alpha/beta hydrolase fold; 1.60A {Pseudo 93.21
1ehy_A294 Protein (soluble epoxide hydrolase); alpha/beta hy 93.19
1vkh_A273 Putative serine hydrolase; structural genomics, jo 93.09
3nwo_A 330 PIP, proline iminopeptidase; structural genomics, 93.04
3g9x_A299 Haloalkane dehalogenase; alpha/beta hydrolase, hel 93.04
3icv_A316 Lipase B, CALB; circular permutation, cleavage on 92.92
1uxo_A192 YDEN protein; hydrolase, A/B hydrolase, esterase, 92.91
1zi8_A236 Carboxymethylenebutenolidase; alpha and beta prote 92.9
3e0x_A245 Lipase-esterase related protein; APC60309, clostri 92.89
3hss_A293 Putative bromoperoxidase; alpha beta hydrolase, ox 92.81
3hju_A 342 Monoglyceride lipase; alpha/beta hydrolase, hydrol 92.81
3i1i_A 377 Homoserine O-acetyltransferase; structural genomic 92.78
1gpl_A 432 RP2 lipase; serine esterase, hydrolase, lipid degr 92.71
2x5x_A 342 PHB depolymerase PHAZ7; biopolymers, oxyanion HOLE 92.7
3f67_A241 Putative dienelactone hydrolase; alpha-beta-alpha 92.62
3fak_A322 Esterase/lipase, ESTE5; HSL, hydrolase; 1.90A {Unc 92.6
1ex9_A 285 Lactonizing lipase; alpha-beta hydrolase fold, pho 92.6
3pfb_A270 Cinnamoyl esterase; alpha/beta hydrolase fold, hyd 92.58
1tca_A 317 Lipase; hydrolase(carboxylic esterase); HET: NAG; 92.57
4fbl_A281 LIPS lipolytic enzyme; thermostable, structural ge 92.54
2i3d_A249 AGR_C_3351P, hypothetical protein ATU1826; structu 92.49
1w52_X 452 Pancreatic lipase related protein 2; detergent, cl 92.48
2wtm_A251 EST1E; hydrolase; 1.60A {Clostridium proteoclastic 92.47
1ei9_A 279 Palmitoyl protein thioesterase 1; alpha/beta hydro 92.44
2qmq_A286 Protein NDRG2, protein NDR2; alpha/beta-hydrolases 92.41
2pbl_A262 Putative esterase/lipase/thioesterase; alpha/beta- 92.35
3k6k_A322 Esterase/lipase; alpha/beta hydrolase fold; 2.20A 92.33
1jmk_C230 SRFTE, surfactin synthetase; thioesterase, non-rib 92.32
1jjf_A268 Xylanase Z, endo-1,4-beta-xylanase Z, 1,4-beta-D-x 92.31
3afi_E 316 Haloalkane dehalogenase; A/B-hydrolase, hydrolase; 92.3
2xt0_A297 Haloalkane dehalogenase; hydrolase, alpha-beta hyd 92.27
1tqh_A247 Carboxylesterase precursor; tetrahedral intermedia 92.19
1kez_A300 Erythronolide synthase; polyketide synthase, modul 92.17
1bu8_A 452 Protein (pancreatic lipase related protein 2); hyd 92.08
4fhz_A285 Phospholipase/carboxylesterase; alpha/beta hydrola 92.01
3fcx_A282 FGH, esterase D, S-formylglutathione hydrolase; re 92.01
2rau_A 354 Putative esterase; NP_343859.1, putative lipase, s 91.9
2pl5_A 366 Homoserine O-acetyltransferase; alpha/beta hydrola 91.88
2b61_A 377 Homoserine O-acetyltransferase; acyl-enzyme, aspar 91.88
2k2q_B242 Surfactin synthetase thioesterase subunit; A/B-hyd 91.85
2uz0_A263 Esterase, tributyrin esterase; alpha/beta hydrolas 91.8
1l7a_A318 Cephalosporin C deacetylase; structural genomics, 91.77
2cb9_A244 Fengycin synthetase; thioesterase, non-ribosomal p 91.77
2r11_A306 Carboxylesterase NP; 2632844, putative hydrolase, 91.63
1ys1_X 320 Lipase; CIS peptide Leu 234, Ca2+ ION, inhibitor h 91.48
3aja_A302 Putative uncharacterized protein; alpha-beta hydro 91.42
2c7b_A311 Carboxylesterase, ESTE1; carboxyesterase, thermoph 91.4
3d0k_A304 Putative poly(3-hydroxybutyrate) depolymerase LPQ; 91.4
3qpa_A197 Cutinase; alpha-beta hydrolase fold, esterase, hyd 91.28
2o2g_A223 Dienelactone hydrolase; YP_324580.1, structural ge 91.21
3p2m_A330 Possible hydrolase; alpha/beta hydrolase superfami 91.18
1imj_A210 CIB, CCG1-interacting factor B; alpha/beta hydrola 91.16
4e15_A303 Kynurenine formamidase; alpha/beta hydrolase fold, 91.14
2hfk_A319 Pikromycin, type I polyketide synthase pikaiv; alp 91.08
3kxp_A314 Alpha-(N-acetylaminomethylene)succinic acid hydrol 91.07
1m33_A258 BIOH protein; alpha-betta-alpha sandwich, structur 90.94
2q0x_A 335 Protein DUF1749, uncharacterized protein; alpha/be 90.93
2y6u_A 398 Peroxisomal membrane protein LPX1; hydrolase, puta 90.9
3qyj_A291 ALR0039 protein; alpha/beta fold, hydrolase; 1.78A 90.9
3fcy_A346 Xylan esterase 1; alpha/beta hydrolase, carbohydra 90.7
1jkm_A361 Brefeldin A esterase; serine hydrolase, degradatio 90.65
1lzl_A323 Heroin esterase; alpha/beta hydrolase; 1.30A {Rhod 90.65
1vlq_A337 Acetyl xylan esterase; TM0077, structural genomics 90.54
3ain_A323 303AA long hypothetical esterase; carboxylesterase 90.51
3bjr_A283 Putative carboxylesterase; structural genomics, jo 90.44
2qm0_A275 BES; alpha-beta structure, structural genomics, PS 90.39
2px6_A 316 Thioesterase domain; thioesaterse domain, orlistat 90.24
1b6g_A310 Haloalkane dehalogenase; hydrolase, alpha/beta-hyd 90.17
4h0c_A210 Phospholipase/carboxylesterase; PSI-biology, midwe 90.17
1dqz_A280 85C, protein (antigen 85-C); fibronectin, structur 90.11
1jji_A311 Carboxylesterase; alpha-beta hydrolase fold, hydro 90.08
3h2g_A 397 Esterase; xanthomonas oryzae PV. oryzae, cell WALL 90.07
3ksr_A290 Putative serine hydrolase; catalytic triad, struct 90.03
3bxp_A277 Putative lipase/esterase; putative carboxylesteras 90.01
2vat_A 444 Acetyl-COA--deacetylcephalosporin C acetyltransfer 89.89
2zsh_A351 Probable gibberellin receptor GID1L1; plant hormon 89.86
3ga7_A326 Acetyl esterase; phosphoserine, IDP00896, hydrolas 89.81
3i28_A 555 Epoxide hydrolase 2; aromatic hydrocarbons catabol 89.62
3doh_A380 Esterase; alpha-beta hydrolase, beta sheet; 2.60A 89.58
2e3j_A 356 Epoxide hydrolase EPHB; epoxide hydrolase B, struc 89.58
3b12_A 304 Fluoroacetate dehalogenase; dehalogease, hydrolase 88.97
2hih_A 431 Lipase 46 kDa form; A1 phospholipase, phospholipid 89.37
1sfr_A304 Antigen 85-A; alpha/beta hydrolase, structural gen 89.27
1tht_A305 Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1. 89.24
1r88_A280 MPT51/MPB51 antigen; ALFA/beta hydrolase fold, FBP 89.21
3hxk_A276 Sugar hydrolase; alpha-beta protein., structural g 89.2
3vdx_A 456 Designed 16NM tetrahedral protein CAGE containing 89.2
2wir_A313 Pesta, alpha/beta hydrolase fold-3 domain protein; 89.16
3n2z_B 446 Lysosomal Pro-X carboxypeptidase; alpha/beta hydro 89.12
1hpl_A 449 Lipase; hydrolase(carboxylic esterase); 2.30A {Equ 89.09
2o7r_A338 CXE carboxylesterase; alpha/beta hydrolase; 1.40A 89.07
3dcn_A201 Cutinase, cutin hydrolase; catalytic triad, secret 88.83
3o4h_A582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 88.63
1rp1_A 450 Pancreatic lipase related protein 1; hydrolase, li 88.63
2hm7_A310 Carboxylesterase; alpha/beta hydrolase fold, hydro 88.5
3qh4_A317 Esterase LIPW; structural genomics, ssgcid, seattl 88.09
4ezi_A 377 Uncharacterized protein; alpha-beta hydrolases fol 87.99
2dsn_A 387 Thermostable lipase; T1 lipase, hydrolase; 1.50A { 87.92
3g02_A 408 Epoxide hydrolase; alpha/beta hydrolase fold, enan 87.83
2czq_A205 Cutinase-like protein; alpha/beta hydrolase fold, 87.67
3ebl_A365 Gibberellin receptor GID1; alpha/beta hydrolase, l 87.47
3qpd_A187 Cutinase 1; alpha-beta hydrolase fold, esterase, h 87.26
2zyr_A 484 Lipase, putative; fatty acid, hydrolase; HET: 1PE; 86.58
2hdw_A367 Hypothetical protein PA2218; alpha/beta hydrolase 86.54
4i19_A 388 Epoxide hydrolase; structural genomics, PSI-biolog 86.51
1jfr_A262 Lipase; serine hydrolase; 1.90A {Streptomyces exfo 86.34
2gzs_A278 IROE protein; enterobactin, salmochelin, DFP, hydr 85.96
2fx5_A258 Lipase; alpha-beta hydrolase; HET: TLA; 1.80A {Pse 85.75
3k2i_A422 Acyl-coenzyme A thioesterase 4; alpha/beta hydrola 84.94
1gkl_A297 Endo-1,4-beta-xylanase Y; hydrolase, esterase fami 84.93
3vis_A306 Esterase; alpha/beta-hydrolase fold, polyethylene 84.88
3mve_A415 FRSA, UPF0255 protein VV1_0328; FRSA,fermentation/ 84.46
3hlk_A 446 Acyl-coenzyme A thioesterase 2, mitochondrial; alp 84.22
1qlw_A328 Esterase; anisotropic refinement, atomic resolutio 82.95
3guu_A 462 Lipase A; protein structure, hydrolase; HET: 1PE; 82.93
3azo_A662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 82.2
3c8d_A403 Enterochelin esterase; alpha-beta-alpha sandwich, 82.17
2jbw_A386 Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine 82.12
3g8y_A391 SUSD/RAGB-associated esterase-like protein; struct 80.03
>3g7n_A Lipase; hydrolase fold, hydrolase; HET: 1PE; 1.30A {Penicillium expansum} Back     alignment and structure
Probab=99.97  E-value=2.1e-30  Score=257.39  Aligned_cols=145  Identities=20%  Similarity=0.253  Sum_probs=123.2

Q ss_pred             ceEEEEEeCCCCeEEEEEccCCCHHHHHHhcCCcceecC------CCCeeEcHHHHHHHHHHHHHHHHHHHHHHHhcCCC
Q 008846          373 CEWFICDDDQSATRFFVIQGSESLASWQANLLFEPVQFE------GLEVVVHRGIYEAAKGIYEQMLPEVHAHLKACGKH  446 (551)
Q Consensus       373 c~~fIa~D~~~~tIVIAFRGT~Sl~DWltDL~f~~v~fe------g~g~kVHrGFy~aa~~ly~qll~~L~~~Lks~gp~  446 (551)
                      +.+||+.|+.++.|||+||||.++.||++|+.+.++++.      +.+++||+||+.++..+++++++.|++++++ +|+
T Consensus        45 ~~gyva~d~~~~~IvVafRGT~s~~dw~~Dl~~~~~~~~~~g~~~~~~~~VH~GF~~~~~~~~~~~~~~l~~~~~~-~p~  123 (258)
T 3g7n_A           45 TNGFVGYSTEKKTIAVIMRGSTTITDFVNDIDIALITPELSGVTFPSDVKIMRGVHRPWSAVHDTIITEVKALIAK-YPD  123 (258)
T ss_dssp             EEEEEEEETTTTEEEEEECCCSCCCC----CCCCEECCCCTTCCCCTTCCEEHHHHHHHHHHHHHHHHHHHHHHHH-STT
T ss_pred             ceEEEEEECCCCEEEEEECCCCCHHHHHHhcccceeccccCCCcCCCCcEEehhHHHHHHHHHHHHHHHHHHHHHh-CCC
Confidence            457999999999999999999999999999999877642      2589999999999999999999999987776 488


Q ss_pred             ceEEEeecChhHHHHHHHHHHHHHcCCCCCCCcccEEEeCCCcCCCCChHHHHHcCCCCCcEEEEEECCCcccccCC
Q 008846          447 ATFRFTGHSLGGSLSVLINLMLLIRGEVPASSLLPVITFGAPSIMCGGDHLLRKLGLPRSHVQSITLHRDIVPRAFS  523 (551)
Q Consensus       447 ~kIiVTGHSLGGALAsLaAL~L~~~~~~p~~~~v~VyTFGSPrVmcGnd~fa~~l~~~~~~I~RVVn~~DIVPrLP~  523 (551)
                      ++|+|||||||||||+|+++++...  +|. ..+.+||||+|||  ||..|++.++.....++||+|..|+||+||+
T Consensus       124 ~~i~vtGHSLGGalA~l~a~~l~~~--~~~-~~v~~~tFg~Prv--Gn~~fa~~~~~~~~~~~Rvvn~~D~VP~lPp  195 (258)
T 3g7n_A          124 YTLEAVGHSLGGALTSIAHVALAQN--FPD-KSLVSNALNAFPI--GNQAWADFGTAQAGTFNRGNNVLDGVPNMYS  195 (258)
T ss_dssp             CEEEEEEETHHHHHHHHHHHHHHHH--CTT-SCEEEEEESCCCC--BCHHHHHHHHHSSSEEEEEEETTCBGGGTTC
T ss_pred             CeEEEeccCHHHHHHHHHHHHHHHh--CCC-CceeEEEecCCCC--CCHHHHHHHHhcCCCeEEEEeCCCccCcCCC
Confidence            9999999999999999999999754  333 3478999999999  9999988875334678999999999999987



>3o0d_A YALI0A20350P, triacylglycerol lipase; alpha/beta-hydrolase, lipids binding, glycosylation, extracellular, hydrolase; HET: NAG; 1.70A {Yarrowia lipolytica} SCOP: c.69.1.0 Back     alignment and structure
>3ngm_A Extracellular lipase; secret lipase, hydrolase; 2.80A {Gibberella zeae} Back     alignment and structure
>1uwc_A Feruloyl esterase A; hydrolase, serine esterase, xylan degradation; HET: NAG FER; 1.08A {Aspergillus niger} SCOP: c.69.1.17 PDB: 1uza_A* 2hl6_A* 2ix9_A* 1usw_A* 2bjh_A* Back     alignment and structure
>1lgy_A Lipase, triacylglycerol lipase; hydrolase (carboxylic ester); 2.20A {Rhizopus niveus} SCOP: c.69.1.17 PDB: 1tic_A Back     alignment and structure
>3uue_A LIP1, secretory lipase (family 3); LID-domain, hydrolase; HET: NAG BMA MAN; 1.45A {Malassezia globosa} PDB: 3uuf_A* Back     alignment and structure
>1tia_A Lipase; hydrolase(carboxylic esterase); 2.10A {Penicillium camemberti} SCOP: c.69.1.17 Back     alignment and structure
>1tib_A Lipase; hydrolase(carboxylic esterase); 1.84A {Thermomyces lanuginosus} SCOP: c.69.1.17 PDB: 1dt3_A 1dt5_A 1du4_A 1ein_A* 1dte_A 4dyh_A* 4ea6_A 1gt6_A* Back     alignment and structure
>1tgl_A Triacyl-glycerol acylhydrolase; carboxylic esterase; 1.90A {Rhizomucor miehei} SCOP: c.69.1.17 PDB: 4tgl_A 5tgl_A* 3tgl_A Back     alignment and structure
>2yij_A Phospholipase A1-iigamma; hydrolase; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>2ory_A Lipase; alpha/beta hydrolase, hydrolase; 2.20A {Photobacterium SP} Back     alignment and structure
>2qub_A Extracellular lipase; beta roll, alpha/beta hydrolase, helical hairpin, hydrolase; 1.80A {Serratia marcescens} PDB: 2qua_A Back     alignment and structure
>2z8x_A Lipase; beta roll, calcium binding protein, RTX protein, hydrolase; 1.48A {Pseudomonas SP} PDB: 2zvd_A 3a6z_A 3a70_A* 2z8z_A 2zj6_A 2zj7_A Back     alignment and structure
>3fle_A SE_1780 protein; structural genomics, APC61035.1, PSI-2, protein structure in midwest center for structural genomics, MCSG; 2.01A {Staphylococcus epidermidis} Back     alignment and structure
>3ds8_A LIN2722 protein; unkonwn function, structural genomics, PSI, MCSG, P structure initiative; 1.80A {Listeria innocua} Back     alignment and structure
>3ils_A PKS, aflatoxin biosynthesis polyketide synthase; A/B hydrolase, thioesterase, norsolorinic acid, P polyketide, acyltransferase; 1.70A {Aspergillus parasiticus} Back     alignment and structure
>3u0v_A Lysophospholipase-like protein 1; alpha, beta hydrolase fold, hydrolase; 1.72A {Homo sapiens} Back     alignment and structure
>3lp5_A Putative cell surface hydrolase; structural genom PSI2, MCSG, protein structure initiative, midwest center FO structural genomics; 2.00A {Lactobacillus plantarum} Back     alignment and structure
>1pja_A Palmitoyl-protein thioesterase 2 precursor; hydrolase, glycoprotein, lysosome; HET: NAG; 2.70A {Homo sapiens} SCOP: c.69.1.13 Back     alignment and structure
>2wfl_A Polyneuridine-aldehyde esterase; alkaloid metabolism, monoterpenoid indole alkaloids, PNAE, hydrolase, serine esterase; HET: CME; 2.10A {Rauvolfia serpentina} PDB: 2wfm_A 3gzj_A* Back     alignment and structure
>3rm3_A MGLP, thermostable monoacylglycerol lipase; alpha/beta hydrolase fold, hydrolase; 1.20A {Bacillus SP} PDB: 3rli_A Back     alignment and structure
>3c6x_A Hydroxynitrilase; atomic resolution, hydroxynitril lyase, catalysis, protonation state, AB initio calculations, substrate bindin; 1.05A {Hevea brasiliensis} SCOP: c.69.1.20 PDB: 1sc9_A 1yas_A* 2g4l_A* 2yas_A 1qj4_A 3c6y_A 3c6z_A 3c70_A 3yas_A 4yas_A 5yas_A* 6yas_A 7yas_A* 1yb6_A* 1yb7_A 1sck_A 1sci_A 1scq_A 1dwo_A 1dwp_A ... Back     alignment and structure
>3h04_A Uncharacterized protein; protein with unknown function, structural genomics, MCSG, PS protein structure initiative; 1.90A {Staphylococcus aureus subsp} Back     alignment and structure
>1isp_A Lipase; alpha/beta hydrolase fold, hydrolase; 1.30A {Bacillus subtilis} SCOP: c.69.1.18 PDB: 1i6w_A 1r4z_A* 1r50_A* 2qxu_A 2qxt_A 1t4m_A 1t2n_A 3d2a_A 3qzu_A 3d2b_A 3d2c_A 3qmm_A Back     alignment and structure
>3sty_A Methylketone synthase 1; alpha/beta hydrolase, decarboxylase, hydrolase; HET: DKA; 1.70A {Lycopersicon hirsutum F} PDB: 3stu_A* 3stt_A* 3stv_A* 3stw_A* 3stx_A* Back     alignment and structure
>2qjw_A Uncharacterized protein XCC1541; putative hydrolase of the alpha/beta superfamily, structural genomics; HET: MSE TLA P6G; 1.35A {Xanthomonas campestris PV} Back     alignment and structure
>3dkr_A Esterase D; alpha beta hydrolase, mechanism, catalytic triad, rotation; 1.60A {Lactobacillus rhamnosus} SCOP: c.69.1.0 PDB: 3dlt_A 3dyi_A 3dyv_A 3e1g_A Back     alignment and structure
>3qmv_A Thioesterase, REDJ; alpha/beta hydrolase fold, hydrolase; 2.12A {Streptomyces coelicolor} PDB: 3qmw_A* Back     alignment and structure
>3dqz_A Alpha-hydroxynitrIle lyase-like protein; A/B-hydrloase fold, cyanogenesis; 2.50A {Arabidopsis thaliana} SCOP: c.69.1.0 Back     alignment and structure
>4fle_A Esterase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, alpha-beta protein, rossmann fold, HY; 2.10A {Yersinia enterocolitica subsp} Back     alignment and structure
>2xmz_A Hydrolase, alpha/beta hydrolase fold family; menaquinone biosynthesis, lyase; 1.94A {Staphylococcus aureus} Back     alignment and structure
>1xkl_A SABP2, salicylic acid-binding protein 2; alpha-beta protein, structural genomics, protein structure initiative, PSI; HET: STH; 2.00A {Nicotiana tabacum} SCOP: c.69.1.20 PDB: 1y7i_A* 1y7h_A* Back     alignment and structure
>3l80_A Putative uncharacterized protein SMU.1393C; alpha/beta hydrolase fold, carboxylesterase, Ser- hydrolase; 2.00A {Streptococcus mutans} Back     alignment and structure
>1ufo_A Hypothetical protein TT1662; alpha-beta fold, hydrolase, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.60A {Thermus thermophilus} SCOP: c.69.1.27 Back     alignment and structure
>1hkh_A Gamma lactamase; hydrolase, alpha/beta hydrolase, CO-factor free haloperoxidase,; 1.73A {Microbacterium} SCOP: c.69.1.12 PDB: 1hl7_A* Back     alignment and structure
>3trd_A Alpha/beta hydrolase; cellular processes; 1.50A {Coxiella burnetii} Back     alignment and structure
>4g9e_A AHL-lactonase, alpha/beta hydrolase fold protein; AHL-binding; HET: C4L; 1.09A {Ochrobactrum} PDB: 4g5x_A* 4g8b_A* 4g8d_A 4g8c_A* 4g9g_A Back     alignment and structure
>3llc_A Putative hydrolase; structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE PG4; 1.80A {Agrobacterium vitis} Back     alignment and structure
>2h1i_A Carboxylesterase; structural genomics, PSI-2, protein struct initiative, midwest center for structural genomics, MCSG, H; HET: MSE; 2.80A {Bacillus cereus} SCOP: c.69.1.14 Back     alignment and structure
>3bf7_A Esterase YBFF; thioesterase, helical CAP, hydrolase; 1.10A {Escherichia coli} PDB: 3bf8_A Back     alignment and structure
>3fsg_A Alpha/beta superfamily hydrolase; PF00561, MCSG, PSI, PSI-2, structural genomics, protein structure initiative, midwest for structural genomics; 2.00A {Oenococcus oeni} Back     alignment and structure
>2psd_A Renilla-luciferin 2-monooxygenase; alpha/beta-hydrolase, luciferase, oxidoreductase; 1.40A {Renilla reniformis} PDB: 2pse_A 2psj_A* 2psh_A 2psf_A Back     alignment and structure
>1g66_A Acetyl xylan esterase II; serine hydrolase, acetyl xylopyranose, hydrolase; 0.90A {Penicillium purpurogenum} SCOP: c.69.1.30 PDB: 1bs9_A 2axe_A* Back     alignment and structure
>1auo_A Carboxylesterase; hydrolase; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.14 PDB: 1aur_A* Back     alignment and structure
>3c5v_A PME-1, protein phosphatase methylesterase 1; demethylase, PP2A, alternative splicing, hydrolase, phosphoprotein, serine esterase; 2.00A {Homo sapiens} PDB: 3c5w_P Back     alignment and structure
>2r8b_A AGR_C_4453P, uncharacterized protein ATU2452; APC6088, agrobacterium tumefaciens STR. C58 structural genomics, PSI-2; 2.56A {Agrobacterium tumefaciens str} SCOP: c.69.1.14 Back     alignment and structure
>1wom_A RSBQ, sigma factor SIGB regulation protein RSBQ; alpha/beta hydrolase, signaling protein; 2.50A {Bacillus subtilis} PDB: 1wpr_A* Back     alignment and structure
>3hc7_A Gene 12 protein, GP12; alpha/beta sandwich, cell adhesion; 2.00A {Mycobacterium phage D29} Back     alignment and structure
>1qoz_A AXE, acetyl xylan esterase; hydrolase, xylan degradation; HET: NAG; 1.90A {Trichoderma reesei} SCOP: c.69.1.30 Back     alignment and structure
>2fuk_A XC6422 protein; A/B hydrolase, structural genomics, X-RAY diffraction; 1.60A {Xanthomonas campestris} SCOP: c.69.1.36 Back     alignment and structure
>3ibt_A 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, oxidoreductase; 2.60A {Pseudomonas putida} Back     alignment and structure
>1mtz_A Proline iminopeptidase; alpha-beta hydrolase, CAP domain, caged active site, prolyl peptidase; 1.80A {Thermoplasma acidophilum} SCOP: c.69.1.7 PDB: 1mt3_A 1mu0_A* 1xrr_A 1xrq_A 1xro_A 1xrn_A 1xrm_A 1xrp_A 1xrl_A* 1xqw_A* 1xqx_A* 1xqy_A 1xqv_A Back     alignment and structure
>1azw_A Proline iminopeptidase; aminopeptidase, serine protease, xanthomonas campestris; 2.70A {Xanthomonas citri} SCOP: c.69.1.7 Back     alignment and structure
>3b5e_A MLL8374 protein; NP_108484.1, carboxylesterase, structural genomics, joint CE structural genomics, JCSG, protein structure initiative; 1.75A {Mesorhizobium loti} SCOP: c.69.1.14 Back     alignment and structure
>3tjm_A Fatty acid synthase; thioesterase domain, fatty acid synthesis, hydrolase-hydrola inhibitor complex; HET: 7FA; 1.48A {Homo sapiens} PDB: 1xkt_A Back     alignment and structure
>3oos_A Alpha/beta hydrolase family protein; APC67239.0, protein structure initiative, PSI-2, structural midwest center for structural genomics, MCSG; HET: MSE PG4; 1.65A {Bacillus anthracis} Back     alignment and structure
>3r0v_A Alpha/beta hydrolase fold protein; structural genomics, PSI-biology, protein structure initiati alpha/beta hydrolase; HET: MSE; 1.38A {Sphaerobacter thermophilus} Back     alignment and structure
>1wm1_A Proline iminopeptidase; complex with inhibitor, hydrolase; HET: PTB; 2.10A {Serratia marcescens} SCOP: c.69.1.7 PDB: 1qtr_A* 1x2b_A* 1x2e_A* Back     alignment and structure
>3pe6_A Monoglyceride lipase; alpha-beta hydrolase fold, 2-arachidonyl-glycerol, M associated, hydrolase, hydrolase-hydrolase inhibitor comple; HET: ZYH; 1.35A {Homo sapiens} PDB: 3jw8_A 3jwe_A* Back     alignment and structure
>3lcr_A Tautomycetin biosynthetic PKS; alpha-beta hydrolase, thioesterase, polyketide synthase, phosphopantetheine, transferase, hydrolase; 2.00A {Streptomyces SP} Back     alignment and structure
>3e4d_A Esterase D; S-formylglutathione hydrolase, hydrolase fold family, catalytic triad, kinetics, proposed reaction mechanism; HET: MSE; 2.01A {Agrobacterium tumefaciens} SCOP: c.69.1.0 Back     alignment and structure
>3bwx_A Alpha/beta hydrolase; YP_496220.1, joint center for structural genomics, protein structure initiative, PSI-2; HET: MSE; 1.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>3fla_A RIFR; alpha-beta hydrolase thioesterase, hydrolase; HET: MSE; 1.80A {Amycolatopsis mediterranei} PDB: 3flb_A* Back     alignment and structure
>2ocg_A Valacyclovir hydrolase; alpha beta hydrolase fold; 1.75A {Homo sapiens} PDB: 2oci_A* 2ock_A 2ocl_A Back     alignment and structure
>1j1i_A META cleavage compound hydrolase; carbazole degradation, META cleavage product hydrolase, histidine tagged protein, alpha/beta-hydrolase; 1.86A {Janthinobacterium} SCOP: c.69.1.10 Back     alignment and structure
>3bdi_A Uncharacterized protein TA0194; NP_393672.1, predicted CIB-like hydrolase, structural genomi center for structural genomics; HET: MSE; 1.45A {Thermoplasma acidophilum dsm 1728} Back     alignment and structure
>3kda_A CFTR inhibitory factor (CIF); alpha/beta hydrolase, hydrolase; 1.50A {Pseudomonas aeruginosa ucbpp-pa14} PDB: 3kd2_A 3pi6_A Back     alignment and structure
>1a8q_A Bromoperoxidase A1; haloperoxidase, oxidoreductase; 1.75A {Streptomyces aureofaciens} SCOP: c.69.1.12 Back     alignment and structure
>3i6y_A Esterase APC40077; lipase, structural genomics, PSI-2, PR structure initiative, midwest center for structural genomic hydrolase; HET: MSE; 1.75A {Oleispira antarctica} PDB: 3s8y_A Back     alignment and structure
>3qvm_A OLEI00960; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta hydrolase fold, hydrolase; 2.00A {Oleispira antarctica} Back     alignment and structure
>3ia2_A Arylesterase; alpha-beta hydrolase fold, transition state analog, hydrolas oxidoreductase, peroxidase; 1.65A {Pseudomonas fluorescens} SCOP: c.69.1.12 PDB: 1va4_A 3t52_A* 3t4u_A* 3hi4_A 3hea_A Back     alignment and structure
>4b6g_A Putative esterase; hydrolase, formaldehyde detoxification, alpha/beta serine HY; 1.40A {Neisseria meningitidis MC58} Back     alignment and structure
>1a8s_A Chloroperoxidase F; haloperoxidase, oxidoreductase, propionate complex; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.12 Back     alignment and structure
>2xua_A PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, catechol metabolism; 1.90A {Burkholderia xenovorans} Back     alignment and structure
>3tej_A Enterobactin synthase component F; nonribosomal peptide, thioesterase, carrier domain, ATP- BIN enterobactin biosynthesis, ION transport, iron; HET: UF0; 1.90A {Escherichia coli} PDB: 2roq_A Back     alignment and structure
>2qvb_A Haloalkane dehalogenase 3; RV2579, alpha-beta hydrolase protei structural genomics consortium, TBSGC, hydrolase; 1.19A {Mycobacterium tuberculosis} PDB: 2o2i_A 2o2h_A Back     alignment and structure
>1u2e_A 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase; alpha/beta hydrolase fold; 2.10A {Escherichia coli} Back     alignment and structure
>1iup_A META-cleavage product hydrolase; aromatic compounds, cumene, isopropylbenzene, META-cleavage compound hydrolase; 1.60A {Pseudomonas fluorescens} SCOP: c.69.1.10 PDB: 1iun_A 1iuo_A 1uk6_A 1uk7_A 1uk8_A 1uk9_A 1uka_A 1ukb_A 2d0d_A Back     alignment and structure
>3v48_A Aminohydrolase, putative aminoacrylate hydrolase RUTD; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.10A {Escherichia coli SE11} Back     alignment and structure
>2puj_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; C-C bond hydrolase, hydrolase; HET: HPZ; 1.57A {Burkholderia xenovorans} PDB: 2pu7_A* 3v1m_A* 3v1l_A* 2puh_A* 3v1n_A* 3v1k_A* 2og1_A 2pu5_A 2rhw_A* 2rht_A* 2ri6_A Back     alignment and structure
>1brt_A Bromoperoxidase A2; haloperoxidase, oxidoreductase, alpha/beta hydrolase fold, mutant M99T; 1.50A {Streptomyces aureofaciens} SCOP: c.69.1.12 PDB: 1bro_A 1a8u_A 1a7u_A Back     alignment and structure
>3d7r_A Esterase; alpha/beta fold, hydrolase; 2.01A {Staphylococcus aureus subsp} Back     alignment and structure
>3ls2_A S-formylglutathione hydrolase; psychrophilic organism; 2.20A {Pseudoalteromonas haloplanktis} SCOP: c.69.1.0 Back     alignment and structure
>3bdv_A Uncharacterized protein DUF1234; DUF1234 family protein, alpha/beta-hydrolases fold, structur genomics; HET: MSE; 1.66A {Pectobacterium atrosepticum SCRI1043} Back     alignment and structure
>1r3d_A Conserved hypothetical protein VC1974; structural genomics, hydrolase, NYSGXRC, NEW YORK SGX research center for structural genomics, PSI; 1.90A {Vibrio cholerae} SCOP: c.69.1.35 Back     alignment and structure
>3fob_A Bromoperoxidase; structural genomics, IDP00046, bacillus ANT peroxidase, oxidoreductase; 1.74A {Bacillus anthracis str} SCOP: c.69.1.0 Back     alignment and structure
>1q0r_A RDMC, aclacinomycin methylesterase; anthracycline, hydrolase, polyketide, tailoring enzyme, structural proteomics in europe, spine; HET: AKT 1PE; 1.45A {Streptomyces purpurascens} SCOP: c.69.1.28 PDB: 1q0z_A* Back     alignment and structure
>2qru_A Uncharacterized protein; alpha/beta-hydrolase, structural GENO PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 1.65A {Enterococcus faecalis} Back     alignment and structure
>1c4x_A BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoat hydrolase); PCB degradation; 2.40A {Rhodococcus SP} SCOP: c.69.1.10 Back     alignment and structure
>2yys_A Proline iminopeptidase-related protein; TTHA1809, structural genomics, unknown function; 2.20A {Thermus thermophilus} Back     alignment and structure
>4dnp_A DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petunia hybrida} PDB: 4dnq_A Back     alignment and structure
>3r40_A Fluoroacetate dehalogenase; FACD, defluorinase, alpha/beta hydrolase, hydrolase; 1.05A {Rhodopseudomonas palustris} PDB: 3r3w_A 3r3x_A 3r3v_A 3r3u_A 3r3z_A 3r41_A 3r3y_A Back     alignment and structure
>1a88_A Chloroperoxidase L; haloperoxidase, oxidoreductase; 1.90A {Streptomyces lividans} SCOP: c.69.1.12 Back     alignment and structure
>3qit_A CURM TE, polyketide synthase; thioesterase, alpha/beta hydrolase, decarboxylase, sulfate elimination, terminal alkene production; 1.68A {Lyngbya majuscula 19L} Back     alignment and structure
>1ycd_A Hypothetical 27.3 kDa protein in AAP1-SMF2 intergenic region; esterase, lipase, serine hydrolase, structural genomics; HET: LI5; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3om8_A Probable hydrolase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MES; 2.25A {Pseudomonas aeruginosa} SCOP: c.69.1.0 Back     alignment and structure
>3og9_A Protein YAHD A copper inducible hydrolase; alpha/beta hydrolase, copper homeostasis, malic acid; 1.88A {Lactococcus lactis subsp} SCOP: c.69.1.0 Back     alignment and structure
>2wue_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolase BPHD; HET: KEK; 1.80A {Mycobacterium tuberculosis} PDB: 2wud_A* 2wuf_A* 2wug_A* 2vf2_A Back     alignment and structure
>2dst_A Hypothetical protein TTHA1544; conserved hypothetical protein, structural genomics, NPPSFA; 2.00A {Thermus thermophilus} SCOP: c.69.1.39 Back     alignment and structure
>1fj2_A Protein (acyl protein thioesterase 1); alpha/beta hydrolase, serine hydrolase, SAD, anomalous diffr hydrolase; 1.50A {Homo sapiens} SCOP: c.69.1.14 Back     alignment and structure
>2wj6_A 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxidoreductase, alpha/beta hydrolase; HET: ZZ8 SRT; 2.00A {Arthrobacter nitroguajacolicus} PDB: 2wj4_A* 2wj3_A* 2wm2_A* Back     alignment and structure
>1mj5_A 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; LINB, haloalkane dehalogenase, 1, 3, 4, 4-cyclohexadiene dehalogenase; 0.95A {Sphingomonas paucimobilis} SCOP: c.69.1.8 PDB: 1cv2_A 1d07_A 2bfn_A 1g42_A* 1g4h_A* 1g5f_A* 1iz7_A 1iz8_A* 1k5p_A 1k63_A 1k6e_A Back     alignment and structure
>4f0j_A Probable hydrolytic enzyme; alpha/beta hydrolase fold, structural genomics, joint center structural genomics, JCSG; HET: MSE; 1.50A {Pseudomonas aeruginosa} Back     alignment and structure
>2qs9_A Retinoblastoma-binding protein 9; B5T overexpressed gene protein, BOG, RBBP9, RBBP10, HR2978, NESG, structural genomics, PSI-2; 1.72A {Homo sapiens} Back     alignment and structure
>3cn9_A Carboxylesterase; alpha/beta hydrolase fold super-family, hydrolase; HET: 2PE; 2.09A {Pseudomonas aeruginosa} PDB: 3cn7_A* Back     alignment and structure
>1k8q_A Triacylglycerol lipase, gastric; APHA beta hydrolase fold, hydrolase; HET: NAG BOG C11; 2.70A {Canis lupus familiaris} SCOP: c.69.1.6 PDB: 1hlg_A* Back     alignment and structure
>2cjp_A Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tuberosum} PDB: 3cxu_A* Back     alignment and structure
>3u1t_A DMMA haloalkane dehalogenase; alpha/beta-hydrolase, hydrolase; 2.20A {Unidentified} Back     alignment and structure
>1zoi_A Esterase; alpha/beta hydrolase fold; 1.60A {Pseudomonas putida} PDB: 4dgq_A Back     alignment and structure
>1ehy_A Protein (soluble epoxide hydrolase); alpha/beta hydrolase fold, epoxide degradation, epichlorohydrin; 2.10A {Agrobacterium tumefaciens} SCOP: c.69.1.11 Back     alignment and structure
>1vkh_A Putative serine hydrolase; structural genomics, joint center structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.85A {Saccharomyces cerevisiae} SCOP: c.69.1.32 Back     alignment and structure
>3nwo_A PIP, proline iminopeptidase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, mycobac smegmatis; 1.90A {Mycobacterium smegmatis} Back     alignment and structure
>3g9x_A Haloalkane dehalogenase; alpha/beta hydrolase, helical CAP domain, catalytic triad (A His272, Glu130), mutant, I135F, haloalkanes; 0.95A {Rhodococcus SP} SCOP: c.69.1.8 PDB: 3fwh_A 3fbw_A 3rlt_A 3rk4_A 1bn6_A 1bn7_A 4fwb_A 1cqw_A 3sk0_A 2v9z_A Back     alignment and structure
>3icv_A Lipase B, CALB; circular permutation, cleavage on PAIR of basic residues, glycoprotein, hydrolase, lipid degradation, zymogen, disulf; HET: NAG BTB; 1.49A {Candida antarctica} PDB: 3icw_A* Back     alignment and structure
>1uxo_A YDEN protein; hydrolase, A/B hydrolase, esterase, PSI, protein structure initiative, MCSG, midwest center for structural genomics; 1.8A {Bacillus subtilis} SCOP: c.69.1.31 Back     alignment and structure
>1zi8_A Carboxymethylenebutenolidase; alpha and beta proteins, 3-D structure, serine esterase, HYD aromatic hydrocarbons, catabolism; 1.40A {Pseudomonas putida} PDB: 1zj5_A* 1zi9_A 1zi6_A 1zj4_A* 1din_A 1ziy_A* 1zic_A 1zix_A 1ggv_A* Back     alignment and structure
>3e0x_A Lipase-esterase related protein; APC60309, clostridium acetobutylicum ATCC 824, structural genomics, PSI-2; HET: MSE; 1.45A {Clostridium acetobutylicum} Back     alignment and structure
>3hss_A Putative bromoperoxidase; alpha beta hydrolase, oxidoreductase, hydrolase; 1.90A {Mycobacterium tuberculosis} PDB: 3e3a_A 3hys_A 3hzo_A Back     alignment and structure
>3hju_A Monoglyceride lipase; alpha/beta hydrolase, hydrolase, serine esterase; 2.20A {Homo sapiens} Back     alignment and structure
>3i1i_A Homoserine O-acetyltransferase; structural genomics, IDP01610, O-acetyltransfera bacillus anthracis; HET: MSE; 2.44A {Bacillus anthracis str} Back     alignment and structure
>1gpl_A RP2 lipase; serine esterase, hydrolase, lipid degradation, pancreas, glycoprotein, chimeric; 2.01A {Cavia porcellus} SCOP: b.12.1.2 c.69.1.19 PDB: 1lpb_B* 1lpa_B* 1n8s_A Back     alignment and structure
>2x5x_A PHB depolymerase PHAZ7; biopolymers, oxyanion HOLE, hydrolase, biodegradation, catal; HET: PG4; 1.20A {Paucimonas lemoignei} PDB: 2vtv_A* 2x76_A Back     alignment and structure
>3f67_A Putative dienelactone hydrolase; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; 1.74A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3fak_A Esterase/lipase, ESTE5; HSL, hydrolase; 1.90A {Uncultured bacterium} PDB: 3g9t_A 3g9u_A 3g9z_A 3h17_A* 3h18_A* 3h19_A 3h1a_A 3h1b_A 3l1h_A 3l1i_A 3l1j_A 3v9a_A Back     alignment and structure
>1ex9_A Lactonizing lipase; alpha-beta hydrolase fold, phosphonate inhibitor; HET: OCP; 2.54A {Pseudomonas aeruginosa} SCOP: c.69.1.18 Back     alignment and structure
>3pfb_A Cinnamoyl esterase; alpha/beta hydrolase fold, hydrolase, cinnamoyl/Fe esterase, hydroxycinammates, extracellular; HET: ZYC; 1.58A {Lactobacillus johnsonii} PDB: 3pf9_A* 3pfc_A* 3s2z_A* 3pf8_A 3qm1_A* Back     alignment and structure
>1tca_A Lipase; hydrolase(carboxylic esterase); HET: NAG; 1.55A {Candida antarctica} SCOP: c.69.1.17 PDB: 1lbs_A* 1lbt_A* 1tcb_A* 1tcc_A* Back     alignment and structure
>4fbl_A LIPS lipolytic enzyme; thermostable, structural genomics, enzyme function initiativ structural proteomics in europe, spine; HET: SPD; 1.99A {Unidentified} PDB: 4fbm_A Back     alignment and structure
>2i3d_A AGR_C_3351P, hypothetical protein ATU1826; structural genomics, APC5865, hydrolase, PSI-2, protein STRU initiative; HET: MSE; 1.50A {Agrobacterium tumefaciens str} SCOP: c.69.1.36 Back     alignment and structure
>1w52_X Pancreatic lipase related protein 2; detergent, cleaved flap; HET: DDQ; 2.99A {Equus caballus} Back     alignment and structure
>2wtm_A EST1E; hydrolase; 1.60A {Clostridium proteoclasticum} PDB: 2wtn_A* Back     alignment and structure
>1ei9_A Palmitoyl protein thioesterase 1; alpha/beta hydrolase, glycoprotein, hydrolase; HET: NDG NAG; 2.25A {Bos taurus} SCOP: c.69.1.13 PDB: 1eh5_A* 1exw_A* 3gro_A Back     alignment and structure
>2qmq_A Protein NDRG2, protein NDR2; alpha/beta-hydrolases fold, NDR family, developmental protei differentiation, neurogenesis, phosphorylation; HET: 2PE; 1.70A {Mus musculus} PDB: 2xmq_A 2xmr_A 2xms_A Back     alignment and structure
>2pbl_A Putative esterase/lipase/thioesterase; alpha/beta-hydrolases fold, structural genomics, joint cente structural genomics, JCSG; 1.79A {Silicibacter SP} SCOP: c.69.1.2 Back     alignment and structure
>3k6k_A Esterase/lipase; alpha/beta hydrolase fold; 2.20A {Uncultured bacterium} PDB: 3dnm_A Back     alignment and structure
>1jmk_C SRFTE, surfactin synthetase; thioesterase, non-ribosomal peptide synthesis, alpha-beta hydrolase, cyclic peptide; 1.71A {Bacillus subtilis} SCOP: c.69.1.22 Back     alignment and structure
>1jjf_A Xylanase Z, endo-1,4-beta-xylanase Z, 1,4-beta-D-xylan; feruloyl esterase, ferulic acid esterase, FAE_XYNZ, XYNZ, structural genomics; 1.75A {Clostridium thermocellum} SCOP: c.69.1.2 PDB: 1jt2_A* Back     alignment and structure
>3afi_E Haloalkane dehalogenase; A/B-hydrolase, hydrolase; 1.75A {Bradyrhizobium japonicum} PDB: 3a2m_A* 3a2n_A 3a2l_A* Back     alignment and structure
>2xt0_A Haloalkane dehalogenase; hydrolase, alpha-beta hydrolase fold; 1.90A {Plesiocystis pacifica} Back     alignment and structure
>1tqh_A Carboxylesterase precursor; tetrahedral intermediate, alpha/beta hydrolase; 1.63A {Geobacillus stearothermophilus} SCOP: c.69.1.29 PDB: 1r1d_A* 4diu_A Back     alignment and structure
>1kez_A Erythronolide synthase; polyketide synthase, modular polyketide synthase, thioesterase, 6-DEB, TE, DEBS, alpha, beta-hydrolase; 2.80A {Saccharopolyspora erythraea} SCOP: c.69.1.22 PDB: 1mo2_A Back     alignment and structure
>1bu8_A Protein (pancreatic lipase related protein 2); hydrolase, lipid degradation; HET: NAG; 1.80A {Rattus norvegicus} SCOP: b.12.1.2 c.69.1.19 PDB: 2oxe_A* 2pvs_A 1eth_A* Back     alignment and structure
>4fhz_A Phospholipase/carboxylesterase; alpha/beta hydrolase superfamily, central beta-STR sheet, flanked alpha helices, hydrolase; 2.01A {Rhodobacter sphaeroides} PDB: 4ftw_A* Back     alignment and structure
>3fcx_A FGH, esterase D, S-formylglutathione hydrolase; retinoblastoma, genetic marker, cytoplasm, cytoplasmic vesicle, polymorphism, serine esterase; 1.50A {Homo sapiens} SCOP: c.69.1.0 Back     alignment and structure
>2rau_A Putative esterase; NP_343859.1, putative lipase, structural genomics, joint CEN structural genomics, JCSG; HET: PG4 UNL; 1.85A {Sulfolobus solfataricus P2} Back     alignment and structure
>2pl5_A Homoserine O-acetyltransferase; alpha/beta hydrolase superfa transferase; 2.20A {Leptospira interrogans} SCOP: c.69.1.40 Back     alignment and structure
>2b61_A Homoserine O-acetyltransferase; acyl-enzyme, aspartate pathway, coenzyme A, structure-functi studies, alpha-beta hydrolase fold; 1.65A {Haemophilus influenzae} SCOP: c.69.1.40 Back     alignment and structure
>2k2q_B Surfactin synthetase thioesterase subunit; A/B-hydrolase, NRPS, non-ribosomal peptide synthetase, type II thioesterase, antibiotic biosynthesis; NMR {Bacillus subtilis} PDB: 2ron_A Back     alignment and structure
>2uz0_A Esterase, tributyrin esterase; alpha/beta hydrolase, hydrolase, A virulence facto LUNG infection; HET: MSE; 1.7A {Streptococcus pneumoniae} Back     alignment and structure
>1l7a_A Cephalosporin C deacetylase; structural genomics, alpha-beta-alpha sandwich, PSI, protein structure initiative; 1.50A {Bacillus subtilis} SCOP: c.69.1.25 PDB: 1odt_C 1ods_A 3fvt_A 3fvr_A 3fyu_A* 2xlb_A 2xlc_A 3fyt_A* 3fyu_B* Back     alignment and structure
>2cb9_A Fengycin synthetase; thioesterase, non-ribosomal peptide synthesis, alpha/beta- hydrolases, catalytic triade, hydrolase; 1.8A {Bacillus subtilis} PDB: 2cbg_A* Back     alignment and structure
>2r11_A Carboxylesterase NP; 2632844, putative hydrolase, structural genomics, joint center for structural genomics, JCSG; HET: MSE PGE; 1.96A {Bacillus subtilis} Back     alignment and structure
>1ys1_X Lipase; CIS peptide Leu 234, Ca2+ ION, inhibitor hexylphosphonic acid (R) 2-methyl-3-phenylpropyl ester, hydrolase; HET: 2HR; 1.10A {Burkholderia cepacia} PDB: 1ys2_X* 4lip_D 1hqd_A 2lip_A 1oil_A* 3lip_A 2nw6_A 5lip_A* 1cvl_A 2es4_A 1tah_B 1qge_D 1qge_E Back     alignment and structure
>3aja_A Putative uncharacterized protein; alpha-beta hydrolase, serine esterase, cutinase, lipase, HYD; 2.90A {Mycobacterium smegmatis} Back     alignment and structure
>2c7b_A Carboxylesterase, ESTE1; carboxyesterase, thermophilic enzyme, hydrolase, HSL, alpha/beta hydrolase fold; 2.3A {Uncultured archaeon} Back     alignment and structure
>3d0k_A Putative poly(3-hydroxybutyrate) depolymerase LPQ; alpha-beta-alpha sandwich, structural genomics, PSI-2; 1.83A {Bordetella parapertussis 12822} Back     alignment and structure
>3qpa_A Cutinase; alpha-beta hydrolase fold, esterase, hydrolase, mono- phosphorylated serine residue, secreted; HET: MIR; 0.85A {Nectria haematococca} PDB: 3qpc_A* 1cex_A 1oxm_A* 1cui_A 1cus_A 2cut_A 1cuj_A 1cuy_A 1xzl_A* 1xzk_A* 1xzm_A* 1cuh_A 1cuu_A 3esc_A* 1cua_A* 3esa_A* 3esb_A* 3ef3_A* 3esd_A* 1cux_A ... Back     alignment and structure
>2o2g_A Dienelactone hydrolase; YP_324580.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.92A {Anabaena variabilis} Back     alignment and structure
>3p2m_A Possible hydrolase; alpha/beta hydrolase superfamily; 2.80A {Mycobacterium tuberculosis} Back     alignment and structure
>1imj_A CIB, CCG1-interacting factor B; alpha/beta hydrolase, CCG1 interactor; 2.20A {Homo sapiens} SCOP: c.69.1.23 Back     alignment and structure
>4e15_A Kynurenine formamidase; alpha/beta hydrolase fold, hydrolase-hydrolase inhibitor COM; HET: SEB; 1.50A {Drosophila melanogaster} PDB: 4e14_A* 4e11_A Back     alignment and structure
>2hfk_A Pikromycin, type I polyketide synthase pikaiv; alpha/beta hydrolase, thioesterase; HET: E4H; 1.79A {Streptomyces venezuelae} PDB: 2h7x_A* 2h7y_A* 2hfj_A* 1mna_A 1mn6_A 1mnq_A Back     alignment and structure
>3kxp_A Alpha-(N-acetylaminomethylene)succinic acid hydrolase; alpha/beta hydrolase, PLP degradation, E-2- (acetamidomethylene)succinate; 2.26A {Mesorhizobium loti} Back     alignment and structure
>1m33_A BIOH protein; alpha-betta-alpha sandwich, structural genomics, PSI, protei structure initiative; HET: MSE 3OH; 1.70A {Escherichia coli} SCOP: c.69.1.26 Back     alignment and structure
>2q0x_A Protein DUF1749, uncharacterized protein; alpha/beta hydrolase fold, structural genomics, structural G of pathogenic protozoa consortium; 2.20A {Trypanosoma brucei} Back     alignment and structure
>2y6u_A Peroxisomal membrane protein LPX1; hydrolase, putative esterase, putative lipase; HET: CME CSO; 1.90A {Saccharomyces cerevisiae} PDB: 2y6v_A* Back     alignment and structure
>3qyj_A ALR0039 protein; alpha/beta fold, hydrolase; 1.78A {Nostoc SP} Back     alignment and structure
>3fcy_A Xylan esterase 1; alpha/beta hydrolase, carbohydrate esterase, CE7; 2.10A {Thermoanaerobacterium SP} Back     alignment and structure
>1jkm_A Brefeldin A esterase; serine hydrolase, degradation of brefeldin A, alpha/beta hydrolase family; 1.85A {Bacillus subtilis} SCOP: c.69.1.2 Back     alignment and structure
>1lzl_A Heroin esterase; alpha/beta hydrolase; 1.30A {Rhodococcus SP} SCOP: c.69.1.2 PDB: 1lzk_A Back     alignment and structure
>1vlq_A Acetyl xylan esterase; TM0077, structural genomics, JCSG, PR structure initiative, PSI, joint center for structural GENO hydrolase; 2.10A {Thermotoga maritima} SCOP: c.69.1.25 PDB: 3m81_A 3m83_A* 3m82_A* Back     alignment and structure
>3ain_A 303AA long hypothetical esterase; carboxylesterase, thermophilic, dimer, archaea, R267G, hydro; 1.65A {Sulfolobus tokodaii} PDB: 3aio_A 3ail_A 3aik_A 3aim_A Back     alignment and structure
>3bjr_A Putative carboxylesterase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 2.09A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>2qm0_A BES; alpha-beta structure, structural genomics, PSI-2, protein ST initiative, midwest center for structural genomics, MCSG; HET: SVY; 1.84A {Bacillus cereus atcc 14579} Back     alignment and structure
>2px6_A Thioesterase domain; thioesaterse domain, orlistat, fatty acid synthase, drug complex, tetrahydrolipstatin, transferase; HET: DH9; 2.30A {Homo sapiens} Back     alignment and structure
>1b6g_A Haloalkane dehalogenase; hydrolase, alpha/beta-hydrolase; 1.15A {Xanthobacter autotrophicus} SCOP: c.69.1.8 PDB: 1be0_A 1cij_A 2yxp_X 1edd_A 1edb_A 2dhc_A 2dhe_A 2eda_A 2edc_A 2had_A 1ede_A 2pky_X 1bez_A 1bee_A 2dhd_A* 1hde_A Back     alignment and structure
>4h0c_A Phospholipase/carboxylesterase; PSI-biology, midwest center for structural genomics, MCSG, hydrolase; HET: CIT; 1.62A {Dyadobacter fermentans} Back     alignment and structure
>1dqz_A 85C, protein (antigen 85-C); fibronectin, structural genomics, PSI, protein structure initiative, TB structural genomics consortium; 1.50A {Mycobacterium tuberculosis} SCOP: c.69.1.3 PDB: 3hrh_A 1dqy_A 1va5_A* 1f0n_A* 1f0p_A* Back     alignment and structure
>1jji_A Carboxylesterase; alpha-beta hydrolase fold, hydrolase; HET: EPE; 2.20A {Archaeoglobus fulgidus} SCOP: c.69.1.2 Back     alignment and structure
>3h2g_A Esterase; xanthomonas oryzae PV. oryzae, cell WALL degrading enzyme, RICE, virulence, innate immune responses, pathogenesis; 1.86A {Xanthomonas oryzae PV} PDB: 3h2j_A 3h2k_A* 3h2h_A 3h2i_A Back     alignment and structure
>3ksr_A Putative serine hydrolase; catalytic triad, structural genomics, JOIN for structural genomics, JCSG; 2.69A {Xanthomonas campestris PV} Back     alignment and structure
>3bxp_A Putative lipase/esterase; putative carboxylesterase, structural genomics, joint center structural genomics, JCSG; HET: EPE; 1.70A {Lactobacillus plantarum WCFS1} PDB: 3d3n_A* Back     alignment and structure
>2vat_A Acetyl-COA--deacetylcephalosporin C acetyltransferase; A/B- hydrolase fold, acyltransferase, acetyl coenzyme A, antibiotic biosynthesis; HET: COA; 2.2A {Acremonium chrysogenum} SCOP: c.69.1.40 PDB: 2vav_A* 2vax_A* Back     alignment and structure
>2zsh_A Probable gibberellin receptor GID1L1; plant hormone receptor, gibberellin, gibberellin signaling pathway, hydrolase, nucleus, receptor, developmental protein; HET: GA3; 1.80A {Arabidopsis thaliana} PDB: 2zsi_A* Back     alignment and structure
>3ga7_A Acetyl esterase; phosphoserine, IDP00896, hydrolase, serine structural genomics, center for structural genomics of INFE diseases, csgid; HET: SEP MSE; 1.55A {Salmonella typhimurium} Back     alignment and structure
>3i28_A Epoxide hydrolase 2; aromatic hydrocarbons catabolism, detoxification, magnesium, metal-binding, peroxisome; HET: 34N; 1.95A {Homo sapiens} PDB: 1s8o_A* 1zd2_P* 1vj5_A* 1zd4_A* 1zd5_A* 3i1y_A* 1zd3_A* 3koo_A* 3otq_A* 4hai_A* 1cqz_A 1cr6_A* 1ek1_A* 1ek2_A* 3ans_A* 3ant_A* 3pdc_A* Back     alignment and structure
>3doh_A Esterase; alpha-beta hydrolase, beta sheet; 2.60A {Thermotoga maritima} PDB: 3doi_A Back     alignment and structure
>2e3j_A Epoxide hydrolase EPHB; epoxide hydrolase B, structural mycobacterium tuberculosis structural proteomics project, X hydrolase; 2.10A {Mycobacterium tuberculosis} PDB: 2zjf_A* Back     alignment and structure
>3b12_A Fluoroacetate dehalogenase; dehalogease, hydrolase; 1.20A {Burkholderia SP} PDB: 1y37_A Back     alignment and structure
>2hih_A Lipase 46 kDa form; A1 phospholipase, phospholipid binding, hydrolase; 2.86A {Staphylococcus hyicus} Back     alignment and structure
>1sfr_A Antigen 85-A; alpha/beta hydrolase, structural genomics, PSI, protein structure initiative, TB structural genomics consortium, TBSGC; 2.70A {Mycobacterium tuberculosis} SCOP: c.69.1.3 Back     alignment and structure
>1tht_A Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1.13 Back     alignment and structure
>1r88_A MPT51/MPB51 antigen; ALFA/beta hydrolase fold, FBPC1, immune system; 1.71A {Mycobacterium tuberculosis} SCOP: c.69.1.3 Back     alignment and structure
>3hxk_A Sugar hydrolase; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 3.20A {Lactococcus lactis subsp} Back     alignment and structure
>3vdx_A Designed 16NM tetrahedral protein CAGE containing bromoperoxidase BPO-A2 and matrix...; protein design, bionanotechnology; 3.00A {Streptomyces aureofaciens} PDB: 4d9j_A Back     alignment and structure
>3n2z_B Lysosomal Pro-X carboxypeptidase; alpha/beta hydrolase, PRCP, serine carboxypeptidase, hydrola; HET: NAG; 2.79A {Homo sapiens} Back     alignment and structure
>1hpl_A Lipase; hydrolase(carboxylic esterase); 2.30A {Equus caballus} SCOP: b.12.1.2 c.69.1.19 Back     alignment and structure
>2o7r_A CXE carboxylesterase; alpha/beta hydrolase; 1.40A {Actinidia eriantha} PDB: 2o7v_A Back     alignment and structure
>3dcn_A Cutinase, cutin hydrolase; catalytic triad, secreted, serine esterase; 1.90A {Glomerella cingulata} SCOP: c.69.1.0 PDB: 3dd5_A 3dea_A* Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>1rp1_A Pancreatic lipase related protein 1; hydrolase, lipid degradation; HET: NAG; 2.10A {Canis lupus familiaris} SCOP: b.12.1.2 c.69.1.19 PDB: 2ppl_A Back     alignment and structure
>2hm7_A Carboxylesterase; alpha/beta hydrolase fold, hydrolase; 2.00A {Alicyclobacillus acidocaldarius} PDB: 1evq_A* 1u4n_A 1qz3_A Back     alignment and structure
>3qh4_A Esterase LIPW; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, tuberculosis, O LIPW, heroin esterase; 1.75A {Mycobacterium marinum} Back     alignment and structure
>4ezi_A Uncharacterized protein; alpha-beta hydrolases fold, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.15A {Legionella pneumophila subsp} Back     alignment and structure
>2dsn_A Thermostable lipase; T1 lipase, hydrolase; 1.50A {Geobacillus zalihae} PDB: 3umj_A 2z5g_A 1ji3_A 3auk_A 2w22_A* 1ku0_A Back     alignment and structure
>3g02_A Epoxide hydrolase; alpha/beta hydrolase fold, enantioselective, mutant, directed evolution; 1.50A {Aspergillus niger} SCOP: c.69.1.11 PDB: 1qo7_A 3g0i_A* Back     alignment and structure
>2czq_A Cutinase-like protein; alpha/beta hydrolase fold, hydrolase; HET: CIT; 1.05A {Cryptococcus SP} Back     alignment and structure
>3ebl_A Gibberellin receptor GID1; alpha/beta hydrolase, lipase, gibberellin signaling pathway, hydrolase, nucleus, hydrolase receptor; HET: GA4; 1.90A {Oryza sativa subsp} PDB: 3ed1_A* Back     alignment and structure
>3qpd_A Cutinase 1; alpha-beta hydrolase fold, esterase, hydrolase, mono- phosphorylated serine residue, secreted, phosphorylated Ser residue; HET: SEP; 1.57A {Aspergillus oryzae} PDB: 3gbs_A Back     alignment and structure
>2zyr_A Lipase, putative; fatty acid, hydrolase; HET: 1PE; 1.77A {Archaeoglobus fulgidus} PDB: 2zys_A* 2zyi_A* 2zyh_A* Back     alignment and structure
>2hdw_A Hypothetical protein PA2218; alpha/beta hydrolase fold, structural genomics, PSI, structure initiative; 2.00A {Pseudomonas aeruginosa} Back     alignment and structure
>4i19_A Epoxide hydrolase; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics, MCSG; 2.15A {Streptomyces carzinostaticus subsp} Back     alignment and structure
>1jfr_A Lipase; serine hydrolase; 1.90A {Streptomyces exfoliatus} SCOP: c.69.1.16 Back     alignment and structure
>2gzs_A IROE protein; enterobactin, salmochelin, DFP, hydrolase, catalytic DYAD; HET: DFP; 1.40A {Escherichia coli} SCOP: c.69.1.38 PDB: 2gzr_A* Back     alignment and structure
>2fx5_A Lipase; alpha-beta hydrolase; HET: TLA; 1.80A {Pseudomonas mendocina} Back     alignment and structure
>3k2i_A Acyl-coenzyme A thioesterase 4; alpha/beta hydrolase fold seven-stranded beta-sandwich, structural genomics, structural genomics consortium, SGC; 2.40A {Homo sapiens} Back     alignment and structure
>1gkl_A Endo-1,4-beta-xylanase Y; hydrolase, esterase family 1, inactive mutant; HET: FER; 1.4A {Clostridium thermocellum} SCOP: c.69.1.2 PDB: 1wb4_A* 1wb5_A* 1wb6_A* 1gkk_A* Back     alignment and structure
>3vis_A Esterase; alpha/beta-hydrolase fold, polyethylene terephthal hydrolase; HET: PE4; 1.76A {Thermobifida alba} Back     alignment and structure
>3mve_A FRSA, UPF0255 protein VV1_0328; FRSA,fermentation/respiration switch protein, hydrolase ACTI lyase; 2.20A {Vibrio vulnificus} PDB: 3our_A Back     alignment and structure
>3hlk_A Acyl-coenzyme A thioesterase 2, mitochondrial; alpha/beta hydrolase, alternative splicing, hydrolase, mitochondrion, polymorphism, serine esterase; 2.10A {Homo sapiens} Back     alignment and structure
>1qlw_A Esterase; anisotropic refinement, atomic resolution, alpha/beta hydrolase; 1.09A {Alcaligenes SP} SCOP: c.69.1.15 PDB: 2wkw_A* Back     alignment and structure
>3guu_A Lipase A; protein structure, hydrolase; HET: 1PE; 2.10A {Candida antarctica} PDB: 2veo_A* Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>3c8d_A Enterochelin esterase; alpha-beta-alpha sandwich, IROD, iron aquisition, structural genomics, PSI-2, protein structure initiative; HET: CIT; 1.80A {Shigella flexneri 2a str} SCOP: b.1.18.20 c.69.1.2 PDB: 2b20_A 3c87_A* 3c8h_A 3mga_A* Back     alignment and structure
>2jbw_A Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine hydrolase; alpha/beta hydrolase, META-cleavage pathway; 2.1A {Arthrobacter nicotinovorans} SCOP: c.69.1.41 Back     alignment and structure
>3g8y_A SUSD/RAGB-associated esterase-like protein; structural genom joint center for structural genomics, JCSG; HET: MSE; 1.90A {Bacteroides vulgatus atcc 8482} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 551
d3tgla_265 c.69.1.17 (A:) Triacylglycerol lipase {Rhizomucor 6e-17
d1uwca_261 c.69.1.17 (A:) Feruloyl esterase A {Aspergillus ni 2e-15
d1lgya_265 c.69.1.17 (A:) Triacylglycerol lipase {Rhizopus ni 1e-12
>d3tgla_ c.69.1.17 (A:) Triacylglycerol lipase {Rhizomucor miehei [TaxId: 4839]} Length = 265 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: alpha/beta-Hydrolases
superfamily: alpha/beta-Hydrolases
family: Fungal lipases
domain: Triacylglycerol lipase
species: Rhizomucor miehei [TaxId: 4839]
 Score = 78.7 bits (193), Expect = 6e-17
 Identities = 42/166 (25%), Positives = 69/166 (41%), Gaps = 9/166 (5%)

Query: 356 EVKQAVADDLKSTRLSPCEWFICDDDQSATRFFVIQGSESLASWQANLLFEPVQFEGLE- 414
           ++ +  +  +  T        +   D   T + V +GS S+ +W A+L F PV +  +  
Sbjct: 46  KIIKTWSTLIYDTN-----AMVARGDSEKTIYIVFRGSSSIRNWIADLTFVPVSYPPVSG 100

Query: 415 VVVHRGIYEAAKGIYEQMLPEVHAHLKACGKHATFRFTGHSLGGSLSVLINLMLLIRGEV 474
             VH+G  ++   +  +++  V    K          TGHSLGG+  +L  L L  R E 
Sbjct: 101 TKVHKGFLDSYGEVQNELVATVLDQFKQY-PSYKVAVTGHSLGGATVLLCALDLYQREEG 159

Query: 475 PASSLLPVITFGAPSIMCGGDHLLRKLGLPRSHVQSITLHRDIVPR 520
            +SS L + T G P +  G       +       +     RDIVP 
Sbjct: 160 LSSSNLFLYTQGQPRV--GDPAFANYVVSTGIPYRRTVNERDIVPH 203


>d1uwca_ c.69.1.17 (A:) Feruloyl esterase A {Aspergillus niger [TaxId: 5061]} Length = 261 Back     information, alignment and structure
>d1lgya_ c.69.1.17 (A:) Triacylglycerol lipase {Rhizopus niveus [TaxId: 4844]} Length = 265 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query551
d3tgla_265 Triacylglycerol lipase {Rhizomucor miehei [TaxId: 100.0
d1lgya_265 Triacylglycerol lipase {Rhizopus niveus [TaxId: 48 100.0
d1tiba_269 Triacylglycerol lipase {Thermomyces lanuginosus, f 99.98
d1uwca_261 Feruloyl esterase A {Aspergillus niger [TaxId: 506 99.97
d1tiaa_271 Triacylglycerol lipase {Penicillium camembertii [T 99.97
d1pjaa_ 268 Palmitoyl protein thioesterase 2 {Human (Homo sapi 96.25
d1ispa_179 Lipase A {Bacillus subtilis [TaxId: 1423]} 95.89
d1jmkc_230 Surfactin synthetase, SrfA {Bacillus subtilis [Tax 95.12
d3c70a1256 Hydroxynitrile lyase {Rubber tree (Hevea brasilien 94.83
d1xkta_286 Fatty acid synthase {Human (Homo sapiens) [TaxId: 94.8
d1cexa_197 Cutinase {Fungus (Fusarium solani), subsp. pisi [T 94.8
d1mtza_290 Tricorn interacting factor F1 {Archaeon Thermoplas 94.44
d1hkha_279 Gamma-lactamase {Aureobacterium sp. [TaxId: 51671] 94.24
d1mo2a_255 Erythromycin polyketide synthase {Saccharopolyspor 94.0
d1brta_277 Bromoperoxidase A2 {Streptomyces aureofaciens [Tax 94.0
d1thta_302 Myristoyl-ACP-specific thioesterase {Vibrio harvey 93.57
d1ex9a_ 285 Lipase {Pseudomonas aeruginosa [TaxId: 287]} 93.45
d1cvla_ 319 Lipase {Chromobacterium viscosum [TaxId: 42739]} 93.41
d3b5ea1209 Uncharacterized protein Mll8374 {Mesorhizobium lot 93.28
d1j1ia_268 Meta cleavage compound hydrolase CarC {Janthinobac 93.28
d1tcaa_ 317 Triacylglycerol lipase {Yeast (Candida antarctica) 93.21
d2h7xa1283 Picromycin polyketide synthase {Streptomyces venez 93.15
d1a8qa_274 Bromoperoxidase A1 {Streptomyces aureofaciens [Tax 92.85
d1ehya_293 Bacterial epoxide hydrolase {Agrobacterium radioba 92.84
d1k8qa_ 377 Gastric lipase {Dog (Canis familiaris) [TaxId: 961 92.79
d1c4xa_281 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas 92.37
d1vkha_263 Putative serine hydrolase Ydr428c {Baker's yeast ( 92.19
d1mj5a_298 Haloalkane dehalogenase {Sphingomonas paucimobilis 92.02
d1uxoa_186 Hypothetical protein YdeN {Bacillus subtilis [TaxI 91.99
d1bn7a_291 Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1 91.92
d1uk8a_271 Meta-cleavage product hydrolase CumD {Pseudomonas 91.85
d1q0ra_297 Aclacinomycin methylesterase RdmC {Streptomyces pu 91.73
d2fuka1218 XC6422 protein {Xanthomonas campestris [TaxId: 339 91.34
d1fj2a_229 Acyl protein thioesterase 1 {Human (Homo sapiens) 91.27
d1zd3a2 322 Mammalian epoxide hydrolase, C-terminal domain {Hu 91.02
d1xkla_258 Salicylic acid-binding protein 2 (SABP2) {Common t 90.89
d1ei9a_ 279 Palmitoyl protein thioesterase 1 {Cow (Bos taurus) 90.82
d1b6ga_310 Haloalkane dehalogenase {Xanthobacter autotrophicu 90.32
d1r3da_264 Hypothetical protein VC1974 {Vibrio cholerae [TaxI 90.21
d1azwa_ 313 Proline iminopeptidase {Xanthomonas campestris, pv 90.2
d2rhwa1283 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas 90.1
d1tqha_242 Carboxylesterase Est {Bacillus stearothermophilus 89.78
d1sfra_288 Antigen 85a {Mycobacterium tuberculosis [TaxId: 17 87.82
d2dsta1122 Hypothetical protein TTHA1544 {Thermus thermophilu 87.69
d1jjfa_255 Feruloyl esterase domain of the cellulosomal xylan 86.53
d1g66a_207 Acetylxylan esterase {Penicillium purpurogenum [Ta 86.36
d1imja_208 Ccg1/TafII250-interacting factor B (Cib) {Human (H 86.19
d1auoa_218 Carboxylesterase {Pseudomonas fluorescens [TaxId: 86.07
d1qoza_207 Acetylxylan esterase {Trichoderma reesei [TaxId: 5 85.91
d1r88a_267 Antigen pt51/mpb51 {Mycobacterium tuberculosis [Ta 85.22
d1dqza_280 Antigen 85c {Mycobacterium tuberculosis [TaxId: 17 85.0
d2jbwa1360 2,6-dihydropseudooxynicotine hydrolase {Arthrobact 84.75
d2r8ba1203 Uncharacterized protein Atu2452 {Agrobacterium tum 84.18
d1va4a_271 Arylesterase {Pseudomonas fluorescens [TaxId: 294] 84.03
d1a8sa_273 Chloroperoxidase F {Pseudomonas fluorescens [TaxId 83.84
d1m33a_256 Biotin biosynthesis protein BioH {Escherichia coli 82.32
d2pbla1261 Uncharacterized protein TM1040_2492 {Silicibacter 81.85
d2h1ia1202 Carboxylesterase {Bacillus cereus [TaxId: 1396]} 81.71
d1rp1a2337 Pancreatic lipase, N-terminal domain {Dog (Canis f 80.82
d3c8da2246 Enterochelin esterase, catalytic domain {Shigella 80.41
d1ufoa_238 Hypothetical protein TT1662 {Thermus thermophilus 80.18
>d3tgla_ c.69.1.17 (A:) Triacylglycerol lipase {Rhizomucor miehei [TaxId: 4839]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: alpha/beta-Hydrolases
superfamily: alpha/beta-Hydrolases
family: Fungal lipases
domain: Triacylglycerol lipase
species: Rhizomucor miehei [TaxId: 4839]
Probab=100.00  E-value=1e-32  Score=272.25  Aligned_cols=151  Identities=27%  Similarity=0.395  Sum_probs=132.0

Q ss_pred             ceEEEEEeCCCCeEEEEEccCCCHHHHHHhcCCcceecCC-CCeeEcHHHHHHHHHHHHHHHHHHHHHHHhcCCCceEEE
Q 008846          373 CEWFICDDDQSATRFFVIQGSESLASWQANLLFEPVQFEG-LEVVVHRGIYEAAKGIYEQMLPEVHAHLKACGKHATFRF  451 (551)
Q Consensus       373 c~~fIa~D~~~~tIVIAFRGT~Sl~DWltDL~f~~v~feg-~g~kVHrGFy~aa~~ly~qll~~L~~~Lks~gp~~kIiV  451 (551)
                      ..+||++|+..++|||+||||.++.||++||++.+++++. .+++||+||+.++..++++++..|++.+++ +|.++|+|
T Consensus        58 ~~~~v~~~~~~~~ivV~fRGT~s~~d~~~dl~~~~~~~~~~~~~~VH~GF~~~~~~v~~~i~~~i~~~~~~-~~~~~i~v  136 (265)
T d3tgla_          58 TNAMVARGDSEKTIYIVFRGSSSIRNWIADLTFVPVSYPPVSGTKVHKGFLDSYGEVQNELVATVLDQFKQ-YPSYKVAV  136 (265)
T ss_dssp             CEEEEEEETTTTEEEEEECCCSSHHHHHHHCCCCEEECTTSTTCEEEHHHHHHHHHHHHHHHHHHHHHHHH-CTTSEEEE
T ss_pred             ceEEEEEeCCCCEEEEEEcCCCCHHHHHHhCccccccccCCCCcEEehhHHHHHHHHHHHHHHHHHHHHHh-CCCceEEE
Confidence            3579999999999999999999999999999999998874 688999999999999999999999988776 48899999


Q ss_pred             eecChhHHHHHHHHHHHHHcCCCCCCCcccEEEeCCCcCCCCChHHHHHcCCCCCcEEEEEECCCcccccCCCCc
Q 008846          452 TGHSLGGSLSVLINLMLLIRGEVPASSLLPVITFGAPSIMCGGDHLLRKLGLPRSHVQSITLHRDIVPRAFSCNY  526 (551)
Q Consensus       452 TGHSLGGALAsLaAL~L~~~~~~p~~~~v~VyTFGSPrVmcGnd~fa~~l~~~~~~I~RVVn~~DIVPrLP~~~y  526 (551)
                      ||||||||||+|++++|..+........+.+||||+|||  ||..|++++......++||+|.+|+||+||+..+
T Consensus       137 tGHSLGGAlA~L~a~~l~~~~~~~~~~~i~~~TFG~Prv--Gn~~fa~~~~~~~~~~~Rvvn~~D~VP~lP~~~~  209 (265)
T d3tgla_         137 TGHSLGGATVLLCALDLYQREEGLSSSNLFLYTQGQPRV--GDPAFANYVVSTGIPYRRTVNERDIVPHLPPAAF  209 (265)
T ss_dssp             EEETHHHHHHHHHHHHHHHTCSSCCTTTEEEEEESCCCC--BCHHHHHHHHHTCCCEEEEEETTBSGGGCSCGGG
T ss_pred             ecccchHHHHHHHHHHHHHhccccCccccceeecCCCcc--CCHHHHHHHHhcCceEEEEEecCCEEeeCCCCCC
Confidence            999999999999999997654322234578999999999  9999998775444567899999999999998654



>d1lgya_ c.69.1.17 (A:) Triacylglycerol lipase {Rhizopus niveus [TaxId: 4844]} Back     information, alignment and structure
>d1tiba_ c.69.1.17 (A:) Triacylglycerol lipase {Thermomyces lanuginosus, formerly Humicola lanuginosa [TaxId: 5541]} Back     information, alignment and structure
>d1uwca_ c.69.1.17 (A:) Feruloyl esterase A {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d1tiaa_ c.69.1.17 (A:) Triacylglycerol lipase {Penicillium camembertii [TaxId: 5075]} Back     information, alignment and structure
>d1pjaa_ c.69.1.13 (A:) Palmitoyl protein thioesterase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ispa_ c.69.1.18 (A:) Lipase A {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1jmkc_ c.69.1.22 (C:) Surfactin synthetase, SrfA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d3c70a1 c.69.1.20 (A:2-257) Hydroxynitrile lyase {Rubber tree (Hevea brasiliensis) [TaxId: 3981]} Back     information, alignment and structure
>d1xkta_ c.69.1.22 (A:) Fatty acid synthase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cexa_ c.69.1.30 (A:) Cutinase {Fungus (Fusarium solani), subsp. pisi [TaxId: 169388]} Back     information, alignment and structure
>d1mtza_ c.69.1.7 (A:) Tricorn interacting factor F1 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1hkha_ c.69.1.12 (A:) Gamma-lactamase {Aureobacterium sp. [TaxId: 51671]} Back     information, alignment and structure
>d1mo2a_ c.69.1.22 (A:) Erythromycin polyketide synthase {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1brta_ c.69.1.12 (A:) Bromoperoxidase A2 {Streptomyces aureofaciens [TaxId: 1894]} Back     information, alignment and structure
>d1thta_ c.69.1.13 (A:) Myristoyl-ACP-specific thioesterase {Vibrio harveyi [TaxId: 669]} Back     information, alignment and structure
>d1ex9a_ c.69.1.18 (A:) Lipase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1cvla_ c.69.1.18 (A:) Lipase {Chromobacterium viscosum [TaxId: 42739]} Back     information, alignment and structure
>d3b5ea1 c.69.1.14 (A:7-215) Uncharacterized protein Mll8374 {Mesorhizobium loti [TaxId: 381]} Back     information, alignment and structure
>d1j1ia_ c.69.1.10 (A:) Meta cleavage compound hydrolase CarC {Janthinobacterium sp. J3 [TaxId: 213804]} Back     information, alignment and structure
>d1tcaa_ c.69.1.17 (A:) Triacylglycerol lipase {Yeast (Candida antarctica), form b [TaxId: 34362]} Back     information, alignment and structure
>d2h7xa1 c.69.1.22 (A:9-291) Picromycin polyketide synthase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1a8qa_ c.69.1.12 (A:) Bromoperoxidase A1 {Streptomyces aureofaciens [TaxId: 1894]} Back     information, alignment and structure
>d1ehya_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Agrobacterium radiobacter [TaxId: 358]} Back     information, alignment and structure
>d1k8qa_ c.69.1.6 (A:) Gastric lipase {Dog (Canis familiaris) [TaxId: 9615]} Back     information, alignment and structure
>d1c4xa_ c.69.1.10 (A:) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Rhodococcus sp., strain rha1 [TaxId: 1831]} Back     information, alignment and structure
>d1vkha_ c.69.1.32 (A:) Putative serine hydrolase Ydr428c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1mj5a_ c.69.1.8 (A:) Haloalkane dehalogenase {Sphingomonas paucimobilis, UT26, LinB [TaxId: 13689]} Back     information, alignment and structure
>d1uxoa_ c.69.1.31 (A:) Hypothetical protein YdeN {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1bn7a_ c.69.1.8 (A:) Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1831]} Back     information, alignment and structure
>d1uk8a_ c.69.1.10 (A:) Meta-cleavage product hydrolase CumD {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1q0ra_ c.69.1.28 (A:) Aclacinomycin methylesterase RdmC {Streptomyces purpurascens [TaxId: 1924]} Back     information, alignment and structure
>d2fuka1 c.69.1.36 (A:3-220) XC6422 protein {Xanthomonas campestris [TaxId: 339]} Back     information, alignment and structure
>d1fj2a_ c.69.1.14 (A:) Acyl protein thioesterase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zd3a2 c.69.1.11 (A:225-547) Mammalian epoxide hydrolase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkla_ c.69.1.20 (A:) Salicylic acid-binding protein 2 (SABP2) {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1ei9a_ c.69.1.13 (A:) Palmitoyl protein thioesterase 1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1b6ga_ c.69.1.8 (A:) Haloalkane dehalogenase {Xanthobacter autotrophicus [TaxId: 280]} Back     information, alignment and structure
>d1r3da_ c.69.1.35 (A:) Hypothetical protein VC1974 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1azwa_ c.69.1.7 (A:) Proline iminopeptidase {Xanthomonas campestris, pv. citri [TaxId: 339]} Back     information, alignment and structure
>d2rhwa1 c.69.1.10 (A:4-286) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Burkholderia xenovorans [TaxId: 36873]} Back     information, alignment and structure
>d1tqha_ c.69.1.29 (A:) Carboxylesterase Est {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1sfra_ c.69.1.3 (A:) Antigen 85a {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2dsta1 c.69.1.39 (A:2-123) Hypothetical protein TTHA1544 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1jjfa_ c.69.1.2 (A:) Feruloyl esterase domain of the cellulosomal xylanase z {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1g66a_ c.69.1.30 (A:) Acetylxylan esterase {Penicillium purpurogenum [TaxId: 28575]} Back     information, alignment and structure
>d1imja_ c.69.1.23 (A:) Ccg1/TafII250-interacting factor B (Cib) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1auoa_ c.69.1.14 (A:) Carboxylesterase {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1qoza_ c.69.1.30 (A:) Acetylxylan esterase {Trichoderma reesei [TaxId: 51453]} Back     information, alignment and structure
>d1r88a_ c.69.1.3 (A:) Antigen pt51/mpb51 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1dqza_ c.69.1.3 (A:) Antigen 85c {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2jbwa1 c.69.1.41 (A:8-367) 2,6-dihydropseudooxynicotine hydrolase {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d2r8ba1 c.69.1.14 (A:44-246) Uncharacterized protein Atu2452 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1va4a_ c.69.1.12 (A:) Arylesterase {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1a8sa_ c.69.1.12 (A:) Chloroperoxidase F {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1m33a_ c.69.1.26 (A:) Biotin biosynthesis protein BioH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2pbla1 c.69.1.2 (A:1-261) Uncharacterized protein TM1040_2492 {Silicibacter sp. tm1040 [TaxId: 292414]} Back     information, alignment and structure
>d2h1ia1 c.69.1.14 (A:1-202) Carboxylesterase {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1rp1a2 c.69.1.19 (A:1-336) Pancreatic lipase, N-terminal domain {Dog (Canis familiaris) [TaxId: 9615]} Back     information, alignment and structure
>d3c8da2 c.69.1.2 (A:151-396) Enterochelin esterase, catalytic domain {Shigella flexneri 2a str. 2457T [TaxId: 198215]} Back     information, alignment and structure
>d1ufoa_ c.69.1.27 (A:) Hypothetical protein TT1662 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure