Citrus Sinensis ID: 008860

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-
MATSVTTPKLTTTFYNRLPITVPLSSHFLSLQNTLTPFSHNCFSLLYFQCRRRHVAARAKSDNGAELPSHYDFDLFTIGAGSGGVRASRFAANFGASVAICELPFSTISSETTGGVGGTCVLRGCVPKKLLVYASKFSHEFDESNGFGWKYGTEPQHDWSTLIANKNAELQRLTGIYKNILINAGITLIEGRGKIVDPHTVDVDGKLYSARHILISVGGRPFIPDIPGSEYAIDSDAALDLPSKPEKIAIVGGGYIALEFAGIFSGLTSEVHVFIRQKKVLRGFDEDIRDFVAEQMSLRGIEFHTEESPQAILKSTDGSLSVKTNKGTVDGFSHVMFATGRRPNTKNLGLEKVGVKMTKNGAIEVDEYSGTAVPSIWAVGDVTDRINLTPVALMEGGALAKTLFQAEPTKPDYSAVPSAVFSQPPIGQVGLSEEQAIQEYGDIDVFTANFRPLKATLSGLPDRIFMKLVLCAKTNKVLGLHMCGEDAPEIVQGFAVAVKAGLTKADFDATVGVHPTAAEEFVTLRTPTRKIRKSPPSEGMTGPEVKAAAGV
ccccccccccEEEEEccccccccccccccccccccccccccccccHHHHHHHHHHHHcccccccccccccccccEEEEccccHHHHHHHHHHHcccEEEEEEccccccccccccccccccccccccHHHHHHHHccccHHHHHccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEEEEEEcccEEEEccEEEEEccEEEEcccccccccccccccEEcccccccccccccEEEEEcccHHHHHHHHHHccccccEEEEEcccccccccHHHHHHHHHHHHHHcccEEccccccEEEEEcccccEEEEEcccEEEEccEEEEEccccccccccccccccEEEcccccEEEccccccccccEEEEccccccccccHHHHHHHHHHHHHHcccccccccccccccEEccccccccccccHHHHHHHcccEEEEEccccccccccccccccEEEEEEEEcccccEEEEEEEcccccHHHHHHHHHHHccccHHHHHcccccccccccHHHcccccEEcccccccccccccHHHHHHccc
cccccccccccHHHHccccccccccccccccccccccccccccccccccccccEEcccccccccccccccccEcEEEEcccHHHHHHHHHHHHcccEEEEEEcccccccccccccccHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHcEEccHHccEcHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEccEEEEEccEEEEccEEEEEEEEEEcccEEEcccccccHHHcEEHHHHHHccccccEEEEEcccHHHHHHHHHHHHcccEEEEEcccccccccccHHHHHHHHHHHHHHccEEEccccEEEEEEcccccEEEEEccccEEEEcEEEEcccEEEccccccHHHHcccEcccccEccccccEcccccEEEccHHHcccccHHHHHHHHHHHHHHHHcccccccccccccEEEcccccEEEEEccHHHHHccccEEEEEEEEEcccHHHHcccccccEEEEEEEccccEEEEEEEEcccHHHHHHHHHHHHHHccEHHHHHcccccccccHHHHHccccccccccccccccccccccEEEEccc
matsvttpkltttfynrlpitvplsshflslqntltpfshncfsLLYFQCRRRHVAAraksdngaelpshydfdlftigagsggvrasrfaanfgasvaicelpfstissettggvggtcvlrgcvpKKLLVYASKFshefdesngfgwkygtepqhdWSTLIANKNAELQRLTGIYKNILINAGITliegrgkivdphtvdvdgklySARHILIsvggrpfipdipgseyaidsdaaldlpskpekiaiVGGGYIALEFAGIFSGLTSEVHVFIRQKKVLRGFDEDIRDFVAEQMSlrgiefhteespqailkstdgslsvktnkgtvdgfshvmfatgrrpntknlgleKVGVKMtkngaievdeysgtavpsiwavgdvtdrinltpvALMEGGALAKTlfqaeptkpdysavpsavfsqppigqvglsEEQAIqeygdidvftanfrplkatlsglpdRIFMKLVLCAKTnkvlglhmcgedapEIVQGFAVAVKAGltkadfdatvgvhptaaEEFVtlrtptrkirksppsegmtgpevkaaagv
matsvttpkltttfynRLPITVPLSSHFLSLQNTLTPFSHNCFSLLYFQCRRRHVAARaksdngaelpshYDFDLFTIGAGSGGVRASRFAANFGASVAICELPFSTISSETTGGVGGTCVLRGCVPKKLLVYASKFSHEFDESNGFGWKYGTEPQHDWSTLIANKNAELQRLTGIYKNILINAGITLIEGRGKIVDPHTVDVDGKLYSARHILISVGGRPFIPDIPGSEYAIDSDAALDLPSKPEKIAIVGGGYIALEFAGIFSGLTSEVHVFIRQKKVLRGFDEDIRDFVAEQMSLRGIefhteespqailkstdgslsvkTNKGTVDGFshvmfatgrrpntknlglekvgVKMTKNGAIEVDEYSGTAVPSIWAVGDVTDRINLTPVALMEGGALAKTLFQAEPTKPDYSAVPSAVFSQPPIGQVGLSEEQAIQEYGDIDVFTANFRPLKATLSGLPDRIFMKLVLCAKTNKVLGLHMCGEDAPEIVQGFAVAVKAGLTKADFDATVGVhptaaeefvtlrtptrkirksppsegmtgpevkaaagv
MATSVTTPKLTTTFYNRLPITVPLSSHFLSLQNTLTPFSHNCFSLLYFQCRRRHVAARAKSDNGAELPSHYDFDLFTIGAGSGGVRASRFAANFGASVAICELPFSTISSETTGGVGGTCVLRGCVPKKLLVYASKFSHEFDESNGFGWKYGTEPQHDWSTLIANKNAELQRLTGIYKNILINAGITLIEGRGKIVDPHTVDVDGKLYSARHILISVGGRPFIPDIPGSEYAIDSDAALDLPSKPEKIAIVGGGYIALEFAGIFSGLTSEVHVFIRQKKVLRGFDEDIRDFVAEQMSLRGIEFHTEESPQAILKSTDGSLSVKTNKGTVDGFSHVMFATGRRPNTKNLGLEKVGVKMTKNGAIEVDEYSGTAVPSIWAVGDVTDRINLTPVALMEGGALAKTLFQAEPTKPDYSAVPSAVFSQPPIGQVGLSEEQAIQEYGDIDVFTANFRPLKATLSGLPDRIFMKLVLCAKTNKVLGLHMCGEDAPEIVQGFAVAVKAGLTKADFDATVGVHPTAAEEFVTLRTPTRKIRKSPPSEGMTGPEVKAAAGV
*********LTTTFYNRLPITVPLSSHFLSLQNTLTPFSHNCFSLLYFQCRRRHVAARAKSDNGAELPSHYDFDLFTIGAGSGGVRASRFAANFGASVAICELPFSTISSETTGGVGGTCVLRGCVPKKLLVYASKFSHEFDESNGFGWKYGTEPQHDWSTLIANKNAELQRLTGIYKNILINAGITLIEGRGKIVDPHTVDVDGKLYSARHILISVGGRPFIPDIPGSEYAIDSDAALDLPSKPEKIAIVGGGYIALEFAGIFSGLTSEVHVFIRQKKVLRGFDEDIRDFVAEQMSLRGIEFH***********************TVDGFSHVMFATGRRPNTKNLGLEKVGVKMTKNGAIEVDEYSGTAVPSIWAVGDVTDRINLTPVALMEGGALAKTLFQA*************VF****IGQVGLSEEQAIQEYGDIDVFTANFRPLKATLSGLPDRIFMKLVLCAKTNKVLGLHMCGEDAPEIVQGFAVAVKAGLTKADFDATVGVHPTAAEEFVTL***************************
***********************************************************************DFDLFTIGAGSGGVRASRFAANFGASVAICELPFSTISSETTGGVGGTCVLRGCVPKKLLVYASKFSHEFDESNGFGWKYGTEPQHDWSTLIANKNAELQRLTGIYKNILINAGITLIEGRGKIVDPHTVDVDGKLYSARHILISVGGRPFIPDIPGSEYAIDSDAALDLPSKPEKIAIVGGGYIALEFAGIFSGLTSEVHVFIRQKKVLRGFDEDIRDFVAEQMSLRGIEFHTEESPQAILKSTDGSLSVKTNKGTVDGFSHVMFATGRRPNTKNLGLEKVGVKMTKNGAIEVDEYSGTAVPSIWAVGDVTDRINLTPVALMEGGALAKTLFQAEPTKPDYSAVPSAVFSQPPIGQVGLSEEQAIQEYGDIDVFTANFRPLKATLSGLPDRIFMKLVLCAKTNKVLGLHMCGEDAPEIVQGFAVAVKAGLTKADFDATVGVHPTAAEEFVTLRTP************************
MATSVTTPKLTTTFYNRLPITVPLSSHFLSLQNTLTPFSHNCFSLLYFQCRRRHVAARAKSDNGAELPSHYDFDLFTIGAGSGGVRASRFAANFGASVAICELPFSTISSETTGGVGGTCVLRGCVPKKLLVYASKFSHEFDESNGFGWKYGTEPQHDWSTLIANKNAELQRLTGIYKNILINAGITLIEGRGKIVDPHTVDVDGKLYSARHILISVGGRPFIPDIPGSEYAIDSDAALDLPSKPEKIAIVGGGYIALEFAGIFSGLTSEVHVFIRQKKVLRGFDEDIRDFVAEQMSLRGIEFHTEESPQAILKSTDGSLSVKTNKGTVDGFSHVMFATGRRPNTKNLGLEKVGVKMTKNGAIEVDEYSGTAVPSIWAVGDVTDRINLTPVALMEGGALAKTLFQAEPTKPDYSAVPSAVFSQPPIGQVGLSEEQAIQEYGDIDVFTANFRPLKATLSGLPDRIFMKLVLCAKTNKVLGLHMCGEDAPEIVQGFAVAVKAGLTKADFDATVGVHPTAAEEFVTLRTPTRK*********************
****VTTPKLTTTFYNRLPITVPLSSHFLSLQNTLTPFSHNCFSLLYFQCRRRHVAAR*K*******PSHYDFDLFTIGAGSGGVRASRFAANFGASVAICELPFSTISSETTGGVGGTCVLRGCVPKKLLVYASKFSHEFDESNGFGWKYGTEPQHDWSTLIANKNAELQRLTGIYKNILINAGITLIEGRGKIVDPHTVDVDGKLYSARHILISVGGRPFIPDIPGSEYAIDSDAALDLPSKPEKIAIVGGGYIALEFAGIFSGLTSEVHVFIRQKKVLRGFDEDIRDFVAEQMSLRGIEFHTEESPQAILKSTDGSLSVKTNKGTVDGFSHVMFATGRRPNTKNLGLEKVGVKMTKNGAIEVDEYSGTAVPSIWAVGDVTDRINLTPVALMEGGALAKTLFQAEPTKPDYSAVPSAVFSQPPIGQVGLSEEQAIQEYGDIDVFTANFRPLKATLSGLPDRIFMKLVLCAKTNKVLGLHMCGEDAPEIVQGFAVAVKAGLTKADFDATVGVHPTAAEEFVTLRT*************************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MATSVTTPKLTTTFYNRLPITVPLSSHFLSLQNTLTPFSHNCFSLLYFQCRRRHVAARAKSDNGAELPSHYDFDLFTIGAGSGGVRASRFAANFGASVAICELPFSTISSETTGGVGGTCVLRGCVPKKLLVYASKFSHEFDESNGFGWKYGTEPQHDWSTLIANKNAELQRLTGIYKNILINAGITLIEGRGKIVDPHTVDVDGKLYSARHILISVGGRPFIPDIPGSEYAIDSDAALDLPSKPEKIAIVGGGYIALEFAGIFSGLTSEVHVFIRQKKVLRGFDEDIRDFVAEQMSLRGIEFHTEESPQAILKSTDGSLSVKTNKGTVDGFSHVMFATGRRPNTKNLGLEKVGVKMTKNGAIEVDEYSGTAVPSIWAVGDVTDRINLTPVALMEGGALAKTLFQAEPTKPDYSAVPSAVFSQPPIGQVGLSEEQAIQEYGDIDVFTANFRPLKATLSGLPDRIFMKLVLCAKTNKVLGLHMCGEDAPEIVQGFAVAVKAGLTKADFDATVGVHPTAAEEFVTLRTPTRKIRKSPPSEGMTGPEVKAAAGV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query551 2.2.26 [Sep-21-2011]
P80461557 Glutathione reductase, ch N/A no 0.996 0.985 0.801 0.0
P42770565 Glutathione reductase, ch yes no 0.911 0.888 0.825 0.0
P48640544 Glutathione reductase, ch yes no 0.907 0.919 0.844 0.0
P27456552 Glutathione reductase, ch N/A no 0.981 0.980 0.762 0.0
Q43621498 Glutathione reductase, cy N/A no 0.847 0.937 0.552 1e-146
Q43154489 Glutathione reductase, ch N/A no 0.838 0.944 0.550 1e-145
P48642496 Glutathione reductase, cy no no 0.849 0.943 0.540 1e-143
O04955502 Glutathione reductase, cy N/A no 0.836 0.918 0.532 1e-140
P48641499 Glutathione reductase, cy no no 0.845 0.933 0.524 1e-140
P23189451 Glutathione reductase OS= yes no 0.813 0.993 0.515 1e-127
>sp|P80461|GSHRP_TOBAC Glutathione reductase, chloroplastic (Fragment) OS=Nicotiana tabacum GN=GOR PE=1 SV=1 Back     alignment and function desciption
 Score =  914 bits (2363), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 447/558 (80%), Positives = 499/558 (89%), Gaps = 9/558 (1%)

Query: 2   ATSVTTPKLTTTFYNRLPITVPLSSHF--LSLQNTLTPF-----SHNCFSLLYFQC-RRR 53
           ATS++TPKL+TT  +    ++     F  LSL N + P      +H+  +     C RRR
Sbjct: 1   ATSLSTPKLSTTLSSPTLHSLLYKHKFSLLSLSNPIKPLHFNFLTHSRSTPSSLSCTRRR 60

Query: 54  HVAARAKSDNGAELPSHYDFDLFTIGAGSGGVRASRFAANFGASVAICELPFSTISSETT 113
             A RA+S NGA+ P HYDFDLFTIGAGSGGVRASRFA+NFGASVA+CELPFSTISS++T
Sbjct: 61  FTAPRAESSNGADAPRHYDFDLFTIGAGSGGVRASRFASNFGASVAVCELPFSTISSDST 120

Query: 114 GGVGGTCVLRGCVPKKLLVYASKFSHEFDESNGFGWKYGTEPQHDWSTLIANKNAELQRL 173
           GGVGGTCVLRGCVPKKLLVYASK+SHEF+ES GFGW Y  EP+ DWSTLIANKNAELQRL
Sbjct: 121 GGVGGTCVLRGCVPKKLLVYASKYSHEFEESCGFGWNYDVEPRFDWSTLIANKNAELQRL 180

Query: 174 TGIYKNILINAGITLIEGRGKIVDPHTVDVDGKLYSARHILISVGGRPFIPDIPGSEYAI 233
           TGIYKNIL NAG+TLIEGRGK+VDPHTVDVDGKLYSA++ILISVGGRPFIPDIPGSEYAI
Sbjct: 181 TGIYKNILKNAGVTLIEGRGKVVDPHTVDVDGKLYSAKNILISVGGRPFIPDIPGSEYAI 240

Query: 234 DSDAALDLPSKPEKIAIVGGGYIALEFAGIFSGLTSEVHVFIRQKKVLRGFDEDIRDFVA 293
           DSDAALDLP+KP KIAIVGGGYIALEFAGIF+GL SEVHVFIRQKKVLRGFDE+IRDFV 
Sbjct: 241 DSDAALDLPTKPNKIAIVGGGYIALEFAGIFNGLKSEVHVFIRQKKVLRGFDEEIRDFVG 300

Query: 294 EQMSLRGIEFHTEESPQAILKSTDGSLSVKTNKGTVDGFSHVMFATGRRPNTKNLGLEKV 353
           EQMSLRGIEFHTEESPQAI+KS DGSLS+KT++GTV+GFSH+MFATGRRPNTKNLGLE V
Sbjct: 301 EQMSLRGIEFHTEESPQAIVKSADGSLSLKTSRGTVEGFSHIMFATGRRPNTKNLGLETV 360

Query: 354 GVKMTKNGAIEVDEYSGTAVPSIWAVGDVTDRINLTPVALMEGGALAKTLFQAEPTKPDY 413
           GVKMTKNGAIEVDEYS T+VPSIWAVGDVTDRINLTPVALMEGGALAKT+F  EPTKPDY
Sbjct: 361 GVKMTKNGAIEVDEYSRTSVPSIWAVGDVTDRINLTPVALMEGGALAKTIFAHEPTKPDY 420

Query: 414 SAVPSAVFSQPPIGQVGLSEEQAIQEYGDIDVFTANFRPLKATLSGLPDRIFMKLVLCAK 473
             VP+AVFSQPPIGQVGL EEQAI+E+GD+DV+TANFRPLKAT+SGLPDR+FMKL++CAK
Sbjct: 421 RNVPAAVFSQPPIGQVGLMEEQAIKEFGDVDVYTANFRPLKATISGLPDRVFMKLIVCAK 480

Query: 474 TNKVLGLHMCGEDAPEIVQGFAVAVKAGLTKADFDATVGVHPTAAEEFVTLRTPTRKIRK 533
           T+KVLGLHMCG+DAPEIVQGFA+AVKAGLTKADFDATVG+HPT+AEEFVT+RTPTRK+R 
Sbjct: 481 TSKVLGLHMCGDDAPEIVQGFAIAVKAGLTKADFDATVGIHPTSAEEFVTMRTPTRKVRS 540

Query: 534 SPPSEGMTGPEVKAAAGV 551
           S PSEG    ++KAAAGV
Sbjct: 541 S-PSEGKAEHDIKAAAGV 557
Maintains high levels of reduced glutathione in the chloroplast.
Nicotiana tabacum (taxid: 4097)
EC: 1EC: .EC: 8EC: .EC: 1EC: .EC: 7
>sp|P42770|GSHRP_ARATH Glutathione reductase, chloroplastic OS=Arabidopsis thaliana GN=EMB2360 PE=2 SV=1 Back     alignment and function description
>sp|P48640|GSHRP_SOYBN Glutathione reductase, chloroplastic OS=Glycine max GN=GR PE=2 SV=1 Back     alignment and function description
>sp|P27456|GSHRP_PEA Glutathione reductase, chloroplastic/mitochondrial OS=Pisum sativum GN=GR PE=2 SV=1 Back     alignment and function description
>sp|Q43621|GSHRC_PEA Glutathione reductase, cytosolic OS=Pisum sativum PE=2 SV=1 Back     alignment and function description
>sp|Q43154|GSHRP_SPIOL Glutathione reductase, chloroplastic (Fragment) OS=Spinacia oleracea PE=2 SV=1 Back     alignment and function description
>sp|P48642|GSHRC_ORYSJ Glutathione reductase, cytosolic OS=Oryza sativa subsp. japonica GN=GRC2 PE=2 SV=2 Back     alignment and function description
>sp|O04955|GSHRC_BRARP Glutathione reductase, cytosolic OS=Brassica rapa subsp. pekinensis GN=GR1 PE=2 SV=2 Back     alignment and function description
>sp|P48641|GSHRC_ARATH Glutathione reductase, cytosolic OS=Arabidopsis thaliana GN=At3g24170 PE=2 SV=1 Back     alignment and function description
>sp|P23189|GSHR_PSEAE Glutathione reductase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=gor PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query551
405794587553 glutathione reductase [Dimocarpus longan 1.0 0.996 0.882 0.0
393757299553 glutathione reductase [Dimocarpus longan 1.0 0.996 0.878 0.0
224133228561 glutathione reductase [Populus trichocar 0.981 0.964 0.807 0.0
255559935560 glutathione reductase, putative [Ricinus 0.992 0.976 0.818 0.0
225437227559 PREDICTED: glutathione reductase, chloro 0.992 0.978 0.819 0.0
2425107565 glutathione reductase (NADPH) [Vitis vin 0.994 0.969 0.820 0.0
147784400559 hypothetical protein VITISV_014813 [Viti 0.996 0.982 0.820 0.0
1708059557 RecName: Full=Glutathione reductase, chl 0.996 0.985 0.801 0.0
350536365557 chloroplast glutathione reductase [Solan 0.998 0.987 0.797 0.0
449458430551 PREDICTED: glutathione reductase, chloro 0.981 0.981 0.796 0.0
>gi|405794587|gb|AFS30566.1| glutathione reductase [Dimocarpus longan] Back     alignment and taxonomy information
 Score =  971 bits (2511), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 488/553 (88%), Positives = 516/553 (93%), Gaps = 2/553 (0%)

Query: 1   MATSVTTPKLTTTFYNRLPITVPLSSHFLSLQNTLTPFSH--NCFSLLYFQCRRRHVAAR 58
           MAT +TTP+LTTTFY +LP+ VPL  HFLSL  TL+  SH     S  ++  +RRH A R
Sbjct: 1   MATPLTTPRLTTTFYKKLPLPVPLCPHFLSLPKTLSFPSHIPRSLSHYHYHHQRRHFAVR 60

Query: 59  AKSDNGAELPSHYDFDLFTIGAGSGGVRASRFAANFGASVAICELPFSTISSETTGGVGG 118
           A SDNGAE   +YDFDLFTIGAGSGGVRASRFAANFGASVA+CELPFSTISSET GGVGG
Sbjct: 61  ADSDNGAERARNYDFDLFTIGAGSGGVRASRFAANFGASVAVCELPFSTISSETAGGVGG 120

Query: 119 TCVLRGCVPKKLLVYASKFSHEFDESNGFGWKYGTEPQHDWSTLIANKNAELQRLTGIYK 178
           TCVLRGCVPKKLLVYASKFSHEFDESNGFGWKY TEPQHDWSTLIANKNAEL+RLTGIYK
Sbjct: 121 TCVLRGCVPKKLLVYASKFSHEFDESNGFGWKYETEPQHDWSTLIANKNAELKRLTGIYK 180

Query: 179 NILINAGITLIEGRGKIVDPHTVDVDGKLYSARHILISVGGRPFIPDIPGSEYAIDSDAA 238
           NIL NAG+TLIEGRGKIVDPHTVDVDGKLYSARHILISVGGRPFIPDIPGSEYAIDSD A
Sbjct: 181 NILNNAGVTLIEGRGKIVDPHTVDVDGKLYSARHILISVGGRPFIPDIPGSEYAIDSDVA 240

Query: 239 LDLPSKPEKIAIVGGGYIALEFAGIFSGLTSEVHVFIRQKKVLRGFDEDIRDFVAEQMSL 298
           LDLPSKPEKIAIVGGGYIALEFAGIF+GL SEVHVFIRQKKVLRGFDE+IRDFV+EQMSL
Sbjct: 241 LDLPSKPEKIAIVGGGYIALEFAGIFNGLESEVHVFIRQKKVLRGFDEEIRDFVSEQMSL 300

Query: 299 RGIEFHTEESPQAILKSTDGSLSVKTNKGTVDGFSHVMFATGRRPNTKNLGLEKVGVKMT 358
           RGIEFHTEESPQAILKS DGSLS+KTNKGTVDGFSH+MFATGRRPNTKNLGLE +GVKM 
Sbjct: 301 RGIEFHTEESPQAILKSGDGSLSLKTNKGTVDGFSHIMFATGRRPNTKNLGLESMGVKMD 360

Query: 359 KNGAIEVDEYSGTAVPSIWAVGDVTDRINLTPVALMEGGALAKTLFQAEPTKPDYSAVPS 418
           KNGAIEVDEYS T+VPSIWAVGDVTDRINLTPVALMEGGALAKTLFQ +PTKP+Y AVPS
Sbjct: 361 KNGAIEVDEYSRTSVPSIWAVGDVTDRINLTPVALMEGGALAKTLFQDQPTKPNYRAVPS 420

Query: 419 AVFSQPPIGQVGLSEEQAIQEYGDIDVFTANFRPLKATLSGLPDRIFMKLVLCAKTNKVL 478
           AVFSQPPIGQVGLSEEQAIQ+YGDIDVFTANFRPLKATLSGLPDR+FMKL++CAKTNKVL
Sbjct: 421 AVFSQPPIGQVGLSEEQAIQQYGDIDVFTANFRPLKATLSGLPDRVFMKLIVCAKTNKVL 480

Query: 479 GLHMCGEDAPEIVQGFAVAVKAGLTKADFDATVGVHPTAAEEFVTLRTPTRKIRKSPPSE 538
           GLHMCGEDAPEIVQGFAVAVKAGLTKADFDATVG+HPTAAEEFVT+RTPTRKIR+ PPSE
Sbjct: 481 GLHMCGEDAPEIVQGFAVAVKAGLTKADFDATVGIHPTAAEEFVTMRTPTRKIRQDPPSE 540

Query: 539 GMTGPEVKAAAGV 551
           GMT PEVKAAAGV
Sbjct: 541 GMTDPEVKAAAGV 553

Source: Dimocarpus longan

Species: Dimocarpus longan

Genus: Dimocarpus

Family: Sapindaceae

Order: Sapindales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|393757299|gb|AFF18772.2| glutathione reductase [Dimocarpus longan] Back     alignment and taxonomy information
>gi|224133228|ref|XP_002321515.1| glutathione reductase [Populus trichocarpa] gi|222868511|gb|EEF05642.1| glutathione reductase [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255559935|ref|XP_002520986.1| glutathione reductase, putative [Ricinus communis] gi|223539823|gb|EEF41403.1| glutathione reductase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|225437227|ref|XP_002281935.1| PREDICTED: glutathione reductase, chloroplastic isoform 1 [Vitis vinifera] gi|359479601|ref|XP_003632299.1| PREDICTED: glutathione reductase, chloroplastic isoform 2 [Vitis vinifera] gi|297735497|emb|CBI17937.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|2425107|gb|AAB70837.1| glutathione reductase (NADPH) [Vitis vinifera] Back     alignment and taxonomy information
>gi|147784400|emb|CAN66042.1| hypothetical protein VITISV_014813 [Vitis vinifera] Back     alignment and taxonomy information
>gi|1708059|sp|P80461.1|GSHRP_TOBAC RecName: Full=Glutathione reductase, chloroplastic; Short=GR; Short=GRase; Flags: Precursor gi|431955|emb|CAA53925.1| glutathione reductase (NADPH) [Nicotiana tabacum] Back     alignment and taxonomy information
>gi|350536365|ref|NP_001234243.1| chloroplast glutathione reductase [Solanum lycopersicum] gi|314951945|gb|ABZ10803.2| chloroplast glutathione reductase [Solanum lycopersicum] Back     alignment and taxonomy information
>gi|449458430|ref|XP_004146950.1| PREDICTED: glutathione reductase, chloroplastic-like [Cucumis sativus] gi|449517205|ref|XP_004165636.1| PREDICTED: glutathione reductase, chloroplastic-like [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query551
TAIR|locus:2102410565 GR "AT3G54660" [Arabidopsis th 0.987 0.962 0.781 1.9e-234
TAIR|locus:2093691499 GR1 "glutathione-disulfide red 0.845 0.933 0.524 2.8e-128
UNIPROTKB|Q48JF8452 gor "Glutathione-disulfide red 0.814 0.993 0.509 9.8e-119
TIGR_CMR|SPO_1328452 SPO_1328 "glutathione-disulfid 0.807 0.984 0.467 2.5e-106
TIGR_CMR|CPS_4984454 CPS_4984 "glutathione reductas 0.802 0.973 0.426 5.5e-93
UNIPROTKB|P06715450 gor "glutathione reductase (NA 0.805 0.986 0.419 3e-92
TIGR_CMR|SO_4702451 SO_4702 "glutathione reductase 0.798 0.975 0.406 9.9e-87
UNIPROTKB|Q9KVG0454 VC0186 "Glutathione reductase" 0.796 0.966 0.400 2.6e-86
TIGR_CMR|VC_0186454 VC_0186 "glutathione reductase 0.796 0.966 0.400 2.6e-86
WB|WBGene00008117473 gsr-1 [Caenorhabditis elegans 0.803 0.936 0.396 8.9e-86
TAIR|locus:2102410 GR "AT3G54660" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 2234 (791.5 bits), Expect = 1.9e-234, Sum P(2) = 1.9e-234
 Identities = 436/558 (78%), Positives = 484/558 (86%)

Query:     4 SVTTPKLTTTFYNRLPITVPL----SSHFLSLQNTLTP-FS-HNCFSLL----YFQCRRR 53
             S ++P L      +LPI + L    SS FLSL  TLT  +S     +LL    Y+  RR 
Sbjct:    12 SSSSPSLQF-LCKKLPIAIHLPSSSSSSFLSLPKTLTSLYSLRPRIALLSNHRYYHSRRF 70

Query:    54 HVAARAKSDNGAELPSHYDFDLFTIGAGSGGVRASRFAANFGASVAICELPFSTISSETT 113
              V A   +DNGAE   HYDFDLFTIGAGSGGVRASRFA +FGAS A+CELPFSTISS+T 
Sbjct:    71 SVCA--STDNGAESDRHYDFDLFTIGAGSGGVRASRFATSFGASAAVCELPFSTISSDTA 128

Query:   114 GGVGGTCVLRGCVPKKLLVYASKFSHEFDESNGFGWKYGTEPQHDWSTLIANKNAELQRL 173
             GGVGGTCVLRGCVPKKLLVYASK+SHEF++S+GFGWKY TEP HDW+TLIANKNAELQRL
Sbjct:   129 GGVGGTCVLRGCVPKKLLVYASKYSHEFEDSHGFGWKYETEPSHDWTTLIANKNAELQRL 188

Query:   174 TGIYKNILINAGITLIEGRGKIVDPHTVDVDGKLYSARHILISVGGRPFIPDIPGSEYAI 233
             TGIYKNIL  A + LIEGRGK++DPHTVDVDGK+Y+ R+ILI+VGGRPFIPDIPG E+AI
Sbjct:   189 TGIYKNILSKANVKLIEGRGKVIDPHTVDVDGKIYTTRNILIAVGGRPFIPDIPGKEFAI 248

Query:   234 DSDAALDLPSKPEKIAIVGGGYIALEFAGIFSGLTSEVHVFIRQKKVLRGFDEDIRDFVA 293
             DSDAALDLPSKP+KIAIVGGGYIALEFAGIF+GL  EVHVFIRQKKVLRGFDED+RDFV 
Sbjct:   249 DSDAALDLPSKPKKIAIVGGGYIALEFAGIFNGLNCEVHVFIRQKKVLRGFDEDVRDFVG 308

Query:   294 EQMSLRGIEFHTEESPQAILKSTDGSLSVKTNKGTVDGFSHVMFATGRRPNTKNLGLEKV 353
             EQMSLRGIEFHTEESP+AI+K+ DGS S+KT+KGTV+GFSHVMFATGR+PNTKNLGLE V
Sbjct:   309 EQMSLRGIEFHTEESPEAIIKAGDGSFSLKTSKGTVEGFSHVMFATGRKPNTKNLGLENV 368

Query:   354 GVKMTKNGAIEVDEYSGTAVPSIWAVGDVTDRINLTPVALMEGGALAKTLFQAEPTKPDY 413
             GVKM KNGAIEVDEYS T+VPSIWAVGDVTDRINLTPVALMEGGALAKTLFQ EPTKPDY
Sbjct:   369 GVKMAKNGAIEVDEYSQTSVPSIWAVGDVTDRINLTPVALMEGGALAKTLFQNEPTKPDY 428

Query:   414 SAVPSAVFSQPPIGQVGLSEEQAIQEYGDIDVFTANFRPLKATLSGLPDRIFMKLVLCAK 473
              AVP AVFSQPPIG VGL+EEQAI++YGD+DV+T+NFRPLKATLSGLPDR+FMKL++CA 
Sbjct:   429 RAVPCAVFSQPPIGTVGLTEEQAIEQYGDVDVYTSNFRPLKATLSGLPDRVFMKLIVCAN 488

Query:   474 TNKVLGLHMCGEDAPEIVQGFAVAVKAGLTKADFDATVGVHPTAAEEFVTLRTPTRKIRK 533
             TNKVLG+HMCGED+PEI+QGF VAVKAGLTKADFDATVGVHPTAAEEFVT+R PTRK RK
Sbjct:   489 TNKVLGVHMCGEDSPEIIQGFGVAVKAGLTKADFDATVGVHPTAAEEFVTMRAPTRKFRK 548

Query:   534 SPPSEGMTGPEVKAAAGV 551
                SEG   PE K AAGV
Sbjct:   549 DS-SEGKASPEAKTAAGV 565
GO:0004362 "glutathione-disulfide reductase activity" evidence=IEA;ISS;IDA
GO:0006749 "glutathione metabolic process" evidence=IEA;IDA
GO:0009055 "electron carrier activity" evidence=IEA
GO:0009507 "chloroplast" evidence=ISM;ISS;IDA
GO:0016491 "oxidoreductase activity" evidence=IEA
GO:0016668 "oxidoreductase activity, acting on a sulfur group of donors, NAD(P) as acceptor" evidence=IEA
GO:0045454 "cell redox homeostasis" evidence=IEA
GO:0050660 "flavin adenine dinucleotide binding" evidence=IEA
GO:0050661 "NADP binding" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0005739 "mitochondrion" evidence=IDA
GO:0009570 "chloroplast stroma" evidence=IDA
GO:0005524 "ATP binding" evidence=IDA
GO:0005507 "copper ion binding" evidence=IDA
GO:0006626 "protein targeting to mitochondrion" evidence=RCA
GO:0009407 "toxin catabolic process" evidence=RCA
GO:0009658 "chloroplast organization" evidence=RCA
GO:0048481 "ovule development" evidence=RCA
TAIR|locus:2093691 GR1 "glutathione-disulfide reductase" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q48JF8 gor "Glutathione-disulfide reductase" [Pseudomonas syringae pv. phaseolicola 1448A (taxid:264730)] Back     alignment and assigned GO terms
TIGR_CMR|SPO_1328 SPO_1328 "glutathione-disulfide reductase" [Ruegeria pomeroyi DSS-3 (taxid:246200)] Back     alignment and assigned GO terms
TIGR_CMR|CPS_4984 CPS_4984 "glutathione reductase" [Colwellia psychrerythraea 34H (taxid:167879)] Back     alignment and assigned GO terms
UNIPROTKB|P06715 gor "glutathione reductase (NADPH)" [Escherichia coli K-12 (taxid:83333)] Back     alignment and assigned GO terms
TIGR_CMR|SO_4702 SO_4702 "glutathione reductase" [Shewanella oneidensis MR-1 (taxid:211586)] Back     alignment and assigned GO terms
UNIPROTKB|Q9KVG0 VC0186 "Glutathione reductase" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)] Back     alignment and assigned GO terms
TIGR_CMR|VC_0186 VC_0186 "glutathione reductase" [Vibrio cholerae O1 biovar El Tor (taxid:686)] Back     alignment and assigned GO terms
WB|WBGene00008117 gsr-1 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P80461GSHRP_TOBAC1, ., 8, ., 1, ., 70.80100.99630.9856N/Ano
P42770GSHRP_ARATH1, ., 8, ., 1, ., 70.82570.91100.8884yesno
Q43621GSHRC_PEA1, ., 8, ., 1, ., 70.55270.84750.9377N/Ano
Q8T137GSHR_DICDI1, ., 8, ., 1, ., 70.38810.81300.9634yesno
Q74ZK4GSHR_ASHGO1, ., 8, ., 1, ., 70.38180.83840.9625yesno
P48640GSHRP_SOYBN1, ., 8, ., 1, ., 70.84460.90740.9191yesno
P27456GSHRP_PEA1, ., 8, ., 1, ., 70.76260.98180.9800N/Ano
Q6C5H4GSHR_YARLI1, ., 8, ., 1, ., 70.38500.81120.9510yesno
Q43154GSHRP_SPIOL1, ., 8, ., 1, ., 70.55010.83840.9447N/Ano
Q6FRV2GSHR_CANGA1, ., 8, ., 1, ., 70.38860.81120.9390yesno
P78965GSHR_SCHPO1, ., 8, ., 1, ., 70.40.80390.9547yesno
P48639GSHR_BURCE1, ., 8, ., 1, ., 70.50100.80390.9866N/Ano
P48638GSHR_NOSS11, ., 8, ., 1, ., 70.46280.80030.9607yesno
Q5NVA2TRXR1_PONAB1, ., 8, ., 1, ., 90.38440.84210.9298yesno
O04955GSHRC_BRARP1, ., 8, ., 1, ., 70.53200.83660.9183N/Ano
P47791GSHR_MOUSE1, ., 8, ., 1, ., 70.39240.81120.894yesno
P23189GSHR_PSEAE1, ., 8, ., 1, ., 70.51520.81300.9933yesno
P41921GSHR_YEAST1, ., 8, ., 1, ., 70.36580.82570.9420yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
4th Layer1.8.1.70.979
3rd Layer1.8.10.983

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
PtrcGR1
glutathione reductase (EC-1.8.1.7) (562 aa)
(Populus trichocarpa)
Predicted Functional Partners:
gw1.I.2970.1
hypothetical protein (547 aa)
     •• 0.901
gw1.145.154.1
hypothetical protein (564 aa)
     •• 0.901
fgenesh4_pg.C_LG_V000227
hypothetical protein (624 aa)
     •• 0.900
gw1.XI.3695.1
hypothetical protein (213 aa)
     •  0.899
gw1.X.4735.1
hypothetical protein (207 aa)
     •  0.899
gw1.VIII.2694.1
hypothetical protein (225 aa)
     •  0.899
gw1.28.365.1
hypothetical protein (220 aa)
     •  0.899
gw1.13302.2.1
annotation not avaliable (135 aa)
     •  0.899
grail3.0104000601
SubName- Full=Putative uncharacterized protein; (213 aa)
     •  0.899
grail3.0044011201
hypothetical protein (214 aa)
     •  0.899

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query551
PLN02546558 PLN02546, PLN02546, glutathione reductase 0.0
PRK06116450 PRK06116, PRK06116, glutathione reductase; Validat 0.0
PLN02507499 PLN02507, PLN02507, glutathione reductase 0.0
TIGR01424446 TIGR01424, gluta_reduc_2, glutathione-disulfide re 0.0
COG1249454 COG1249, Lpd, Pyruvate/2-oxoglutarate dehydrogenas 1e-150
TIGR01421450 TIGR01421, gluta_reduc_1, glutathione-disulfide re 1e-146
TIGR01438484 TIGR01438, TGR, thioredoxin and glutathione reduct 1e-119
TIGR01423486 TIGR01423, trypano_reduc, trypanothione-disulfide 1e-119
PRK06292460 PRK06292, PRK06292, dihydrolipoamide dehydrogenase 1e-110
PTZ00058561 PTZ00058, PTZ00058, glutathione reductase; Provisi 1e-103
TIGR01350460 TIGR01350, lipoamide_DH, dihydrolipoamide dehydrog 1e-100
PTZ00052499 PTZ00052, PTZ00052, thioredoxin reductase; Provisi 2e-99
TIGR02053463 TIGR02053, MerA, mercuric reductase 4e-93
PRK06370463 PRK06370, PRK06370, mercuric reductase; Validated 4e-93
PRK06416462 PRK06416, PRK06416, dihydrolipoamide dehydrogenase 7e-93
PRK07846451 PRK07846, PRK07846, mycothione reductase; Reviewed 4e-73
PRK05976472 PRK05976, PRK05976, dihydrolipoamide dehydrogenase 4e-69
PRK06327475 PRK06327, PRK06327, dihydrolipoamide dehydrogenase 2e-67
TIGR03452452 TIGR03452, mycothione_red, mycothione reductase 8e-65
pfam07992283 pfam07992, Pyr_redox_2, Pyridine nucleotide-disulp 8e-64
PRK07251438 PRK07251, PRK07251, pyridine nucleotide-disulfide 8e-61
PRK06467471 PRK06467, PRK06467, dihydrolipoamide dehydrogenase 1e-58
PRK06912458 PRK06912, acoL, dihydrolipoamide dehydrogenase; Va 2e-56
PRK05249461 PRK05249, PRK05249, soluble pyridine nucleotide tr 5e-55
PRK14694468 PRK14694, PRK14694, putative mercuric reductase; P 5e-55
PRK07818466 PRK07818, PRK07818, dihydrolipoamide dehydrogenase 3e-54
PRK13748561 PRK13748, PRK13748, putative mercuric reductase; P 7e-52
PRK14727479 PRK14727, PRK14727, putative mercuric reductase; P 9e-50
PRK08010441 PRK08010, PRK08010, pyridine nucleotide-disulfide 1e-46
PRK07845466 PRK07845, PRK07845, flavoprotein disulfide reducta 3e-46
PRK06115466 PRK06115, PRK06115, dihydrolipoamide dehydrogenase 3e-44
pfam02852110 pfam02852, Pyr_redox_dim, Pyridine nucleotide-disu 7e-41
PTZ00153659 PTZ00153, PTZ00153, lipoamide dehydrogenase; Provi 2e-39
PRK09564444 PRK09564, PRK09564, coenzyme A disulfide reductase 7e-28
TIGR03385427 TIGR03385, CoA_CoA_reduc, CoA-disulfide reductase 1e-26
pfam0007082 pfam00070, Pyr_redox, Pyridine nucleotide-disulphi 1e-21
COG0446415 COG0446, HcaD, Uncharacterized NAD(FAD)-dependent 4e-20
COG0492305 COG0492, TrxB, Thioredoxin reductase [Posttranslat 3e-17
COG1251 793 COG1251, NirB, NAD(P)H-nitrite reductase [Energy p 5e-14
TIGR02374 785 TIGR02374, nitri_red_nirB, nitrite reductase [NAD( 1e-12
TIGR01292299 TIGR01292, TRX_reduct, thioredoxin-disulfide reduc 3e-12
COG1252405 COG1252, Ndh, NADH dehydrogenase, FAD-containing s 7e-12
PRK13512438 PRK13512, PRK13512, coenzyme A disulfide reductase 5e-11
PRK04965377 PRK04965, PRK04965, NADH:flavorubredoxin oxidoredu 4e-09
TIGR03169364 TIGR03169, Nterm_to_SelD, pyridine nucleotide-disu 4e-09
PRK14989 847 PRK14989, PRK14989, nitrite reductase subunit NirD 2e-08
TIGR01316449 TIGR01316, gltA, glutamate synthase (NADPH), homot 2e-08
PTZ00318424 PTZ00318, PTZ00318, NADH dehydrogenase-like protei 3e-07
TIGR03140515 TIGR03140, AhpF, alkyl hydroperoxide reductase sub 3e-05
pfam13434335 pfam13434, K_oxygenase, L-lysine 6-monooxygenase ( 6e-05
COG3634520 COG3634, AhpF, Alkyl hydroperoxide reductase, larg 2e-04
COG3486436 COG3486, IucD, Lysine/ornithine N-monooxygenase [S 3e-04
PRK11749457 PRK11749, PRK11749, dihydropyrimidine dehydrogenas 6e-04
PRK12770352 PRK12770, PRK12770, putative glutamate synthase su 7e-04
PRK10262321 PRK10262, PRK10262, thioredoxin reductase; Provisi 0.003
PRK09754396 PRK09754, PRK09754, phenylpropionate dioxygenase f 0.004
>gnl|CDD|215301 PLN02546, PLN02546, glutathione reductase Back     alignment and domain information 
 Score = 1041 bits (2694), Expect = 0.0
 Identities = 459/559 (82%), Positives = 499/559 (89%), Gaps = 12/559 (2%)

Query: 2   ATSVTTPKLTT-----TFYNRLPITVPL----SSHFLSLQNTLTPFSHNCFSLLYFQCRR 52
           AT  +T KLT+     T Y +LP+ +PL    SS  L L  TLT  S            R
Sbjct: 3   ATLPSTSKLTSSPSLQTLYRKLPLRLPLPSSSSSSHLPLPKTLTRLSSPRPLSH---HHR 59

Query: 53  RHVAARAKSDNGAELPSHYDFDLFTIGAGSGGVRASRFAANFGASVAICELPFSTISSET 112
           R   +RA + NGAE   HYDFDLFTIGAGSGGVRASRFA+NFGAS A+CELPF+TISS+T
Sbjct: 60  RRSVSRAAAPNGAESERHYDFDLFTIGAGSGGVRASRFASNFGASAAVCELPFATISSDT 119

Query: 113 TGGVGGTCVLRGCVPKKLLVYASKFSHEFDESNGFGWKYGTEPQHDWSTLIANKNAELQR 172
            GGVGGTCVLRGCVPKKLLVYASK+SHEF+ES GFGWKY TEP+HDW+TLIANKNAELQR
Sbjct: 120 LGGVGGTCVLRGCVPKKLLVYASKYSHEFEESRGFGWKYETEPKHDWNTLIANKNAELQR 179

Query: 173 LTGIYKNILINAGITLIEGRGKIVDPHTVDVDGKLYSARHILISVGGRPFIPDIPGSEYA 232
           LTGIYKNIL NAG+TLIEGRGKIVDPHTVDVDGKLY+AR+ILI+VGGRPFIPDIPG E+A
Sbjct: 180 LTGIYKNILKNAGVTLIEGRGKIVDPHTVDVDGKLYTARNILIAVGGRPFIPDIPGIEHA 239

Query: 233 IDSDAALDLPSKPEKIAIVGGGYIALEFAGIFSGLTSEVHVFIRQKKVLRGFDEDIRDFV 292
           IDSDAALDLPSKPEKIAIVGGGYIALEFAGIF+GL S+VHVFIRQKKVLRGFDE++RDFV
Sbjct: 240 IDSDAALDLPSKPEKIAIVGGGYIALEFAGIFNGLKSDVHVFIRQKKVLRGFDEEVRDFV 299

Query: 293 AEQMSLRGIEFHTEESPQAILKSTDGSLSVKTNKGTVDGFSHVMFATGRRPNTKNLGLEK 352
           AEQMSLRGIEFHTEESPQAI+KS DGSLS+KTNKGTV+GFSHVMFATGR+PNTKNLGLE+
Sbjct: 300 AEQMSLRGIEFHTEESPQAIIKSADGSLSLKTNKGTVEGFSHVMFATGRKPNTKNLGLEE 359

Query: 353 VGVKMTKNGAIEVDEYSGTAVPSIWAVGDVTDRINLTPVALMEGGALAKTLFQAEPTKPD 412
           VGVKM KNGAIEVDEYS T+VPSIWAVGDVTDRINLTPVALMEGGALAKTLF  EPTKPD
Sbjct: 360 VGVKMDKNGAIEVDEYSRTSVPSIWAVGDVTDRINLTPVALMEGGALAKTLFGNEPTKPD 419

Query: 413 YSAVPSAVFSQPPIGQVGLSEEQAIQEYGDIDVFTANFRPLKATLSGLPDRIFMKLVLCA 472
           Y AVPSAVFSQPPIGQVGL+EEQAI+EYGD+DVFTANFRPLKATLSGLPDR+FMKL++CA
Sbjct: 420 YRAVPSAVFSQPPIGQVGLTEEQAIEEYGDVDVFTANFRPLKATLSGLPDRVFMKLIVCA 479

Query: 473 KTNKVLGLHMCGEDAPEIVQGFAVAVKAGLTKADFDATVGVHPTAAEEFVTLRTPTRKIR 532
           KTNKVLG+HMCGEDAPEI+QGFAVAVKAGLTKADFDATVG+HPTAAEEFVT+RTPTRKIR
Sbjct: 480 KTNKVLGVHMCGEDAPEIIQGFAVAVKAGLTKADFDATVGIHPTAAEEFVTMRTPTRKIR 539

Query: 533 KSPPSEGMTGPEVKAAAGV 551
           K  PSEG T  EVKAAAGV
Sbjct: 540 KDSPSEGKTKDEVKAAAGV 558

Length = 558
>gnl|CDD|235701 PRK06116, PRK06116, glutathione reductase; Validated Back     alignment and domain information
>gnl|CDD|215281 PLN02507, PLN02507, glutathione reductase Back     alignment and domain information
>gnl|CDD|213618 TIGR01424, gluta_reduc_2, glutathione-disulfide reductase, plant Back     alignment and domain information
>gnl|CDD|224169 COG1249, Lpd, Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|130488 TIGR01421, gluta_reduc_1, glutathione-disulfide reductase, animal/bacterial Back     alignment and domain information
>gnl|CDD|233412 TIGR01438, TGR, thioredoxin and glutathione reductase selenoprotein Back     alignment and domain information
>gnl|CDD|200098 TIGR01423, trypano_reduc, trypanothione-disulfide reductase Back     alignment and domain information
>gnl|CDD|235774 PRK06292, PRK06292, dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|185420 PTZ00058, PTZ00058, glutathione reductase; Provisional Back     alignment and domain information
>gnl|CDD|233368 TIGR01350, lipoamide_DH, dihydrolipoamide dehydrogenase Back     alignment and domain information
>gnl|CDD|185416 PTZ00052, PTZ00052, thioredoxin reductase; Provisional Back     alignment and domain information
>gnl|CDD|233700 TIGR02053, MerA, mercuric reductase Back     alignment and domain information
>gnl|CDD|235787 PRK06370, PRK06370, mercuric reductase; Validated Back     alignment and domain information
>gnl|CDD|235798 PRK06416, PRK06416, dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|181142 PRK07846, PRK07846, mycothione reductase; Reviewed Back     alignment and domain information
>gnl|CDD|235660 PRK05976, PRK05976, dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|235779 PRK06327, PRK06327, dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|132493 TIGR03452, mycothione_red, mycothione reductase Back     alignment and domain information
>gnl|CDD|219686 pfam07992, Pyr_redox_2, Pyridine nucleotide-disulphide oxidoreductase Back     alignment and domain information
>gnl|CDD|180907 PRK07251, PRK07251, pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|180579 PRK06467, PRK06467, dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|180743 PRK06912, acoL, dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|235373 PRK05249, PRK05249, soluble pyridine nucleotide transhydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|237790 PRK14694, PRK14694, putative mercuric reductase; Provisional Back     alignment and domain information
>gnl|CDD|236106 PRK07818, PRK07818, dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|184298 PRK13748, PRK13748, putative mercuric reductase; Provisional Back     alignment and domain information
>gnl|CDD|237806 PRK14727, PRK14727, putative mercuric reductase; Provisional Back     alignment and domain information
>gnl|CDD|181196 PRK08010, PRK08010, pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|236112 PRK07845, PRK07845, flavoprotein disulfide reductase; Reviewed Back     alignment and domain information
>gnl|CDD|180409 PRK06115, PRK06115, dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|217252 pfam02852, Pyr_redox_dim, Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain Back     alignment and domain information
>gnl|CDD|173442 PTZ00153, PTZ00153, lipoamide dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181958 PRK09564, PRK09564, coenzyme A disulfide reductase; Reviewed Back     alignment and domain information
>gnl|CDD|163244 TIGR03385, CoA_CoA_reduc, CoA-disulfide reductase Back     alignment and domain information
>gnl|CDD|215691 pfam00070, Pyr_redox, Pyridine nucleotide-disulphide oxidoreductase Back     alignment and domain information
>gnl|CDD|223523 COG0446, HcaD, Uncharacterized NAD(FAD)-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>gnl|CDD|223566 COG0492, TrxB, Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|224171 COG1251, NirB, NAD(P)H-nitrite reductase [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|162827 TIGR02374, nitri_red_nirB, nitrite reductase [NAD(P)H], large subunit Back     alignment and domain information
>gnl|CDD|233345 TIGR01292, TRX_reduct, thioredoxin-disulfide reductase Back     alignment and domain information
>gnl|CDD|224172 COG1252, Ndh, NADH dehydrogenase, FAD-containing subunit [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|184103 PRK13512, PRK13512, coenzyme A disulfide reductase; Provisional Back     alignment and domain information
>gnl|CDD|179902 PRK04965, PRK04965, NADH:flavorubredoxin oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|234134 TIGR03169, Nterm_to_SelD, pyridine nucleotide-disulfide oxidoreductase family protein Back     alignment and domain information
>gnl|CDD|184951 PRK14989, PRK14989, nitrite reductase subunit NirD; Provisional Back     alignment and domain information
>gnl|CDD|130383 TIGR01316, gltA, glutamate synthase (NADPH), homotetrameric Back     alignment and domain information
>gnl|CDD|185553 PTZ00318, PTZ00318, NADH dehydrogenase-like protein; Provisional Back     alignment and domain information
>gnl|CDD|234119 TIGR03140, AhpF, alkyl hydroperoxide reductase subunit F Back     alignment and domain information
>gnl|CDD|222125 pfam13434, K_oxygenase, L-lysine 6-monooxygenase (NADPH-requiring) Back     alignment and domain information
>gnl|CDD|226160 COG3634, AhpF, Alkyl hydroperoxide reductase, large subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|226017 COG3486, IucD, Lysine/ornithine N-monooxygenase [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|236967 PRK11749, PRK11749, dihydropyrimidine dehydrogenase subunit A; Provisional Back     alignment and domain information
>gnl|CDD|237197 PRK12770, PRK12770, putative glutamate synthase subunit beta; Provisional Back     alignment and domain information
>gnl|CDD|182343 PRK10262, PRK10262, thioredoxin reductase; Provisional Back     alignment and domain information
>gnl|CDD|170080 PRK09754, PRK09754, phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 551
COG1249454 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, 100.0
PLN02546558 glutathione reductase 100.0
KOG0405478 consensus Pyridine nucleotide-disulphide oxidoredu 100.0
PLN02507499 glutathione reductase 100.0
TIGR01423486 trypano_reduc trypanothione-disulfide reductase. T 100.0
TIGR01421450 gluta_reduc_1 glutathione-disulfide reductase, ani 100.0
PRK06116450 glutathione reductase; Validated 100.0
TIGR01424446 gluta_reduc_2 glutathione-disulfide reductase, pla 100.0
PRK06370463 mercuric reductase; Validated 100.0
PTZ00058561 glutathione reductase; Provisional 100.0
KOG1335506 consensus Dihydrolipoamide dehydrogenase [Energy p 100.0
PRK07846451 mycothione reductase; Reviewed 100.0
TIGR01438484 TGR thioredoxin and glutathione reductase selenopr 100.0
PRK06467471 dihydrolipoamide dehydrogenase; Reviewed 100.0
PTZ00153659 lipoamide dehydrogenase; Provisional 100.0
TIGR03452452 mycothione_red mycothione reductase. Mycothiol, a 100.0
PRK07845466 flavoprotein disulfide reductase; Reviewed 100.0
PRK06115466 dihydrolipoamide dehydrogenase; Reviewed 100.0
PRK07818466 dihydrolipoamide dehydrogenase; Reviewed 100.0
PRK05249461 soluble pyridine nucleotide transhydrogenase; Prov 100.0
TIGR02053463 MerA mercuric reductase. This model represents the 100.0
PRK14727479 putative mercuric reductase; Provisional 100.0
PRK14694468 putative mercuric reductase; Provisional 100.0
PRK06416462 dihydrolipoamide dehydrogenase; Reviewed 100.0
PRK06912458 acoL dihydrolipoamide dehydrogenase; Validated 100.0
PRK05976472 dihydrolipoamide dehydrogenase; Validated 100.0
PRK06292460 dihydrolipoamide dehydrogenase; Validated 100.0
PTZ00052499 thioredoxin reductase; Provisional 100.0
PRK08010441 pyridine nucleotide-disulfide oxidoreductase; Prov 100.0
PRK06327475 dihydrolipoamide dehydrogenase; Validated 100.0
PRK13748561 putative mercuric reductase; Provisional 100.0
PRK07251438 pyridine nucleotide-disulfide oxidoreductase; Prov 100.0
TIGR01350461 lipoamide_DH dihydrolipoamide dehydrogenase. The m 100.0
KOG4716503 consensus Thioredoxin reductase [Posttranslational 100.0
PRK13512438 coenzyme A disulfide reductase; Provisional 100.0
PRK09564444 coenzyme A disulfide reductase; Reviewed 100.0
TIGR03385427 CoA_CoA_reduc CoA-disulfide reductase. Members of 100.0
PRK14989 847 nitrite reductase subunit NirD; Provisional 100.0
PRK04965377 NADH:flavorubredoxin oxidoreductase; Provisional 100.0
PRK09754396 phenylpropionate dioxygenase ferredoxin reductase 100.0
TIGR02374 785 nitri_red_nirB nitrite reductase [NAD(P)H], large 100.0
PTZ00318424 NADH dehydrogenase-like protein; Provisional 100.0
COG1252405 Ndh NADH dehydrogenase, FAD-containing subunit [En 100.0
TIGR01292300 TRX_reduct thioredoxin-disulfide reductase. This m 100.0
PRK10262321 thioredoxin reductase; Provisional 100.0
TIGR03143 555 AhpF_homolog putative alkyl hydroperoxide reductas 100.0
TIGR01316449 gltA glutamate synthase (NADPH), homotetrameric. T 100.0
TIGR03140515 AhpF alkyl hydroperoxide reductase, F subunit. Thi 100.0
COG1251 793 NirB NAD(P)H-nitrite reductase [Energy production 100.0
COG0492305 TrxB Thioredoxin reductase [Posttranslational modi 100.0
KOG1336478 consensus Monodehydroascorbate/ferredoxin reductas 100.0
PRK12831464 putative oxidoreductase; Provisional 100.0
TIGR03169364 Nterm_to_SelD pyridine nucleotide-disulfide oxidor 100.0
PRK15317517 alkyl hydroperoxide reductase subunit F; Provision 100.0
PRK11749457 dihydropyrimidine dehydrogenase subunit A; Provisi 100.0
PRK098531019 putative selenate reductase subunit YgfK; Provisio 100.0
PRK12778752 putative bifunctional 2-polyprenylphenol hydroxyla 99.98
PRK12770352 putative glutamate synthase subunit beta; Provisio 99.97
TIGR033151012 Se_ygfK putative selenate reductase, YgfK subunit. 99.97
PRK12810471 gltD glutamate synthase subunit beta; Reviewed 99.97
PRK12779 944 putative bifunctional glutamate synthase subunit b 99.97
PRK12814652 putative NADPH-dependent glutamate synthase small 99.97
PRK12775 1006 putative trifunctional 2-polyprenylphenol hydroxyl 99.96
TIGR01318467 gltD_gamma_fam glutamate synthase small subunit fa 99.96
PRK12769654 putative oxidoreductase Fe-S binding subunit; Revi 99.96
TIGR01317485 GOGAT_sm_gam glutamate synthases, NADH/NADPH, smal 99.96
KOG2495491 consensus NADH-dehydrogenase (ubiquinone) [Energy 99.96
KOG0404322 consensus Thioredoxin reductase [Posttranslational 99.96
PRK12809639 putative oxidoreductase Fe-S binding subunit; Revi 99.95
PRK13984604 putative oxidoreductase; Provisional 99.95
COG0446415 HcaD Uncharacterized NAD(FAD)-dependent dehydrogen 99.95
PLN02852491 ferredoxin-NADP+ reductase 99.95
COG3634520 AhpF Alkyl hydroperoxide reductase, large subunit 99.94
KOG1346659 consensus Programmed cell death 8 (apoptosis-induc 99.94
TIGR01372 985 soxA sarcosine oxidase, alpha subunit family, hete 99.93
PRK12771564 putative glutamate synthase (NADPH) small subunit; 99.93
PLN02172461 flavin-containing monooxygenase FMO GS-OX 99.92
PF02852110 Pyr_redox_dim: Pyridine nucleotide-disulphide oxid 99.9
PF00743531 FMO-like: Flavin-binding monooxygenase-like; Inter 99.86
COG0493457 GltD NADPH-dependent glutamate synthase beta chain 99.84
PF07992201 Pyr_redox_2: Pyridine nucleotide-disulphide oxidor 99.81
PRK05329422 anaerobic glycerol-3-phosphate dehydrogenase subun 99.78
PRK06567 1028 putative bifunctional glutamate synthase subunit b 99.77
KOG3851446 consensus Sulfide:quinone oxidoreductase/flavo-bin 99.74
KOG2755334 consensus Oxidoreductase [General function predict 99.73
COG2072443 TrkA Predicted flavoprotein involved in K+ transpo 99.72
PF13738203 Pyr_redox_3: Pyridine nucleotide-disulphide oxidor 99.72
KOG03992142 consensus Glutamate synthase [Amino acid transport 99.71
PF13434341 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requi 99.71
COG3486436 IucD Lysine/ornithine N-monooxygenase [Secondary m 99.7
KOG1399448 consensus Flavin-containing monooxygenase [Seconda 99.7
PTZ00188506 adrenodoxin reductase; Provisional 99.59
COG1148622 HdrA Heterodisulfide reductase, subunit A and rela 99.57
KOG1800468 consensus Ferredoxin/adrenodoxin reductase [Nucleo 99.49
PF0007080 Pyr_redox: Pyridine nucleotide-disulphide oxidored 99.48
COG2081408 Predicted flavoproteins [General function predicti 99.43
TIGR03378419 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase 99.36
PRK07843557 3-ketosteroid-delta-1-dehydrogenase; Reviewed 99.33
PRK12842574 putative succinate dehydrogenase; Reviewed 99.32
COG4529474 Uncharacterized protein conserved in bacteria [Fun 99.3
PRK06134581 putative FAD-binding dehydrogenase; Reviewed 99.3
PRK08401466 L-aspartate oxidase; Provisional 99.23
PF03486409 HI0933_like: HI0933-like protein; InterPro: IPR004 99.23
COG0029518 NadB Aspartate oxidase [Coenzyme metabolism] 99.16
TIGR00551488 nadB L-aspartate oxidase. L-aspartate oxidase is t 99.12
PRK13800 897 putative oxidoreductase/HEAT repeat-containing pro 99.12
PRK04176257 ribulose-1,5-biphosphate synthetase; Provisional 99.1
TIGR00292254 thiazole biosynthesis enzyme. This enzyme is invol 99.06
PRK08275554 putative oxidoreductase; Provisional 99.06
COG3075421 GlpB Anaerobic glycerol-3-phosphate dehydrogenase 99.06
PRK07804541 L-aspartate oxidase; Provisional 99.02
PRK06854608 adenylylsulfate reductase subunit alpha; Validated 99.01
PRK06263543 sdhA succinate dehydrogenase flavoprotein subunit; 99.01
PRK09077536 L-aspartate oxidase; Provisional 99.0
PRK09231582 fumarate reductase flavoprotein subunit; Validated 98.99
PF01266358 DAO: FAD dependent oxidoreductase; InterPro: IPR00 98.97
PRK07395553 L-aspartate oxidase; Provisional 98.97
COG0579429 Predicted dehydrogenase [General function predicti 98.95
PRK08071510 L-aspartate oxidase; Provisional 98.95
TIGR00136 617 gidA glucose-inhibited division protein A. GidA, t 98.93
PRK08641 589 sdhA succinate dehydrogenase flavoprotein subunit; 98.93
TIGR01176580 fum_red_Fp fumarate reductase, flavoprotein subuni 98.92
PRK11728393 hydroxyglutarate oxidase; Provisional 98.91
PRK06452566 sdhA succinate dehydrogenase flavoprotein subunit; 98.91
TIGR01377380 soxA_mon sarcosine oxidase, monomeric form. Sarcos 98.91
PRK06069577 sdhA succinate dehydrogenase flavoprotein subunit; 98.91
COG1635262 THI4 Ribulose 1,5-bisphosphate synthetase, convert 98.91
PRK09897534 hypothetical protein; Provisional 98.91
TIGR01812566 sdhA_frdA_Gneg succinate dehydrogenase or fumarate 98.91
PLN02815594 L-aspartate oxidase 98.9
PRK12845564 3-ketosteroid-delta-1-dehydrogenase; Reviewed 98.89
PRK12409410 D-amino acid dehydrogenase small subunit; Provisio 98.89
TIGR03329460 Phn_aa_oxid putative aminophosphonate oxidoreducta 98.88
PRK11259376 solA N-methyltryptophan oxidase; Provisional 98.88
PRK05192 618 tRNA uridine 5-carboxymethylaminomethyl modificati 98.85
TIGR02061614 aprA adenosine phosphosulphate reductase, alpha su 98.85
PRK06847375 hypothetical protein; Provisional 98.85
PRK07512513 L-aspartate oxidase; Provisional 98.83
PRK08626 657 fumarate reductase flavoprotein subunit; Provision 98.83
PRK08773392 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 98.8
TIGR01811603 sdhA_Bsu succinate dehydrogenase or fumarate reduc 98.79
PRK10157428 putative oxidoreductase FixC; Provisional 98.79
PRK00711416 D-amino acid dehydrogenase small subunit; Validate 98.79
TIGR01292300 TRX_reduct thioredoxin-disulfide reductase. This m 98.78
TIGR00275400 flavoprotein, HI0933 family. The model when search 98.78
PRK08163396 salicylate hydroxylase; Provisional 98.77
COG0644396 FixC Dehydrogenases (flavoproteins) [Energy produc 98.75
PF00890417 FAD_binding_2: FAD binding domain of the Pfam fami 98.72
PTZ00383497 malate:quinone oxidoreductase; Provisional 98.72
PRK08274466 tricarballylate dehydrogenase; Validated 98.71
PRK12844557 3-ketosteroid-delta-1-dehydrogenase; Reviewed 98.71
COG0654387 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and 98.71
PLN02661357 Putative thiazole synthesis 98.69
COG2509486 Uncharacterized FAD-dependent dehydrogenases [Gene 98.68
PRK05714405 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 98.68
PRK09126392 hypothetical protein; Provisional 98.68
PF01494356 FAD_binding_3: FAD binding domain; InterPro: IPR00 98.67
PRK07608388 ubiquinone biosynthesis hydroxylase family protein 98.67
PRK06481506 fumarate reductase flavoprotein subunit; Validated 98.66
PRK07364415 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 98.66
TIGR01373407 soxB sarcosine oxidase, beta subunit family, heter 98.65
PRK08020391 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquin 98.65
TIGR03364365 HpnW_proposed FAD dependent oxidoreductase TIGR033 98.65
PRK07588391 hypothetical protein; Provisional 98.64
PRK08013400 oxidoreductase; Provisional 98.64
TIGR02028398 ChlP geranylgeranyl reductase. This model represen 98.64
PRK13977576 myosin-cross-reactive antigen; Provisional 98.64
COG1053562 SdhA Succinate dehydrogenase/fumarate reductase, f 98.63
PRK12839572 hypothetical protein; Provisional 98.63
PRK10015429 oxidoreductase; Provisional 98.63
PRK06834 488 hypothetical protein; Provisional 98.62
PRK06184 502 hypothetical protein; Provisional 98.62
PRK07333403 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 98.62
PRK08849384 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 98.62
PRK01747662 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltrans 98.6
PRK08850405 2-octaprenyl-6-methoxyphenol hydroxylase; Validate 98.59
PRK07121492 hypothetical protein; Validated 98.59
PRK06175433 L-aspartate oxidase; Provisional 98.59
PLN02463447 lycopene beta cyclase 98.59
TIGR02032295 GG-red-SF geranylgeranyl reductase family. This mo 98.58
PRK07494388 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 98.57
TIGR02734502 crtI_fam phytoene desaturase. Phytoene is converte 98.56
PRK13369502 glycerol-3-phosphate dehydrogenase; Provisional 98.56
PRK07190 487 hypothetical protein; Provisional 98.55
PRK05335436 tRNA (uracil-5-)-methyltransferase Gid; Reviewed 98.55
PRK07573 640 sdhA succinate dehydrogenase flavoprotein subunit; 98.55
TIGR01790388 carotene-cycl lycopene cyclase family protein. Thi 98.54
TIGR01984382 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase. T 98.54
TIGR01320483 mal_quin_oxido malate:quinone-oxidoreductase. This 98.54
TIGR01988385 Ubi-OHases Ubiquinone biosynthesis hydroxylase, Ub 98.53
TIGR02730493 carot_isom carotene isomerase. Members of this fam 98.53
PRK07045388 putative monooxygenase; Reviewed 98.52
PLN02697529 lycopene epsilon cyclase 98.52
PRK08244 493 hypothetical protein; Provisional 98.51
PRK08243392 4-hydroxybenzoate 3-monooxygenase; Validated 98.5
PRK05257494 malate:quinone oxidoreductase; Validated 98.5
PF01946230 Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K. 98.5
PRK05868372 hypothetical protein; Validated 98.5
PRK08132 547 FAD-dependent oxidoreductase; Provisional 98.5
PRK11101 546 glpA sn-glycerol-3-phosphate dehydrogenase subunit 98.5
PRK06185407 hypothetical protein; Provisional 98.5
PRK05732395 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 98.49
PRK12834549 putative FAD-binding dehydrogenase; Reviewed 98.48
PRK12266508 glpD glycerol-3-phosphate dehydrogenase; Reviewed 98.48
PTZ00139 617 Succinate dehydrogenase [ubiquinone] flavoprotein 98.48
PTZ00363443 rab-GDP dissociation inhibitor; Provisional 98.48
COG0665387 DadA Glycine/D-amino acid oxidases (deaminating) [ 98.47
PRK07233434 hypothetical protein; Provisional 98.46
PF01134392 GIDA: Glucose inhibited division protein A; InterP 98.44
PLN00093450 geranylgeranyl diphosphate reductase; Provisional 98.43
PF12831428 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3 98.43
TIGR01813439 flavo_cyto_c flavocytochrome c. This model describ 98.42
PF13738203 Pyr_redox_3: Pyridine nucleotide-disulphide oxidor 98.42
KOG2820399 consensus FAD-dependent oxidoreductase [General fu 98.42
PF13454156 NAD_binding_9: FAD-NAD(P)-binding 98.41
PRK13339497 malate:quinone oxidoreductase; Reviewed 98.41
PRK09078 598 sdhA succinate dehydrogenase flavoprotein subunit; 98.4
PRK11445351 putative oxidoreductase; Provisional 98.39
PRK06183 538 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Va 98.39
COG1232444 HemY Protoporphyrinogen oxidase [Coenzyme metaboli 98.39
PRK06617374 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 98.39
TIGR02023388 BchP-ChlP geranylgeranyl reductase. This model rep 98.38
PRK07803 626 sdhA succinate dehydrogenase flavoprotein subunit; 98.38
PRK15317517 alkyl hydroperoxide reductase subunit F; Provision 98.37
PRK08958 588 sdhA succinate dehydrogenase flavoprotein subunit; 98.37
TIGR03140515 AhpF alkyl hydroperoxide reductase, F subunit. Thi 98.37
PRK05945 575 sdhA succinate dehydrogenase flavoprotein subunit; 98.37
PF1345068 NAD_binding_8: NAD(P)-binding Rossmann-like domain 98.36
PRK07057 591 sdhA succinate dehydrogenase flavoprotein subunit; 98.36
PRK12835584 3-ketosteroid-delta-1-dehydrogenase; Reviewed 98.36
PRK12843578 putative FAD-binding dehydrogenase; Reviewed 98.35
COG1231450 Monoamine oxidase [Amino acid transport and metabo 98.35
PRK08205 583 sdhA succinate dehydrogenase flavoprotein subunit; 98.34
PRK06126 545 hypothetical protein; Provisional 98.34
KOG2415 621 consensus Electron transfer flavoprotein ubiquinon 98.33
PLN00128 635 Succinate dehydrogenase [ubiquinone] flavoprotein 98.33
PLN02464 627 glycerol-3-phosphate dehydrogenase 98.32
PLN02172461 flavin-containing monooxygenase FMO GS-OX 98.31
PRK09754396 phenylpropionate dioxygenase ferredoxin reductase 98.29
PRK06475400 salicylate hydroxylase; Provisional 98.27
TIGR01989437 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6. T 98.27
PF05834374 Lycopene_cycl: Lycopene cyclase protein; InterPro: 98.26
PRK09564 444 coenzyme A disulfide reductase; Reviewed 98.25
TIGR02360390 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase. 98.25
PRK06996398 hypothetical protein; Provisional 98.24
PRK07236386 hypothetical protein; Provisional 98.23
PRK07538413 hypothetical protein; Provisional 98.21
PLN02612567 phytoene desaturase 98.21
PRK07251438 pyridine nucleotide-disulfide oxidoreductase; Prov 98.2
PTZ00306 1167 NADH-dependent fumarate reductase; Provisional 98.2
COG0578532 GlpA Glycerol-3-phosphate dehydrogenase [Energy pr 98.17
TIGR01789370 lycopene_cycl lycopene cyclase. This model represe 98.16
PF04820454 Trp_halogenase: Tryptophan halogenase; InterPro: I 98.15
COG1252405 Ndh NADH dehydrogenase, FAD-containing subunit [En 98.12
KOG2844 856 consensus Dimethylglycine dehydrogenase precursor 98.1
TIGR01350461 lipoamide_DH dihydrolipoamide dehydrogenase. The m 98.1
TIGR03169364 Nterm_to_SelD pyridine nucleotide-disulfide oxidor 98.1
PTZ00318424 NADH dehydrogenase-like protein; Provisional 98.09
COG1233487 Phytoene dehydrogenase and related proteins [Secon 98.09
PF07992201 Pyr_redox_2: Pyridine nucleotide-disulphide oxidor 98.08
PRK14989 847 nitrite reductase subunit NirD; Provisional 98.08
PRK07208479 hypothetical protein; Provisional 98.06
TIGR02032295 GG-red-SF geranylgeranyl reductase family. This mo 98.06
PRK13512 438 coenzyme A disulfide reductase; Provisional 98.06
TIGR02485432 CobZ_N-term precorrin 3B synthase CobZ. CobZ is es 98.05
PLN02927 668 antheraxanthin epoxidase/zeaxanthin epoxidase 98.04
PRK12770352 putative glutamate synthase subunit beta; Provisio 98.04
TIGR02374 785 nitri_red_nirB nitrite reductase [NAD(P)H], large 98.04
PF06039488 Mqo: Malate:quinone oxidoreductase (Mqo); InterPro 98.02
PF01134392 GIDA: Glucose inhibited division protein A; InterP 98.0
PRK12779 944 putative bifunctional glutamate synthase subunit b 98.0
KOG0029501 consensus Amine oxidase [Secondary metabolites bio 97.99
PRK07236386 hypothetical protein; Provisional 97.98
COG0445 621 GidA Flavin-dependent tRNA uridine 5-carboxymethyl 97.97
PRK10262321 thioredoxin reductase; Provisional 97.97
PLN02463447 lycopene beta cyclase 97.97
TIGR00031377 UDP-GALP_mutase UDP-galactopyranose mutase. The ge 97.96
TIGR03143 555 AhpF_homolog putative alkyl hydroperoxide reductas 97.95
PRK04965377 NADH:flavorubredoxin oxidoreductase; Provisional 97.93
TIGR01316449 gltA glutamate synthase (NADPH), homotetrameric. T 97.91
PRK09853 1019 putative selenate reductase subunit YgfK; Provisio 97.91
PRK11749457 dihydropyrimidine dehydrogenase subunit A; Provisi 97.9
KOG2665453 consensus Predicted FAD-dependent oxidoreductase [ 97.87
COG3380331 Predicted NAD/FAD-dependent oxidoreductase [Genera 97.86
COG0492305 TrxB Thioredoxin reductase [Posttranslational modi 97.84
TIGR01424446 gluta_reduc_2 glutathione-disulfide reductase, pla 97.83
TIGR01318467 gltD_gamma_fam glutamate synthase small subunit fa 97.82
PF00743 531 FMO-like: Flavin-binding monooxygenase-like; Inter 97.82
PLN02576496 protoporphyrinogen oxidase 97.81
PRK06753373 hypothetical protein; Provisional 97.8
PLN02268435 probable polyamine oxidase 97.79
PRK11883451 protoporphyrinogen oxidase; Reviewed 97.79
PRK07845 466 flavoprotein disulfide reductase; Reviewed 97.78
TIGR00562462 proto_IX_ox protoporphyrinogen oxidase. This prote 97.78
TIGR02733492 desat_CrtD C-3',4' desaturase CrtD. Members of thi 97.76
PRK12831464 putative oxidoreductase; Provisional 97.75
COG3349485 Uncharacterized conserved protein [Function unknow 97.75
PLN02852 491 ferredoxin-NADP+ reductase 97.74
PRK05249 461 soluble pyridine nucleotide transhydrogenase; Prov 97.74
KOG03992142 consensus Glutamate synthase [Amino acid transport 97.74
COG2907447 Predicted NAD/FAD-binding protein [General functio 97.73
PF06100500 Strep_67kDa_ant: Streptococcal 67 kDa myosin-cross 97.72
COG0446415 HcaD Uncharacterized NAD(FAD)-dependent dehydrogen 97.72
COG0562374 Glf UDP-galactopyranose mutase [Cell envelope biog 97.71
PLN02568539 polyamine oxidase 97.71
PRK08010 441 pyridine nucleotide-disulfide oxidoreductase; Prov 97.7
KOG4254561 consensus Phytoene desaturase [Coenzyme transport 97.7
KOG1399448 consensus Flavin-containing monooxygenase [Seconda 97.69
PRK06467 471 dihydrolipoamide dehydrogenase; Reviewed 97.68
PRK05976 472 dihydrolipoamide dehydrogenase; Validated 97.68
COG2072443 TrkA Predicted flavoprotein involved in K+ transpo 97.66
TIGR01317485 GOGAT_sm_gam glutamate synthases, NADH/NADPH, smal 97.65
PLN02697529 lycopene epsilon cyclase 97.65
KOG2404477 consensus Fumarate reductase, flavoprotein subunit 97.64
PRK06327475 dihydrolipoamide dehydrogenase; Validated 97.63
TIGR01790388 carotene-cycl lycopene cyclase family protein. Thi 97.62
PRK12778752 putative bifunctional 2-polyprenylphenol hydroxyla 97.61
PRK05192 618 tRNA uridine 5-carboxymethylaminomethyl modificati 97.6
PRK08255 765 salicylyl-CoA 5-hydroxylase; Reviewed 97.6
PRK12837513 3-ketosteroid-delta-1-dehydrogenase; Provisional 97.6
PRK12814 652 putative NADPH-dependent glutamate synthase small 97.59
PRK12416463 protoporphyrinogen oxidase; Provisional 97.59
PRK12775 1006 putative trifunctional 2-polyprenylphenol hydroxyl 97.58
TIGR03385427 CoA_CoA_reduc CoA-disulfide reductase. Members of 97.58
TIGR02731453 phytoene_desat phytoene desaturase. Plants and cya 97.56
PRK06912458 acoL dihydrolipoamide dehydrogenase; Validated 97.56
PRK06116450 glutathione reductase; Validated 97.56
TIGR03315 1012 Se_ygfK putative selenate reductase, YgfK subunit. 97.55
PRK12810471 gltD glutamate synthase subunit beta; Reviewed 97.54
PRK06416462 dihydrolipoamide dehydrogenase; Reviewed 97.54
TIGR03219414 salicylate_mono salicylate 1-monooxygenase. Member 97.54
PRK12809639 putative oxidoreductase Fe-S binding subunit; Revi 97.53
PRK09897 534 hypothetical protein; Provisional 97.52
KOG1335506 consensus Dihydrolipoamide dehydrogenase [Energy p 97.51
PLN02676487 polyamine oxidase 97.5
COG0493457 GltD NADPH-dependent glutamate synthase beta chain 97.49
PRK14694468 putative mercuric reductase; Provisional 97.49
PLN02985514 squalene monooxygenase 97.47
COG1249454 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, 97.47
PLN02529738 lysine-specific histone demethylase 1 97.47
PRK06370463 mercuric reductase; Validated 97.47
PRK12769654 putative oxidoreductase Fe-S binding subunit; Revi 97.45
PTZ00188 506 adrenodoxin reductase; Provisional 97.45
KOG1336478 consensus Monodehydroascorbate/ferredoxin reductas 97.44
PRK08294 634 phenol 2-monooxygenase; Provisional 97.44
PF0007080 Pyr_redox: Pyridine nucleotide-disulphide oxidored 97.43
TIGR02053463 MerA mercuric reductase. This model represents the 97.39
PRK06753373 hypothetical protein; Provisional 97.39
PRK01438 480 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 97.38
PF05834374 Lycopene_cycl: Lycopene cyclase protein; InterPro: 97.37
KOG0685498 consensus Flavin-containing amine oxidase [Coenzym 97.35
PTZ00367567 squalene epoxidase; Provisional 97.34
TIGR02732474 zeta_caro_desat carotene 7,8-desaturase. Carotene 97.32
PRK06115 466 dihydrolipoamide dehydrogenase; Reviewed 97.32
PLN02507499 glutathione reductase 97.32
TIGR01421450 gluta_reduc_1 glutathione-disulfide reductase, ani 97.3
TIGR01789370 lycopene_cycl lycopene cyclase. This model represe 97.3
TIGR02023388 BchP-ChlP geranylgeranyl reductase. This model rep 97.3
TIGR00136 617 gidA glucose-inhibited division protein A. GidA, t 97.28
PLN02328808 lysine-specific histone demethylase 1 homolog 97.27
KOG1298509 consensus Squalene monooxygenase [Lipid transport 97.26
PF12831428 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3 97.25
PRK14727479 putative mercuric reductase; Provisional 97.25
PRK07818466 dihydrolipoamide dehydrogenase; Reviewed 97.25
KOG2311 679 consensus NAD/FAD-utilizing protein possibly invol 97.24
PF00732296 GMC_oxred_N: GMC oxidoreductase; InterPro: IPR0001 97.24
PRK12771 564 putative glutamate synthase (NADPH) small subunit; 97.23
PRK13984604 putative oxidoreductase; Provisional 97.21
PF13454156 NAD_binding_9: FAD-NAD(P)-binding 97.21
PRK07846451 mycothione reductase; Reviewed 97.19
KOG2852380 consensus Possible oxidoreductase [General functio 97.18
PRK13748561 putative mercuric reductase; Provisional 97.16
TIGR02462544 pyranose_ox pyranose oxidase. Pyranose oxidase (al 97.16
PTZ00052499 thioredoxin reductase; Provisional 97.15
PTZ00058561 glutathione reductase; Provisional 97.14
PLN02487569 zeta-carotene desaturase 97.13
TIGR03219414 salicylate_mono salicylate 1-monooxygenase. Member 97.1
TIGR03452452 mycothione_red mycothione reductase. Mycothiol, a 97.09
PRK02106560 choline dehydrogenase; Validated 97.08
TIGR01438484 TGR thioredoxin and glutathione reductase selenopr 97.07
TIGR01423486 trypano_reduc trypanothione-disulfide reductase. T 97.06
TIGR01372 985 soxA sarcosine oxidase, alpha subunit family, hete 97.03
PRK06292460 dihydrolipoamide dehydrogenase; Validated 97.02
TIGR02028398 ChlP geranylgeranyl reductase. This model represen 97.01
TIGR00137433 gid_trmFO tRNA:m(5)U-54 methyltransferase. This mo 97.0
PLN03000 881 amine oxidase 96.96
PLN02976 1713 amine oxidase 96.94
COG3573552 Predicted oxidoreductase [General function predict 96.91
KOG0404322 consensus Thioredoxin reductase [Posttranslational 96.9
KOG2853509 consensus Possible oxidoreductase [General functio 96.89
PLN02546558 glutathione reductase 96.87
PF01946230 Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K. 96.83
KOG2614420 consensus Kynurenine 3-monooxygenase and related f 96.83
PRK06567 1028 putative bifunctional glutamate synthase subunit b 96.81
KOG2495 491 consensus NADH-dehydrogenase (ubiquinone) [Energy 96.77
PLN00093450 geranylgeranyl diphosphate reductase; Provisional 96.77
COG1251 793 NirB NAD(P)H-nitrite reductase [Energy production 96.75
COG3380331 Predicted NAD/FAD-dependent oxidoreductase [Genera 96.75
KOG2960328 consensus Protein involved in thiamine biosynthesi 96.75
COG2303542 BetA Choline dehydrogenase and related flavoprotei 96.68
TIGR00137 433 gid_trmFO tRNA:m(5)U-54 methyltransferase. This mo 96.64
PTZ00153659 lipoamide dehydrogenase; Provisional 96.64
COG0445 621 GidA Flavin-dependent tRNA uridine 5-carboxymethyl 96.59
PRK01438480 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 96.59
KOG1276491 consensus Protoporphyrinogen oxidase [Coenzyme tra 96.58
PRK08401466 L-aspartate oxidase; Provisional 96.57
COG1148 622 HdrA Heterodisulfide reductase, subunit A and rela 96.33
PLN02985 514 squalene monooxygenase 96.26
KOG2311 679 consensus NAD/FAD-utilizing protein possibly invol 96.15
PRK08294 634 phenol 2-monooxygenase; Provisional 96.15
TIGR01812 566 sdhA_frdA_Gneg succinate dehydrogenase or fumarate 96.15
TIGR01810532 betA choline dehydrogenase. This enzyme is a membe 96.07
PRK06854 608 adenylylsulfate reductase subunit alpha; Validated 95.98
PLN02785587 Protein HOTHEAD 95.97
KOG2614 420 consensus Kynurenine 3-monooxygenase and related f 95.94
TIGR03862376 flavo_PP4765 uncharacterized flavoprotein, PP_4765 95.92
COG3634520 AhpF Alkyl hydroperoxide reductase, large subunit 95.88
KOG0042 680 consensus Glycerol-3-phosphate dehydrogenase [Ener 95.88
TIGR00551488 nadB L-aspartate oxidase. L-aspartate oxidase is t 95.84
KOG3855481 consensus Monooxygenase involved in coenzyme Q (ub 95.81
PRK08275 554 putative oxidoreductase; Provisional 95.78
PF1345068 NAD_binding_8: NAD(P)-binding Rossmann-like domain 95.72
PRK06263 543 sdhA succinate dehydrogenase flavoprotein subunit; 95.61
PRK07804 541 L-aspartate oxidase; Provisional 95.58
PRK14106450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 95.55
PRK06452 566 sdhA succinate dehydrogenase flavoprotein subunit; 95.53
COG4529 474 Uncharacterized protein conserved in bacteria [Fun 95.44
KOG1238623 consensus Glucose dehydrogenase/choline dehydrogen 95.36
PRK08255 765 salicylyl-CoA 5-hydroxylase; Reviewed 95.34
PTZ00367 567 squalene epoxidase; Provisional 95.22
TIGR01811 603 sdhA_Bsu succinate dehydrogenase or fumarate reduc 95.18
PF00996438 GDI: GDP dissociation inhibitor; InterPro: IPR0182 95.02
PF13434341 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requi 95.01
PF02558151 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: 95.01
PF01494356 FAD_binding_3: FAD binding domain; InterPro: IPR00 94.91
KOG0405 478 consensus Pyridine nucleotide-disulphide oxidoredu 94.87
COG1206439 Gid NAD(FAD)-utilizing enzyme possibly involved in 94.8
TIGR02352337 thiamin_ThiO glycine oxidase ThiO. This family con 94.66
KOG1346 659 consensus Programmed cell death 8 (apoptosis-induc 94.65
PRK08626 657 fumarate reductase flavoprotein subunit; Provision 94.61
PRK06069 577 sdhA succinate dehydrogenase flavoprotein subunit; 94.58
KOG2852380 consensus Possible oxidoreductase [General functio 94.56
PRK14106 450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 94.49
PLN02815 594 L-aspartate oxidase 94.43
PRK06475400 salicylate hydroxylase; Provisional 94.34
PRK05868372 hypothetical protein; Validated 94.33
TIGR01470205 cysG_Nterm siroheme synthase, N-terminal domain. T 94.26
PRK08071 510 L-aspartate oxidase; Provisional 94.21
PRK05335 436 tRNA (uracil-5-)-methyltransferase Gid; Reviewed 94.19
PRK06184 502 hypothetical protein; Provisional 94.12
COG0654387 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and 94.11
PRK06847375 hypothetical protein; Provisional 94.1
PRK08163396 salicylate hydroxylase; Provisional 94.05
PF01210157 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate 93.94
TIGR03197381 MnmC_Cterm tRNA U-34 5-methylaminomethyl-2-thiouri 93.93
COG1635262 THI4 Ribulose 1,5-bisphosphate synthetase, convert 93.91
KOG3851446 consensus Sulfide:quinone oxidoreductase/flavo-bin 93.86
KOG2755334 consensus Oxidoreductase [General function predict 93.83
PRK07395 553 L-aspartate oxidase; Provisional 93.83
PRK08244 493 hypothetical protein; Provisional 93.81
PRK07364415 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 93.66
KOG3923342 consensus D-aspartate oxidase [Amino acid transpor 93.65
KOG2853 509 consensus Possible oxidoreductase [General functio 93.42
PRK07494388 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 93.32
KOG1298 509 consensus Squalene monooxygenase [Lipid transport 93.32
TIGR01176 580 fum_red_Fp fumarate reductase, flavoprotein subuni 93.31
PRK06718202 precorrin-2 dehydrogenase; Reviewed 93.28
PRK09231 582 fumarate reductase flavoprotein subunit; Validated 93.23
PRK08641 589 sdhA succinate dehydrogenase flavoprotein subunit; 93.22
PRK12837513 3-ketosteroid-delta-1-dehydrogenase; Provisional 93.14
PRK07538 413 hypothetical protein; Provisional 93.13
PRK06126 545 hypothetical protein; Provisional 93.13
PF02737180 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD bind 92.89
PF03721185 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogen 92.89
COG1893307 ApbA Ketopantoate reductase [Coenzyme metabolism] 92.89
KOG0029 501 consensus Amine oxidase [Secondary metabolites bio 92.85
PRK09126392 hypothetical protein; Provisional 92.8
TIGR01984382 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase. T 92.75
PRK06185407 hypothetical protein; Provisional 92.71
PRK07045388 putative monooxygenase; Reviewed 92.71
PRK05562223 precorrin-2 dehydrogenase; Provisional 92.7
COG0029 518 NadB Aspartate oxidase [Coenzyme metabolism] 92.65
PRK05708305 2-dehydropantoate 2-reductase; Provisional 92.51
COG0569225 TrkA K+ transport systems, NAD-binding component [ 92.43
PF13241103 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_ 92.39
PRK05714405 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 92.35
PRK07588391 hypothetical protein; Provisional 92.34
PF01593450 Amino_oxidase: Flavin containing amine oxidoreduct 92.3
PF02737180 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD bind 92.15
PRK09077 536 L-aspartate oxidase; Provisional 92.06
TIGR01470205 cysG_Nterm siroheme synthase, N-terminal domain. T 92.0
PF01262168 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal 91.98
COG0686371 Ald Alanine dehydrogenase [Amino acid transport an 91.96
PRK02705459 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 91.91
PRK06719157 precorrin-2 dehydrogenase; Validated 91.9
PRK11883 451 protoporphyrinogen oxidase; Reviewed 91.86
PRK04176257 ribulose-1,5-biphosphate synthetase; Provisional 91.85
PRK08013400 oxidoreductase; Provisional 91.83
PRK07190 487 hypothetical protein; Provisional 91.82
TIGR01988385 Ubi-OHases Ubiquinone biosynthesis hydroxylase, Ub 91.81
>COG1249 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] Back     alignment and domain information 
Probab=100.00  E-value=5.6e-85  Score=668.67  Aligned_cols=443  Identities=36%  Similarity=0.574  Sum_probs=416.0

Q ss_pred             CCCccEEEECCChHHHHHHHHHHhCCCcEEEEccCCCCCCCCCCC-CCCCeeccCCCcchHHHHHhhhhhhHhhhcc-CC
Q 008860           70 HYDFDLFTIGAGSGGVRASRFAANFGASVAICELPFSTISSETTG-GVGGTCVLRGCVPKKLLVYASKFSHEFDESN-GF  147 (551)
Q Consensus        70 ~~~~dVvIIGgG~aGl~aA~~l~~~G~~V~liE~~~~~~~~~~~~-~~GG~~~~~g~~p~~~l~~~~~~~~~~~~~~-~~  147 (551)
                      +.+||+||||+||||+.||.++++.|.+|+|||          +. .+||+|+|+||+|+|.|++.++..+.+.+.. .|
T Consensus         2 ~~~yDvvVIG~GpaG~~aA~raa~~G~kvalvE----------~~~~lGGtCln~GCIPsK~Ll~~a~~~~~~~~~~~~~   71 (454)
T COG1249           2 MKEYDVVVIGAGPAGYVAAIRAAQLGLKVALVE----------KGERLGGTCLNVGCIPSKALLHAAEVIEEARHAAKEY   71 (454)
T ss_pred             CccccEEEECCCHHHHHHHHHHHhCCCCEEEEe----------ecCCcCceEEeeCccccHHHHHHHHHHHHHhhccccc
Confidence            457999999999999999999999999999999          55 7999999999999999999999998888776 68


Q ss_pred             CcccCCCCCCChHHHHHHHHHHHHHHHHHHHHHHHhCCeEEEEeEEEEecCCEEEEcC---EEEEeCeEEEcCCCCCCCC
Q 008860          148 GWKYGTEPQHDWSTLIANKNAELQRLTGIYKNILINAGITLIEGRGKIVDPHTVDVDG---KLYSARHILISVGGRPFIP  224 (551)
Q Consensus       148 g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~~~~~i~~~~v~v~g---~~~~~d~lviAtG~~p~~p  224 (551)
                      |+..... .+||.+++.+++...+.+......+++..+|+++.|++++++++++.+++   +++.++++|||||++|..|
T Consensus        72 Gi~~~~~-~id~~~~~~~k~~v~~~~~~~~~~l~~~~~V~vi~G~a~f~~~~~v~V~~~~~~~~~a~~iiIATGS~p~~~  150 (454)
T COG1249          72 GISAEVP-KIDFEKLLARKDKVVRLLTGGVEGLLKKNGVDVIRGEARFVDPHTVEVTGEDKETITADNIIIATGSRPRIP  150 (454)
T ss_pred             ceecCCC-CcCHHHHHHHHHHHHHHHhhhHHHHHhhCCCEEEEEEEEECCCCEEEEcCCCceEEEeCEEEEcCCCCCcCC
Confidence            8887654 89999999999997778888888888999999999999999999999965   8999999999999999999


Q ss_pred             CCCCCCc--eecchhhhcCCCCCCeEEEEcCcHHHHHHHHHHHhCCCeEEEEeecCccCCCCCHHHHHHHHHHHHhcCcE
Q 008860          225 DIPGSEY--AIDSDAALDLPSKPEKIAIVGGGYIALEFAGIFSGLTSEVHVFIRQKKVLRGFDEDIRDFVAEQMSLRGIE  302 (551)
Q Consensus       225 ~i~g~~~--~~~~~~~~~~~~~~~~vvViG~G~~g~e~a~~l~~~g~~Vtlv~~~~~~l~~~~~~~~~~l~~~l~~~Gv~  302 (551)
                      ++++.+.  ++++++.+.+.+.|++++|||+|++|+|+|..++++|.+||++++.+++++.+|+++++.+.+.|++.|++
T Consensus       151 ~~~~~~~~~~~~s~~~l~~~~lP~~lvIiGgG~IGlE~a~~~~~LG~~VTiie~~~~iLp~~D~ei~~~~~~~l~~~gv~  230 (454)
T COG1249         151 PGPGIDGARILDSSDALFLLELPKSLVIVGGGYIGLEFASVFAALGSKVTVVERGDRILPGEDPEISKELTKQLEKGGVK  230 (454)
T ss_pred             CCCCCCCCeEEechhhcccccCCCEEEEECCCHHHHHHHHHHHHcCCcEEEEecCCCCCCcCCHHHHHHHHHHHHhCCeE
Confidence            9988764  77888877777999999999999999999999999999999999999999999999999999999999999


Q ss_pred             EEcCcccEEEEEcCCceEEEEECCCe--EEEeeEEEEecCcCCCCCCCCccccCeeecCCCCeEeCCCCCCCCCcEEEeC
Q 008860          303 FHTEESPQAILKSTDGSLSVKTNKGT--VDGFSHVMFATGRRPNTKNLGLEKVGVKMTKNGAIEVDEYSGTAVPSIWAVG  380 (551)
Q Consensus       303 i~~~~~v~~i~~~~~~~~~V~~~~G~--~i~~d~vi~a~G~~p~~~~l~l~~~gl~~~~~G~i~vd~~~~t~~~~vya~G  380 (551)
                      +++++.+++++..+++ +.+.+++|+  ++++|.|++|+|++||++.|++++.|++++++|+|.||++++|++|||||+|
T Consensus       231 i~~~~~v~~~~~~~~~-v~v~~~~g~~~~~~ad~vLvAiGR~Pn~~~LgLe~~Gv~~~~rg~I~VD~~~~Tnvp~IyA~G  309 (454)
T COG1249         231 ILLNTKVTAVEKKDDG-VLVTLEDGEGGTIEADAVLVAIGRKPNTDGLGLENAGVELDDRGFIKVDDQMTTNVPGIYAIG  309 (454)
T ss_pred             EEccceEEEEEecCCe-EEEEEecCCCCEEEeeEEEEccCCccCCCCCChhhcCceECCCCCEEeCCccccCCCCEEEee
Confidence            9999999999987776 788888776  6999999999999999999999999999999999999988888999999999


Q ss_pred             cCCCCCCChHHHHHhHHHHHHHHcCCCCCCCCCCCccEEEecCCceEEeeCCHHHHHhcCCCeEEEEeeccCcccccccC
Q 008860          381 DVTDRINLTPVALMEGGALAKTLFQAEPTKPDYSAVPSAVFSQPPIGQVGLSEEQAIQEYGDIDVFTANFRPLKATLSGL  460 (551)
Q Consensus       381 D~~~~~~~~~~A~~~g~~aa~~i~g~~~~~~~~~~~~~~~~~~~~~~~vGl~~~~a~~~~~~~~~~~~~~~~~~~~~~~~  460 (551)
                      ||++.+.+++.|.+||++|++||+|......+|..+|+++|++|++++||+||+||++++.++++...+|..+.++....
T Consensus       310 DV~~~~~Lah~A~~eg~iaa~~i~g~~~~~~d~~~iP~~ift~Peia~VGlte~ea~~~g~~~~~~~~~f~~~~ra~~~~  389 (454)
T COG1249         310 DVIGGPMLAHVAMAEGRIAAENIAGGKRTPIDYRLIPSVVFTDPEIASVGLTEEEAKEAGIDYKVGKFPFAANGRAITMG  389 (454)
T ss_pred             ccCCCcccHhHHHHHHHHHHHHHhCCCCCcCcccCCCEEEECCCcceeeeCCHHHHHhcCCceEEEEeecccchhHHhcc
Confidence            99999889999999999999999985556778999999999999999999999999999989999999999999999889


Q ss_pred             CCcEEEEEEEECCCCeEEEEEEECCChhHHHHHHHHHHHCCCCHHHHccCcccCCCchHHHHHH
Q 008860          461 PDRIFMKLVLCAKTNKVLGLHMCGEDAPEIVQGFAVAVKAGLTKADFDATVGVHPTAAEEFVTL  524 (551)
Q Consensus       461 ~~~~~~kl~~~~~~~~ilG~~~~g~~~~e~i~~~~~~i~~~~~~~~l~~~~~~~pt~~e~~~~~  524 (551)
                      +..||+|+++|+++++|||+|++|++|.|||+.+++||++++|.+|+.+++|+|||++|++.++
T Consensus       390 ~~~G~~Klv~d~~t~~IlGahivg~~A~ElI~~~~~a~~~g~t~~~~~~~i~~HPT~sE~~~~a  453 (454)
T COG1249         390 ETDGFVKLVVDKETGRILGAHIVGPGASELINEIALAIEMGATAEDLALTIHAHPTLSEALKEA  453 (454)
T ss_pred             CCceEEEEEEECCCCeEEEEEEECCCHHHHHHHHHHHHHCCCcHHHHhcCCCCCCChHHHHHHh
Confidence            9999999999999999999999999999999999999999999999999999999999998764

>PLN02546 glutathione reductase Back     alignment and domain information
>KOG0405 consensus Pyridine nucleotide-disulphide oxidoreductase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PLN02507 glutathione reductase Back     alignment and domain information
>TIGR01423 trypano_reduc trypanothione-disulfide reductase Back     alignment and domain information
>TIGR01421 gluta_reduc_1 glutathione-disulfide reductase, animal/bacterial Back     alignment and domain information
>PRK06116 glutathione reductase; Validated Back     alignment and domain information
>TIGR01424 gluta_reduc_2 glutathione-disulfide reductase, plant Back     alignment and domain information
>PRK06370 mercuric reductase; Validated Back     alignment and domain information
>PTZ00058 glutathione reductase; Provisional Back     alignment and domain information
>KOG1335 consensus Dihydrolipoamide dehydrogenase [Energy production and conversion] Back     alignment and domain information
>PRK07846 mycothione reductase; Reviewed Back     alignment and domain information
>TIGR01438 TGR thioredoxin and glutathione reductase selenoprotein Back     alignment and domain information
>PRK06467 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PTZ00153 lipoamide dehydrogenase; Provisional Back     alignment and domain information
>TIGR03452 mycothione_red mycothione reductase Back     alignment and domain information
>PRK07845 flavoprotein disulfide reductase; Reviewed Back     alignment and domain information
>PRK06115 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK07818 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK05249 soluble pyridine nucleotide transhydrogenase; Provisional Back     alignment and domain information
>TIGR02053 MerA mercuric reductase Back     alignment and domain information
>PRK14727 putative mercuric reductase; Provisional Back     alignment and domain information
>PRK14694 putative mercuric reductase; Provisional Back     alignment and domain information
>PRK06416 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK06912 acoL dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK05976 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK06292 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PTZ00052 thioredoxin reductase; Provisional Back     alignment and domain information
>PRK08010 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>PRK06327 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK13748 putative mercuric reductase; Provisional Back     alignment and domain information
>PRK07251 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>TIGR01350 lipoamide_DH dihydrolipoamide dehydrogenase Back     alignment and domain information
>KOG4716 consensus Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK13512 coenzyme A disulfide reductase; Provisional Back     alignment and domain information
>PRK09564 coenzyme A disulfide reductase; Reviewed Back     alignment and domain information
>TIGR03385 CoA_CoA_reduc CoA-disulfide reductase Back     alignment and domain information
>PRK14989 nitrite reductase subunit NirD; Provisional Back     alignment and domain information
>PRK04965 NADH:flavorubredoxin oxidoreductase; Provisional Back     alignment and domain information
>PRK09754 phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional Back     alignment and domain information
>TIGR02374 nitri_red_nirB nitrite reductase [NAD(P)H], large subunit Back     alignment and domain information
>PTZ00318 NADH dehydrogenase-like protein; Provisional Back     alignment and domain information
>COG1252 Ndh NADH dehydrogenase, FAD-containing subunit [Energy production and conversion] Back     alignment and domain information
>TIGR01292 TRX_reduct thioredoxin-disulfide reductase Back     alignment and domain information
>PRK10262 thioredoxin reductase; Provisional Back     alignment and domain information
>TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit Back     alignment and domain information
>TIGR01316 gltA glutamate synthase (NADPH), homotetrameric Back     alignment and domain information
>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit Back     alignment and domain information
>COG1251 NirB NAD(P)H-nitrite reductase [Energy production and conversion] Back     alignment and domain information
>COG0492 TrxB Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1336 consensus Monodehydroascorbate/ferredoxin reductase [General function prediction only] Back     alignment and domain information
>PRK12831 putative oxidoreductase; Provisional Back     alignment and domain information
>TIGR03169 Nterm_to_SelD pyridine nucleotide-disulfide oxidoreductase family protein Back     alignment and domain information
>PRK15317 alkyl hydroperoxide reductase subunit F; Provisional Back     alignment and domain information
>PRK11749 dihydropyrimidine dehydrogenase subunit A; Provisional Back     alignment and domain information
>PRK09853 putative selenate reductase subunit YgfK; Provisional Back     alignment and domain information
>PRK12778 putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional Back     alignment and domain information
>PRK12770 putative glutamate synthase subunit beta; Provisional Back     alignment and domain information
>TIGR03315 Se_ygfK putative selenate reductase, YgfK subunit Back     alignment and domain information
>PRK12810 gltD glutamate synthase subunit beta; Reviewed Back     alignment and domain information
>PRK12779 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Provisional Back     alignment and domain information
>PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional Back     alignment and domain information
>PRK12775 putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein; Provisional Back     alignment and domain information
>TIGR01318 gltD_gamma_fam glutamate synthase small subunit family protein, proteobacterial Back     alignment and domain information
>PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>TIGR01317 GOGAT_sm_gam glutamate synthases, NADH/NADPH, small subunit Back     alignment and domain information
>KOG2495 consensus NADH-dehydrogenase (ubiquinone) [Energy production and conversion] Back     alignment and domain information
>KOG0404 consensus Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>PRK13984 putative oxidoreductase; Provisional Back     alignment and domain information
>COG0446 HcaD Uncharacterized NAD(FAD)-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>PLN02852 ferredoxin-NADP+ reductase Back     alignment and domain information
>COG3634 AhpF Alkyl hydroperoxide reductase, large subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1346 consensus Programmed cell death 8 (apoptosis-inducing factor) [Signal transduction mechanisms] Back     alignment and domain information
>TIGR01372 soxA sarcosine oxidase, alpha subunit family, heterotetrameric form Back     alignment and domain information
>PRK12771 putative glutamate synthase (NADPH) small subunit; Provisional Back     alignment and domain information
>PLN02172 flavin-containing monooxygenase FMO GS-OX Back     alignment and domain information
>PF02852 Pyr_redox_dim: Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain; InterPro: IPR004099 This entry represents a dimerisation domain that is usually found at the C-terminal of both class I and class II oxidoreductases, as well as in NADH oxidases and peroxidases [, , ] Back     alignment and domain information
>PF00743 FMO-like: Flavin-binding monooxygenase-like; InterPro: IPR020946 Flavin-containing monooxygenases (FMOs) constitute a family of xenobiotic-metabolising enzymes [] Back     alignment and domain information
>COG0493 GltD NADPH-dependent glutamate synthase beta chain and related oxidoreductases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>PF07992 Pyr_redox_2: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR023753 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>PRK05329 anaerobic glycerol-3-phosphate dehydrogenase subunit B; Validated Back     alignment and domain information
>PRK06567 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Validated Back     alignment and domain information
>KOG3851 consensus Sulfide:quinone oxidoreductase/flavo-binding protein [Energy production and conversion] Back     alignment and domain information
>KOG2755 consensus Oxidoreductase [General function prediction only] Back     alignment and domain information
>COG2072 TrkA Predicted flavoprotein involved in K+ transport [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF13738 Pyr_redox_3: Pyridine nucleotide-disulphide oxidoreductase; PDB: 3D1C_A 4A9W_B 2YLX_A 2YM2_A 2YLW_A 2YLR_A 2YM1_A 2YLS_A 1W4X_A 2YLT_A Back     alignment and domain information
>KOG0399 consensus Glutamate synthase [Amino acid transport and metabolism] Back     alignment and domain information
>PF13434 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requiring); PDB: 3S61_B 3S5W_B Back     alignment and domain information
>COG3486 IucD Lysine/ornithine N-monooxygenase [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>KOG1399 consensus Flavin-containing monooxygenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PTZ00188 adrenodoxin reductase; Provisional Back     alignment and domain information
>COG1148 HdrA Heterodisulfide reductase, subunit A and related polyferredoxins [Energy production and conversion] Back     alignment and domain information
>KOG1800 consensus Ferredoxin/adrenodoxin reductase [Nucleotide transport and metabolism] Back     alignment and domain information
>PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>COG2081 Predicted flavoproteins [General function prediction only] Back     alignment and domain information
>TIGR03378 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase, anaerobic, B subunit Back     alignment and domain information
>PRK07843 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PRK12842 putative succinate dehydrogenase; Reviewed Back     alignment and domain information
>COG4529 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK06134 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>PRK08401 L-aspartate oxidase; Provisional Back     alignment and domain information
>PF03486 HI0933_like: HI0933-like protein; InterPro: IPR004792 This is a family of conserved hypothetical proteins that may include proteins with a dinucleotide-binding motif (Rossman fold), including oxidoreductases and dehydrogenases Back     alignment and domain information
>COG0029 NadB Aspartate oxidase [Coenzyme metabolism] Back     alignment and domain information
>TIGR00551 nadB L-aspartate oxidase Back     alignment and domain information
>PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional Back     alignment and domain information
>PRK04176 ribulose-1,5-biphosphate synthetase; Provisional Back     alignment and domain information
>TIGR00292 thiazole biosynthesis enzyme Back     alignment and domain information
>PRK08275 putative oxidoreductase; Provisional Back     alignment and domain information
>COG3075 GlpB Anaerobic glycerol-3-phosphate dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK07804 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK06854 adenylylsulfate reductase subunit alpha; Validated Back     alignment and domain information
>PRK06263 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK09077 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK09231 fumarate reductase flavoprotein subunit; Validated Back     alignment and domain information
>PF01266 DAO: FAD dependent oxidoreductase; InterPro: IPR006076 This entry includes various FAD dependent oxidoreductases: Glycerol-3-phosphate dehydrogenase (1 Back     alignment and domain information
>PRK07395 L-aspartate oxidase; Provisional Back     alignment and domain information
>COG0579 Predicted dehydrogenase [General function prediction only] Back     alignment and domain information
>PRK08071 L-aspartate oxidase; Provisional Back     alignment and domain information
>TIGR00136 gidA glucose-inhibited division protein A Back     alignment and domain information
>PRK08641 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>TIGR01176 fum_red_Fp fumarate reductase, flavoprotein subunit Back     alignment and domain information
>PRK11728 hydroxyglutarate oxidase; Provisional Back     alignment and domain information
>PRK06452 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>TIGR01377 soxA_mon sarcosine oxidase, monomeric form Back     alignment and domain information
>PRK06069 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>COG1635 THI4 Ribulose 1,5-bisphosphate synthetase, converts PRPP to RuBP, flavoprotein [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK09897 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01812 sdhA_frdA_Gneg succinate dehydrogenase or fumarate reductase, flavoprotein subunitGram-negative/mitochondrial subgroup Back     alignment and domain information
>PLN02815 L-aspartate oxidase Back     alignment and domain information
>PRK12845 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PRK12409 D-amino acid dehydrogenase small subunit; Provisional Back     alignment and domain information
>TIGR03329 Phn_aa_oxid putative aminophosphonate oxidoreductase Back     alignment and domain information
>PRK11259 solA N-methyltryptophan oxidase; Provisional Back     alignment and domain information
>PRK05192 tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA; Validated Back     alignment and domain information
>TIGR02061 aprA adenosine phosphosulphate reductase, alpha subunit Back     alignment and domain information
>PRK06847 hypothetical protein; Provisional Back     alignment and domain information
>PRK07512 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK08626 fumarate reductase flavoprotein subunit; Provisional Back     alignment and domain information
>PRK08773 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Validated Back     alignment and domain information
>TIGR01811 sdhA_Bsu succinate dehydrogenase or fumarate reductase, flavoprotein subunit, Bacillus subtilis subgroup Back     alignment and domain information
>PRK10157 putative oxidoreductase FixC; Provisional Back     alignment and domain information
>PRK00711 D-amino acid dehydrogenase small subunit; Validated Back     alignment and domain information
>TIGR01292 TRX_reduct thioredoxin-disulfide reductase Back     alignment and domain information
>TIGR00275 flavoprotein, HI0933 family Back     alignment and domain information
>PRK08163 salicylate hydroxylase; Provisional Back     alignment and domain information
>COG0644 FixC Dehydrogenases (flavoproteins) [Energy production and conversion] Back     alignment and domain information
>PF00890 FAD_binding_2: FAD binding domain of the Pfam family Back     alignment and domain information
>PTZ00383 malate:quinone oxidoreductase; Provisional Back     alignment and domain information
>PRK08274 tricarballylate dehydrogenase; Validated Back     alignment and domain information
>PRK12844 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>COG0654 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion] Back     alignment and domain information
>PLN02661 Putative thiazole synthesis Back     alignment and domain information
>COG2509 Uncharacterized FAD-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>PRK05714 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>PRK09126 hypothetical protein; Provisional Back     alignment and domain information
>PF01494 FAD_binding_3: FAD binding domain; InterPro: IPR002938 Monooxygenases incorporate one hydroxyl group into substrates and are found in many metabolic pathways Back     alignment and domain information
>PRK07608 ubiquinone biosynthesis hydroxylase family protein; Provisional Back     alignment and domain information
>PRK06481 fumarate reductase flavoprotein subunit; Validated Back     alignment and domain information
>PRK07364 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>TIGR01373 soxB sarcosine oxidase, beta subunit family, heterotetrameric form Back     alignment and domain information
>PRK08020 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Reviewed Back     alignment and domain information
>TIGR03364 HpnW_proposed FAD dependent oxidoreductase TIGR03364 Back     alignment and domain information
>PRK07588 hypothetical protein; Provisional Back     alignment and domain information
>PRK08013 oxidoreductase; Provisional Back     alignment and domain information
>TIGR02028 ChlP geranylgeranyl reductase Back     alignment and domain information
>PRK13977 myosin-cross-reactive antigen; Provisional Back     alignment and domain information
>COG1053 SdhA Succinate dehydrogenase/fumarate reductase, flavoprotein subunit [Energy production and conversion] Back     alignment and domain information
>PRK12839 hypothetical protein; Provisional Back     alignment and domain information
>PRK10015 oxidoreductase; Provisional Back     alignment and domain information
>PRK06834 hypothetical protein; Provisional Back     alignment and domain information
>PRK06184 hypothetical protein; Provisional Back     alignment and domain information
>PRK07333 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>PRK08849 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>PRK01747 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltransferase/FAD-dependent cmnm(5)s(2)U34 oxidoreductase; Reviewed Back     alignment and domain information
>PRK08850 2-octaprenyl-6-methoxyphenol hydroxylase; Validated Back     alignment and domain information
>PRK07121 hypothetical protein; Validated Back     alignment and domain information
>PRK06175 L-aspartate oxidase; Provisional Back     alignment and domain information
>PLN02463 lycopene beta cyclase Back     alignment and domain information
>TIGR02032 GG-red-SF geranylgeranyl reductase family Back     alignment and domain information
>PRK07494 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>TIGR02734 crtI_fam phytoene desaturase Back     alignment and domain information
>PRK13369 glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK07190 hypothetical protein; Provisional Back     alignment and domain information
>PRK05335 tRNA (uracil-5-)-methyltransferase Gid; Reviewed Back     alignment and domain information
>PRK07573 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>TIGR01790 carotene-cycl lycopene cyclase family protein Back     alignment and domain information
>TIGR01984 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase Back     alignment and domain information
>TIGR01320 mal_quin_oxido malate:quinone-oxidoreductase Back     alignment and domain information
>TIGR01988 Ubi-OHases Ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6 family Back     alignment and domain information
>TIGR02730 carot_isom carotene isomerase Back     alignment and domain information
>PRK07045 putative monooxygenase; Reviewed Back     alignment and domain information
>PLN02697 lycopene epsilon cyclase Back     alignment and domain information
>PRK08244 hypothetical protein; Provisional Back     alignment and domain information
>PRK08243 4-hydroxybenzoate 3-monooxygenase; Validated Back     alignment and domain information
>PRK05257 malate:quinone oxidoreductase; Validated Back     alignment and domain information
>PF01946 Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K Back     alignment and domain information
>PRK05868 hypothetical protein; Validated Back     alignment and domain information
>PRK08132 FAD-dependent oxidoreductase; Provisional Back     alignment and domain information
>PRK11101 glpA sn-glycerol-3-phosphate dehydrogenase subunit A; Provisional Back     alignment and domain information
>PRK06185 hypothetical protein; Provisional Back     alignment and domain information
>PRK05732 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PRK12834 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>PRK12266 glpD glycerol-3-phosphate dehydrogenase; Reviewed Back     alignment and domain information
>PTZ00139 Succinate dehydrogenase [ubiquinone] flavoprotein subunit; Provisional Back     alignment and domain information
>PTZ00363 rab-GDP dissociation inhibitor; Provisional Back     alignment and domain information
>COG0665 DadA Glycine/D-amino acid oxidases (deaminating) [Amino acid transport and metabolism] Back     alignment and domain information
>PRK07233 hypothetical protein; Provisional Back     alignment and domain information
>PF01134 GIDA: Glucose inhibited division protein A; InterPro: IPR002218 GidA is a tRNA modification enzyme found in bacteria and mitochondria Back     alignment and domain information
>PLN00093 geranylgeranyl diphosphate reductase; Provisional Back     alignment and domain information
>PF12831 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3ADA_A 1VRQ_A 1X31_A 3AD9_A 3AD8_A 3AD7_A 2GAG_A 2GAH_A Back     alignment and domain information
>TIGR01813 flavo_cyto_c flavocytochrome c Back     alignment and domain information
>PF13738 Pyr_redox_3: Pyridine nucleotide-disulphide oxidoreductase; PDB: 3D1C_A 4A9W_B 2YLX_A 2YM2_A 2YLW_A 2YLR_A 2YM1_A 2YLS_A 1W4X_A 2YLT_A Back     alignment and domain information
>KOG2820 consensus FAD-dependent oxidoreductase [General function prediction only] Back     alignment and domain information
>PF13454 NAD_binding_9: FAD-NAD(P)-binding Back     alignment and domain information
>PRK13339 malate:quinone oxidoreductase; Reviewed Back     alignment and domain information
>PRK09078 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK11445 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK06183 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Validated Back     alignment and domain information
>COG1232 HemY Protoporphyrinogen oxidase [Coenzyme metabolism] Back     alignment and domain information
>PRK06617 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>TIGR02023 BchP-ChlP geranylgeranyl reductase Back     alignment and domain information
>PRK07803 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK15317 alkyl hydroperoxide reductase subunit F; Provisional Back     alignment and domain information
>PRK08958 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit Back     alignment and domain information
>PRK05945 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PF13450 NAD_binding_8: NAD(P)-binding Rossmann-like domain; PDB: 3KA7_A 1V0J_D 3INR_B 3KYB_B 3GF4_A 2BI8_A 3INT_B 1WAM_A 2BI7_A 3MJ4_G Back     alignment and domain information
>PRK07057 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK12835 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PRK12843 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>COG1231 Monoamine oxidase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK08205 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK06126 hypothetical protein; Provisional Back     alignment and domain information
>KOG2415 consensus Electron transfer flavoprotein ubiquinone oxidoreductase [Energy production and conversion] Back     alignment and domain information
>PLN00128 Succinate dehydrogenase [ubiquinone] flavoprotein subunit Back     alignment and domain information
>PLN02464 glycerol-3-phosphate dehydrogenase Back     alignment and domain information
>PLN02172 flavin-containing monooxygenase FMO GS-OX Back     alignment and domain information
>PRK09754 phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional Back     alignment and domain information
>PRK06475 salicylate hydroxylase; Provisional Back     alignment and domain information
>TIGR01989 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6 Back     alignment and domain information
>PF05834 Lycopene_cycl: Lycopene cyclase protein; InterPro: IPR008671 This family consists of lycopene beta and epsilon cyclase proteins Back     alignment and domain information
>PRK09564 coenzyme A disulfide reductase; Reviewed Back     alignment and domain information
>TIGR02360 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase Back     alignment and domain information
>PRK06996 hypothetical protein; Provisional Back     alignment and domain information
>PRK07236 hypothetical protein; Provisional Back     alignment and domain information
>PRK07538 hypothetical protein; Provisional Back     alignment and domain information
>PLN02612 phytoene desaturase Back     alignment and domain information
>PRK07251 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>PTZ00306 NADH-dependent fumarate reductase; Provisional Back     alignment and domain information
>COG0578 GlpA Glycerol-3-phosphate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>TIGR01789 lycopene_cycl lycopene cyclase Back     alignment and domain information
>PF04820 Trp_halogenase: Tryptophan halogenase; InterPro: IPR006905 Tryptophan halogenase catalyses the chlorination of tryptophan to form 7-chlorotryptophan Back     alignment and domain information
>COG1252 Ndh NADH dehydrogenase, FAD-containing subunit [Energy production and conversion] Back     alignment and domain information
>KOG2844 consensus Dimethylglycine dehydrogenase precursor [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01350 lipoamide_DH dihydrolipoamide dehydrogenase Back     alignment and domain information
>TIGR03169 Nterm_to_SelD pyridine nucleotide-disulfide oxidoreductase family protein Back     alignment and domain information
>PTZ00318 NADH dehydrogenase-like protein; Provisional Back     alignment and domain information
>COG1233 Phytoene dehydrogenase and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PF07992 Pyr_redox_2: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR023753 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>PRK14989 nitrite reductase subunit NirD; Provisional Back     alignment and domain information
>PRK07208 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02032 GG-red-SF geranylgeranyl reductase family Back     alignment and domain information
>PRK13512 coenzyme A disulfide reductase; Provisional Back     alignment and domain information
>TIGR02485 CobZ_N-term precorrin 3B synthase CobZ Back     alignment and domain information
>PLN02927 antheraxanthin epoxidase/zeaxanthin epoxidase Back     alignment and domain information
>PRK12770 putative glutamate synthase subunit beta; Provisional Back     alignment and domain information
>TIGR02374 nitri_red_nirB nitrite reductase [NAD(P)H], large subunit Back     alignment and domain information
>PF06039 Mqo: Malate:quinone oxidoreductase (Mqo); InterPro: IPR006231 The membrane-associated enzyme, malate:quinone-oxidoreductase, is an alternative to the better-known NAD-dependent malate dehydrogenase as part of the TCA cycle Back     alignment and domain information
>PF01134 GIDA: Glucose inhibited division protein A; InterPro: IPR002218 GidA is a tRNA modification enzyme found in bacteria and mitochondria Back     alignment and domain information
>PRK12779 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Provisional Back     alignment and domain information
>KOG0029 consensus Amine oxidase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK07236 hypothetical protein; Provisional Back     alignment and domain information
>COG0445 GidA Flavin-dependent tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK10262 thioredoxin reductase; Provisional Back     alignment and domain information
>PLN02463 lycopene beta cyclase Back     alignment and domain information
>TIGR00031 UDP-GALP_mutase UDP-galactopyranose mutase Back     alignment and domain information
>TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit Back     alignment and domain information
>PRK04965 NADH:flavorubredoxin oxidoreductase; Provisional Back     alignment and domain information
>TIGR01316 gltA glutamate synthase (NADPH), homotetrameric Back     alignment and domain information
>PRK09853 putative selenate reductase subunit YgfK; Provisional Back     alignment and domain information
>PRK11749 dihydropyrimidine dehydrogenase subunit A; Provisional Back     alignment and domain information
>KOG2665 consensus Predicted FAD-dependent oxidoreductase [Function unknown] Back     alignment and domain information
>COG3380 Predicted NAD/FAD-dependent oxidoreductase [General function prediction only] Back     alignment and domain information
>COG0492 TrxB Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01424 gluta_reduc_2 glutathione-disulfide reductase, plant Back     alignment and domain information
>TIGR01318 gltD_gamma_fam glutamate synthase small subunit family protein, proteobacterial Back     alignment and domain information
>PF00743 FMO-like: Flavin-binding monooxygenase-like; InterPro: IPR020946 Flavin-containing monooxygenases (FMOs) constitute a family of xenobiotic-metabolising enzymes [] Back     alignment and domain information
>PLN02576 protoporphyrinogen oxidase Back     alignment and domain information
>PRK06753 hypothetical protein; Provisional Back     alignment and domain information
>PLN02268 probable polyamine oxidase Back     alignment and domain information
>PRK11883 protoporphyrinogen oxidase; Reviewed Back     alignment and domain information
>PRK07845 flavoprotein disulfide reductase; Reviewed Back     alignment and domain information
>TIGR00562 proto_IX_ox protoporphyrinogen oxidase Back     alignment and domain information
>TIGR02733 desat_CrtD C-3',4' desaturase CrtD Back     alignment and domain information
>PRK12831 putative oxidoreductase; Provisional Back     alignment and domain information
>COG3349 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PLN02852 ferredoxin-NADP+ reductase Back     alignment and domain information
>PRK05249 soluble pyridine nucleotide transhydrogenase; Provisional Back     alignment and domain information
>KOG0399 consensus Glutamate synthase [Amino acid transport and metabolism] Back     alignment and domain information
>COG2907 Predicted NAD/FAD-binding protein [General function prediction only] Back     alignment and domain information
>PF06100 Strep_67kDa_ant: Streptococcal 67 kDa myosin-cross-reactive antigen like family ; InterPro: IPR010354 Members of this family are thought to have structural features in common with the beta chain of the class II antigens, as well as myosin, and may play an important role in the pathogenesis [] Back     alignment and domain information
>COG0446 HcaD Uncharacterized NAD(FAD)-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>COG0562 Glf UDP-galactopyranose mutase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PLN02568 polyamine oxidase Back     alignment and domain information
>PRK08010 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>KOG4254 consensus Phytoene desaturase [Coenzyme transport and metabolism] Back     alignment and domain information
>KOG1399 consensus Flavin-containing monooxygenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK06467 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK05976 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>COG2072 TrkA Predicted flavoprotein involved in K+ transport [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR01317 GOGAT_sm_gam glutamate synthases, NADH/NADPH, small subunit Back     alignment and domain information
>PLN02697 lycopene epsilon cyclase Back     alignment and domain information
>KOG2404 consensus Fumarate reductase, flavoprotein subunit [Energy production and conversion] Back     alignment and domain information
>PRK06327 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>TIGR01790 carotene-cycl lycopene cyclase family protein Back     alignment and domain information
>PRK12778 putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional Back     alignment and domain information
>PRK05192 tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA; Validated Back     alignment and domain information
>PRK08255 salicylyl-CoA 5-hydroxylase; Reviewed Back     alignment and domain information
>PRK12837 3-ketosteroid-delta-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional Back     alignment and domain information
>PRK12416 protoporphyrinogen oxidase; Provisional Back     alignment and domain information
>PRK12775 putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein; Provisional Back     alignment and domain information
>TIGR03385 CoA_CoA_reduc CoA-disulfide reductase Back     alignment and domain information
>TIGR02731 phytoene_desat phytoene desaturase Back     alignment and domain information
>PRK06912 acoL dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK06116 glutathione reductase; Validated Back     alignment and domain information
>TIGR03315 Se_ygfK putative selenate reductase, YgfK subunit Back     alignment and domain information
>PRK12810 gltD glutamate synthase subunit beta; Reviewed Back     alignment and domain information
>PRK06416 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>TIGR03219 salicylate_mono salicylate 1-monooxygenase Back     alignment and domain information
>PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>PRK09897 hypothetical protein; Provisional Back     alignment and domain information
>KOG1335 consensus Dihydrolipoamide dehydrogenase [Energy production and conversion] Back     alignment and domain information
>PLN02676 polyamine oxidase Back     alignment and domain information
>COG0493 GltD NADPH-dependent glutamate synthase beta chain and related oxidoreductases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>PRK14694 putative mercuric reductase; Provisional Back     alignment and domain information
>PLN02985 squalene monooxygenase Back     alignment and domain information
>COG1249 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>PLN02529 lysine-specific histone demethylase 1 Back     alignment and domain information
>PRK06370 mercuric reductase; Validated Back     alignment and domain information
>PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>PTZ00188 adrenodoxin reductase; Provisional Back     alignment and domain information
>KOG1336 consensus Monodehydroascorbate/ferredoxin reductase [General function prediction only] Back     alignment and domain information
>PRK08294 phenol 2-monooxygenase; Provisional Back     alignment and domain information
>PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>TIGR02053 MerA mercuric reductase Back     alignment and domain information
>PRK06753 hypothetical protein; Provisional Back     alignment and domain information
>PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PF05834 Lycopene_cycl: Lycopene cyclase protein; InterPro: IPR008671 This family consists of lycopene beta and epsilon cyclase proteins Back     alignment and domain information
>KOG0685 consensus Flavin-containing amine oxidase [Coenzyme transport and metabolism] Back     alignment and domain information
>PTZ00367 squalene epoxidase; Provisional Back     alignment and domain information
>TIGR02732 zeta_caro_desat carotene 7,8-desaturase Back     alignment and domain information
>PRK06115 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PLN02507 glutathione reductase Back     alignment and domain information
>TIGR01421 gluta_reduc_1 glutathione-disulfide reductase, animal/bacterial Back     alignment and domain information
>TIGR01789 lycopene_cycl lycopene cyclase Back     alignment and domain information
>TIGR02023 BchP-ChlP geranylgeranyl reductase Back     alignment and domain information
>TIGR00136 gidA glucose-inhibited division protein A Back     alignment and domain information
>PLN02328 lysine-specific histone demethylase 1 homolog Back     alignment and domain information
>KOG1298 consensus Squalene monooxygenase [Lipid transport and metabolism] Back     alignment and domain information
>PF12831 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3ADA_A 1VRQ_A 1X31_A 3AD9_A 3AD8_A 3AD7_A 2GAG_A 2GAH_A Back     alignment and domain information
>PRK14727 putative mercuric reductase; Provisional Back     alignment and domain information
>PRK07818 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>KOG2311 consensus NAD/FAD-utilizing protein possibly involved in translation [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF00732 GMC_oxred_N: GMC oxidoreductase; InterPro: IPR000172 The glucose-methanol-choline (GMC) oxidoreductases are FAD flavoproteins oxidoreductases [, ] Back     alignment and domain information
>PRK12771 putative glutamate synthase (NADPH) small subunit; Provisional Back     alignment and domain information
>PRK13984 putative oxidoreductase; Provisional Back     alignment and domain information
>PF13454 NAD_binding_9: FAD-NAD(P)-binding Back     alignment and domain information
>PRK07846 mycothione reductase; Reviewed Back     alignment and domain information
>KOG2852 consensus Possible oxidoreductase [General function prediction only] Back     alignment and domain information
>PRK13748 putative mercuric reductase; Provisional Back     alignment and domain information
>TIGR02462 pyranose_ox pyranose oxidase Back     alignment and domain information
>PTZ00052 thioredoxin reductase; Provisional Back     alignment and domain information
>PTZ00058 glutathione reductase; Provisional Back     alignment and domain information
>PLN02487 zeta-carotene desaturase Back     alignment and domain information
>TIGR03219 salicylate_mono salicylate 1-monooxygenase Back     alignment and domain information
>TIGR03452 mycothione_red mycothione reductase Back     alignment and domain information
>PRK02106 choline dehydrogenase; Validated Back     alignment and domain information
>TIGR01438 TGR thioredoxin and glutathione reductase selenoprotein Back     alignment and domain information
>TIGR01423 trypano_reduc trypanothione-disulfide reductase Back     alignment and domain information
>TIGR01372 soxA sarcosine oxidase, alpha subunit family, heterotetrameric form Back     alignment and domain information
>PRK06292 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>TIGR02028 ChlP geranylgeranyl reductase Back     alignment and domain information
>TIGR00137 gid_trmFO tRNA:m(5)U-54 methyltransferase Back     alignment and domain information
>PLN03000 amine oxidase Back     alignment and domain information
>PLN02976 amine oxidase Back     alignment and domain information
>COG3573 Predicted oxidoreductase [General function prediction only] Back     alignment and domain information
>KOG0404 consensus Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2853 consensus Possible oxidoreductase [General function prediction only] Back     alignment and domain information
>PLN02546 glutathione reductase Back     alignment and domain information
>PF01946 Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K Back     alignment and domain information
>KOG2614 consensus Kynurenine 3-monooxygenase and related flavoprotein monooxygenases [Energy production and conversion; General function prediction only] Back     alignment and domain information
>PRK06567 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Validated Back     alignment and domain information
>KOG2495 consensus NADH-dehydrogenase (ubiquinone) [Energy production and conversion] Back     alignment and domain information
>PLN00093 geranylgeranyl diphosphate reductase; Provisional Back     alignment and domain information
>COG1251 NirB NAD(P)H-nitrite reductase [Energy production and conversion] Back     alignment and domain information
>COG3380 Predicted NAD/FAD-dependent oxidoreductase [General function prediction only] Back     alignment and domain information
>KOG2960 consensus Protein involved in thiamine biosynthesis and DNA damage tolerance [General function prediction only] Back     alignment and domain information
>COG2303 BetA Choline dehydrogenase and related flavoproteins [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR00137 gid_trmFO tRNA:m(5)U-54 methyltransferase Back     alignment and domain information
>PTZ00153 lipoamide dehydrogenase; Provisional Back     alignment and domain information
>COG0445 GidA Flavin-dependent tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>KOG1276 consensus Protoporphyrinogen oxidase [Coenzyme transport and metabolism] Back     alignment and domain information
>PRK08401 L-aspartate oxidase; Provisional Back     alignment and domain information
>COG1148 HdrA Heterodisulfide reductase, subunit A and related polyferredoxins [Energy production and conversion] Back     alignment and domain information
>PLN02985 squalene monooxygenase Back     alignment and domain information
>KOG2311 consensus NAD/FAD-utilizing protein possibly involved in translation [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK08294 phenol 2-monooxygenase; Provisional Back     alignment and domain information
>TIGR01812 sdhA_frdA_Gneg succinate dehydrogenase or fumarate reductase, flavoprotein subunitGram-negative/mitochondrial subgroup Back     alignment and domain information
>TIGR01810 betA choline dehydrogenase Back     alignment and domain information
>PRK06854 adenylylsulfate reductase subunit alpha; Validated Back     alignment and domain information
>PLN02785 Protein HOTHEAD Back     alignment and domain information
>KOG2614 consensus Kynurenine 3-monooxygenase and related flavoprotein monooxygenases [Energy production and conversion; General function prediction only] Back     alignment and domain information
>TIGR03862 flavo_PP4765 uncharacterized flavoprotein, PP_4765 family Back     alignment and domain information
>COG3634 AhpF Alkyl hydroperoxide reductase, large subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0042 consensus Glycerol-3-phosphate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>TIGR00551 nadB L-aspartate oxidase Back     alignment and domain information
>KOG3855 consensus Monooxygenase involved in coenzyme Q (ubiquinone) biosynthesis [Coenzyme transport and metabolism; Energy production and conversion] Back     alignment and domain information
>PRK08275 putative oxidoreductase; Provisional Back     alignment and domain information
>PF13450 NAD_binding_8: NAD(P)-binding Rossmann-like domain; PDB: 3KA7_A 1V0J_D 3INR_B 3KYB_B 3GF4_A 2BI8_A 3INT_B 1WAM_A 2BI7_A 3MJ4_G Back     alignment and domain information
>PRK06263 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK07804 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK14106 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK06452 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>COG4529 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG1238 consensus Glucose dehydrogenase/choline dehydrogenase/mandelonitrile lyase (GMC oxidoreductase family) [General function prediction only] Back     alignment and domain information
>PRK08255 salicylyl-CoA 5-hydroxylase; Reviewed Back     alignment and domain information
>PTZ00367 squalene epoxidase; Provisional Back     alignment and domain information
>TIGR01811 sdhA_Bsu succinate dehydrogenase or fumarate reductase, flavoprotein subunit, Bacillus subtilis subgroup Back     alignment and domain information
>PF00996 GDI: GDP dissociation inhibitor; InterPro: IPR018203 Rab proteins constitute a family of small GTPases that serve a regulatory role in vesicular membrane traffic [, ]; C-terminal geranylgeranylation is crucial for their membrane association and function Back     alignment and domain information
>PF13434 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requiring); PDB: 3S61_B 3S5W_B Back     alignment and domain information
>PF02558 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: IPR013332 ApbA, the ketopantoate reductase enzyme 1 Back     alignment and domain information
>PF01494 FAD_binding_3: FAD binding domain; InterPro: IPR002938 Monooxygenases incorporate one hydroxyl group into substrates and are found in many metabolic pathways Back     alignment and domain information
>KOG0405 consensus Pyridine nucleotide-disulphide oxidoreductase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>COG1206 Gid NAD(FAD)-utilizing enzyme possibly involved in translation [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR02352 thiamin_ThiO glycine oxidase ThiO Back     alignment and domain information
>KOG1346 consensus Programmed cell death 8 (apoptosis-inducing factor) [Signal transduction mechanisms] Back     alignment and domain information
>PRK08626 fumarate reductase flavoprotein subunit; Provisional Back     alignment and domain information
>PRK06069 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>KOG2852 consensus Possible oxidoreductase [General function prediction only] Back     alignment and domain information
>PRK14106 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PLN02815 L-aspartate oxidase Back     alignment and domain information
>PRK06475 salicylate hydroxylase; Provisional Back     alignment and domain information
>PRK05868 hypothetical protein; Validated Back     alignment and domain information
>TIGR01470 cysG_Nterm siroheme synthase, N-terminal domain Back     alignment and domain information
>PRK08071 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK05335 tRNA (uracil-5-)-methyltransferase Gid; Reviewed Back     alignment and domain information
>PRK06184 hypothetical protein; Provisional Back     alignment and domain information
>COG0654 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion] Back     alignment and domain information
>PRK06847 hypothetical protein; Provisional Back     alignment and domain information
>PRK08163 salicylate hydroxylase; Provisional Back     alignment and domain information
>PF01210 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus; InterPro: IPR011128 NAD-dependent glycerol-3-phosphate dehydrogenase (GPDH) catalyses the interconversion of dihydroxyacetone phosphate and L-glycerol-3-phosphate Back     alignment and domain information
>TIGR03197 MnmC_Cterm tRNA U-34 5-methylaminomethyl-2-thiouridine biosynthesis protein MnmC, C-terminal domain Back     alignment and domain information
>COG1635 THI4 Ribulose 1,5-bisphosphate synthetase, converts PRPP to RuBP, flavoprotein [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG3851 consensus Sulfide:quinone oxidoreductase/flavo-binding protein [Energy production and conversion] Back     alignment and domain information
>KOG2755 consensus Oxidoreductase [General function prediction only] Back     alignment and domain information
>PRK07395 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK08244 hypothetical protein; Provisional Back     alignment and domain information
>PRK07364 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>KOG3923 consensus D-aspartate oxidase [Amino acid transport and metabolism] Back     alignment and domain information
>KOG2853 consensus Possible oxidoreductase [General function prediction only] Back     alignment and domain information
>PRK07494 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>KOG1298 consensus Squalene monooxygenase [Lipid transport and metabolism] Back     alignment and domain information
>TIGR01176 fum_red_Fp fumarate reductase, flavoprotein subunit Back     alignment and domain information
>PRK06718 precorrin-2 dehydrogenase; Reviewed Back     alignment and domain information
>PRK09231 fumarate reductase flavoprotein subunit; Validated Back     alignment and domain information
>PRK08641 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK12837 3-ketosteroid-delta-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK07538 hypothetical protein; Provisional Back     alignment and domain information
>PRK06126 hypothetical protein; Provisional Back     alignment and domain information
>PF02737 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain; InterPro: IPR006176 3-hydroxyacyl-CoA dehydrogenase (1 Back     alignment and domain information
>PF03721 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain; InterPro: IPR001732 The UDP-glucose/GDP-mannose dehydrogenases are a small group of enzymes which possesses the ability to catalyse the NAD-dependent 2-fold oxidation of an alcohol to an acid without the release of an aldehyde intermediate [, ] Back     alignment and domain information
>COG1893 ApbA Ketopantoate reductase [Coenzyme metabolism] Back     alignment and domain information
>KOG0029 consensus Amine oxidase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK09126 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01984 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase Back     alignment and domain information
>PRK06185 hypothetical protein; Provisional Back     alignment and domain information
>PRK07045 putative monooxygenase; Reviewed Back     alignment and domain information
>PRK05562 precorrin-2 dehydrogenase; Provisional Back     alignment and domain information
>COG0029 NadB Aspartate oxidase [Coenzyme metabolism] Back     alignment and domain information
>PRK05708 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF13241 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_B 1PJT_A 1PJS_A 1PJQ_A 1KYQ_B Back     alignment and domain information
>PRK05714 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>PRK07588 hypothetical protein; Provisional Back     alignment and domain information
>PF01593 Amino_oxidase: Flavin containing amine oxidoreductase This is a subset of the Pfam family; InterPro: IPR002937 This entry consists of various amine oxidases, including maize polyamine oxidase (PAO) [], L-amino acid oxidases (LAO) and various flavin containing monoamine oxidases (MAO) Back     alignment and domain information
>PF02737 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain; InterPro: IPR006176 3-hydroxyacyl-CoA dehydrogenase (1 Back     alignment and domain information
>PRK09077 L-aspartate oxidase; Provisional Back     alignment and domain information
>TIGR01470 cysG_Nterm siroheme synthase, N-terminal domain Back     alignment and domain information
>PF01262 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal domain; InterPro: IPR007698 Alanine dehydrogenases (1 Back     alignment and domain information
>COG0686 Ald Alanine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK02705 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK06719 precorrin-2 dehydrogenase; Validated Back     alignment and domain information
>PRK11883 protoporphyrinogen oxidase; Reviewed Back     alignment and domain information
>PRK04176 ribulose-1,5-biphosphate synthetase; Provisional Back     alignment and domain information
>PRK08013 oxidoreductase; Provisional Back     alignment and domain information
>PRK07190 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01988 Ubi-OHases Ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6 family Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query551
3o0h_A484 Crystal Structure Of Glutathione Reductase From Bar 1e-108
4dna_A463 Crystal Structure Of Putative Glutathione Reductase 1e-105
2r9z_A463 Glutathione Amide Reductase From Chromatium Gracile 1e-97
1ger_A450 The Structure Of Glutathione Reductase From Escheri 8e-96
2jk6_A511 Structure Of Trypanothione Reductase From Leishmani 8e-94
2x50_A510 Crystal Structure Of Trypanothione Reductase From L 8e-94
2wba_A492 Properties Of Trypanothione Reductase From T. Bruce 2e-93
2woi_A495 Trypanothione Reductase From Trypanosoma Brucei Len 2e-93
1ges_A450 Anatomy Of An Engineered Nad-Binding Site Length = 2e-91
1gxf_A492 Crystal Structure Of Trypanosoma Cruzi Trypanothion 7e-91
1bzl_A486 Crystal Structure Of Trypanosoma Cruzi Trypanothion 7e-91
1aog_A485 Trypanosoma Cruzi Trypanothione Reductase (Oxidized 1e-90
1nda_A491 The Structure Of Trypanosoma Cruzi Trypanothione Re 2e-90
1fea_A490 Unliganded Crithidia Fasciculata Trypanothione Redu 3e-88
1typ_A487 Substrate Interactions Between Trypanothione Reduct 3e-88
1tyt_A487 Crystal And Molecular Structure Of Crithidia Fascic 5e-88
2tpr_A490 X-ray Structure Of Trypanothione Reductase From Cri 2e-87
2grt_A461 Human Glutathione Reductase A34e, R37w Mutant, Oxid 8e-86
1grt_A478 Human Glutathione Reductase A34eR37W MUTANT Length 8e-86
1xan_A461 Human Glutathione Reductase In Complex With A Xanth 4e-83
3djg_X477 Catalytic Cycle Of Human Glutathione Reductase Near 6e-83
1bwc_A478 Structure Of Human Glutathione Reductase Complexed 6e-83
2aaq_A479 Crystal Structure Analysis Of The Human Glutahione 6e-83
2x8c_A598 Thioredoxin Glutathione Reductase From Schistosoma 9e-83
3h4k_A598 Crystal Structure Of The Wild Type Thioredoxin Glut 1e-82
2v6o_A596 Structure Of Schistosoma Mansoni Thioredoxin-Glutat 4e-82
1grg_A478 Substrate Binding And Catalysis By Glutathione Redu 1e-81
1dnc_A478 Human Glutathione Reductase Modified By Diglutathio 1e-81
1gsn_A478 Human Glutathione Reductase Modified By Dinitrosogl 1e-81
1k4q_A463 Human Glutathione Reductase Inactivated By Peroxyni 2e-80
2hqm_A479 Crystal Structure Of Glutathione Reductase Glr1 Fro 1e-79
2cfy_A521 Crystal Structure Of Human Thioredoxin Reductase 1 2e-77
2j3n_A519 X-Ray Structure Of Human Thioredoxin Reductase 1 Le 3e-77
3qfa_A519 Crystal Structure Of The Human Thioredoxin Reductas 3e-77
2zz0_A513 Crystal Structure Of Human Thioredoxin Reductase I 4e-77
1h6v_A499 Mammalian Thioredoxin Reductase Length = 499 5e-75
3ean_A499 Crystal Structure Of Recombinant Rat Selenoprotein 7e-75
3dgh_A483 Crystal Structure Of Drosophila Thioredoxin Reducta 9e-74
2nvk_X488 Crystal Structure Of Thioredoxin Reductase From Dro 1e-73
3dh9_A482 Crystal Structure Of Drosophila Thioredoxin Reducta 1e-73
3dgz_A488 Crystal Structure Of Mouse Mitochondrial Thioredoxi 6e-73
1zdl_A517 Crystal Structure Of Mouse Thioredoxin Reductase Ty 7e-73
1onf_A500 Crystal Structure Of Plasmodium Falciparum Glutathi 4e-70
4b1b_A542 Crystal Structure Of Plasmodium Falciparum Oxidised 2e-66
1ebd_A455 Dihydrolipoamide Dehydrogenase Complexed With The B 3e-54
3lad_A476 Refined Crystal Structure Of Lipoamide Dehydrogenas 2e-46
1lpf_A477 Three-Dimensional Structure Of Lipoamide Dehydrogen 4e-45
2eq6_A464 Crystal Structure Of Lipoamide Dehydrogenase From T 4e-44
1zk7_A467 Crystal Structure Of Tn501 Mera Length = 467 2e-40
1dxl_A470 Dihydrolipoamide Dehydrogenase Of Glycine Decarboxy 6e-40
1lvl_A458 The Refined Structure Of Pseudomonas Putida Lipoami 8e-40
2eq7_A455 Crystal Structure Of Lipoamide Dehydrogenase From T 1e-39
2qae_A468 Crystal Structure Analysis Of Trypanosoma Cruzi Lip 6e-38
1zy8_A474 The Crystal Structure Of Dihydrolipoamide Dehydroge 3e-37
1zmc_A474 Crystal Structure Of Human Dihydrolipoamide Dehydro 3e-37
3rnm_A495 The Crystal Structure Of The Subunit Binding Of Hum 4e-37
3urh_A491 Crystal Structure Of A Dihydrolipoamide Dehydrogena 7e-36
3ii4_A466 Structure Of Mycobacterial Lipoamide Dehydrogenase 3e-33
1jeh_A478 Crystal Structure Of Yeast E3, Lipoamide Dehydrogen 4e-33
2a8x_A464 Crystal Structure Of Lipoamide Dehydrogenase From M 2e-32
1ojt_A482 Structure Of Dihydrolipoamide Dehydrogenase Length 6e-31
1bhy_A482 Low Temperature Middle Resolution Structure Of P64k 1e-30
1xdi_A499 Crystal Structure Of Lpda (Rv3303c) From Mycobacter 1e-26
3ic9_A492 The Structure Of Dihydrolipoamide Dehydrogenase Fro 1e-23
3l8k_A466 Crystal Structure Of A Dihydrolipoyl Dehydrogenase 1e-20
1mo9_A523 Nadph Dependent 2-Ketopropyl Coenzyme M Oxidoreduct 9e-20
3cgc_A480 Pyridine Nucleotide Complexes With Bacillus Anthrac 8e-14
1f8w_A447 Crystal Structure Of Nadh Peroxidase Mutant: R303m 4e-13
3cgb_A480 Pyridine Nucleotide Complexes With Bacillus Anthrac 9e-13
1nhr_A447 An L40c Mutation Converts The Cysteine-Sulfenic Aci 1e-12
1nhq_A447 Crystallographic Analyses Of Nadh Peroxidase Cys42a 1e-12
1nhp_A447 Crystallographic Analyses Of Nadh Peroxidase Cys42a 1e-12
1nhs_A447 An L40c Mutation Converts The Cysteine-Sulfenic Aci 1e-12
1joa_A447 Nadh Peroxidase With Cysteine-Sulfenic Acid Length 2e-12
2bc1_A490 Structural Analysis Of Streptococcus Pyogenes Nadh 3e-12
2bc0_A490 Structural Analysis Of Streptococcus Pyogenes Nadh 3e-12
3kd9_A449 Crystal Structure Of Pyridine Nucleotide Disulfide 4e-11
2cdu_A452 The Crystal Structure Of Water-Forming Nad(P)h Oxid 7e-11
4emw_A436 Crystal Structure Of Staphylococcus Aureus Bound Wi 1e-07
4eqs_A437 Crystal Structure Of The Y419f Mutant Of Staphyloco 2e-07
4eqr_A437 Crystal Structure Of The Y361f Mutant Of Staphyloco 2e-07
4em3_A437 Crystal Structure Of Staphylococcus Aureus Bound Wi 2e-07
1yqz_A438 Structure Of Coenzyme A-Disulfide Reductase From St 2e-07
4eqw_A437 Crystal Structure Of The Y361f, Y419f Mutant Of Sta 2e-07
4eqx_A437 Crystal Structure Of The C43s Mutant Of Staphylococ 2e-07
2gr3_A408 Crystal Structure Of Ferredoxin Reductase, Bpha4 (O 2e-07
1d7y_A408 Crystal Structure Of Nadh-Dependent Ferredoxin Redu 2e-07
3oc4_A452 Crystal Structure Of A Pyridine Nucleotide-Disulfid 2e-07
3iwa_A472 Crystal Structure Of A Fad-Dependent Pyridine Nucle 4e-06
3icr_A588 Crystal Structure Of Oxidized Bacillus Anthracis Co 5e-06
3ntd_A565 Structure Of The Shewanella Loihica Pv-4 Nadh-Depen 8e-06
1f6m_A320 Crystal Structure Of A Complex Between Thioredoxin 2e-04
3lxd_A415 Crystal Structure Of Ferredoxin Reductase Arr From 2e-04
3nta_A574 Structure Of The Shewanella Loihica Pv-4 Nadh-Depen 2e-04
1tde_A316 Crystal Structure Of Escherichia Coli Thioredoxin R 2e-04
1cl0_A320 Crystal Structure Of Reduced Thioredoxin Reductase 3e-04
3nt6_A574 Structure Of The Shewanella Loihica Pv-4 Nadh-Depen 3e-04
1tdf_A316 Crystal Structure Of Escherichia Coli Thioredoxin R 5e-04
1trb_A320 Convergent Evolution Of Similar Function In Two Str 6e-04
>pdb|3O0H|A Chain A, Crystal Structure Of Glutathione Reductase From Bartonella Henselae Length = 484 Back     alignment and structure 
Iteration: 1

 Score =  388 bits (996), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 206/461 (44%), Positives = 278/461 (60%), Gaps = 15/461 (3%)
Query: 71  YDFDLFTIGAGSGGVRASRFAANFGASVAICELPFSTISSETTGGVGGTCVLRGCVPKKL 130
           +DFDLF IG+GSGGVRA+R A   G  VAI E             +GGTCV+RGCVPKKL
Sbjct: 25  FDFDLFVIGSGSGGVRAARLAGALGKRVAIAE----------EYRIGGTCVIRGCVPKKL 74
Query: 131 LVYASKFSHEFDESNGFGWKYGTEPQHDWSTLIANKNAELQRLTGIYKNILINAGITLIE 190
             YAS+++ EF +S GFGWKY  +P  +W  L+A KN E+ RL G+Y+  L N+ + + E
Sbjct: 75  YFYASQYAQEFSKSIGFGWKYA-DPIFNWEKLVAAKNKEISRLEGLYREGLQNSNVHIYE 133
Query: 191 GRGKIVDPHTVD--VDGKLYSARHILISVGGRPFIPD-IPGSEYAIDSDAALDLPSKPEK 247
            R   VD HT++  V G+  SA  ILI+ G +      I GS+  + S+   DL   P+ 
Sbjct: 134 SRAVFVDEHTLELSVTGERISAEKILIATGAKIVSNSAIKGSDLCLTSNEIFDLEKLPKS 193
Query: 248 IAIVGGGYIALEFAGIFSGLTSEVHVFIRQKKVLRGFDEDIRDFVAEQMSLRGIEFHTEE 307
           I IVGGGYI +EFA IF GL  +  +  R   +LR FD D+R  + + M  +GI    E 
Sbjct: 194 IVIVGGGYIGVEFANIFHGLGVKTTLLHRGDLILRNFDYDLRQLLNDAMVAKGISIIYEA 253
Query: 308 SPQAILKSTDGSLSVKTNKGTVDGFSHVMFATGRRPNTKNLGLEKVGVKMTKNGAIEVDE 367
           +   + +ST+   +V    G       VM ATGR PNT  LGLE+ GVK+ + GA+ VDE
Sbjct: 254 TVSQV-QSTENCYNVVLTNGQTICADRVMLATGRVPNTTGLGLERAGVKVNEFGAVVVDE 312
Query: 368 YSGTAVPSIWAVGDVTDRINLTPVALMEGGALAKTLFQAEPTKPDYSAVPSAVFSQPPIG 427
              T V  IWAVGDVT  I LTPVA+ +     K  F+   T PDY  + +AVFSQP IG
Sbjct: 313 KMTTNVSHIWAVGDVTGHIQLTPVAIHDAMCFVKNAFENTSTTPDYDLITTAVFSQPEIG 372
Query: 428 QVGLSEEQAIQEYGDIDVFTANFRPLKATLSGLPDRIFMKLVLCAKTNKVLGLHMCGEDA 487
            VGLSEE A+  Y  ++++   FRP++  LSG P+++FMKLV+  ++  V+G H+ GE+A
Sbjct: 373 TVGLSEEDALHRYKRVEIYRTVFRPMRNVLSGSPEKMFMKLVVDGESRIVVGAHVLGENA 432
Query: 488 PEIVQGFAVAVKAGLTKADFDATVGVHPTAAEEFVTLRTPT 528
            EI Q   +++K  LTK  FD T+ VHPT +EE VT+  P+
Sbjct: 433 GEIAQLIGISLKGKLTKDIFDKTMAVHPTMSEELVTMYKPS 473
>pdb|4DNA|A Chain A, Crystal Structure Of Putative Glutathione Reductase From Sinorhizobium Meliloti 1021 Length = 463 Back     alignment and structure
>pdb|2R9Z|A Chain A, Glutathione Amide Reductase From Chromatium Gracile Length = 463 Back     alignment and structure
>pdb|1GER|A Chain A, The Structure Of Glutathione Reductase From Escherichia Coli At 1.86 Angstroms Resolution: Comparison With The Enzyme From Human Erythrocytes Length = 450 Back     alignment and structure
>pdb|2JK6|A Chain A, Structure Of Trypanothione Reductase From Leishmania Infantum Length = 511 Back     alignment and structure
>pdb|2X50|A Chain A, Crystal Structure Of Trypanothione Reductase From Leishmania Infantum In Complex With Nadph And Silver Length = 510 Back     alignment and structure
>pdb|2WBA|A Chain A, Properties Of Trypanothione Reductase From T. Brucei Length = 492 Back     alignment and structure
>pdb|2WOI|A Chain A, Trypanothione Reductase From Trypanosoma Brucei Length = 495 Back     alignment and structure
>pdb|1GES|A Chain A, Anatomy Of An Engineered Nad-Binding Site Length = 450 Back     alignment and structure
>pdb|1GXF|A Chain A, Crystal Structure Of Trypanosoma Cruzi Trypanothione Reductase In Complex With The Inhibitor Quinacrine Mustard Length = 492 Back     alignment and structure
>pdb|1BZL|A Chain A, Crystal Structure Of Trypanosoma Cruzi Trypanothione Reductase In Complex With Trypanothione, And The Structure- Based Discovery Of New Natural Product Inhibitors Length = 486 Back     alignment and structure
>pdb|1AOG|A Chain A, Trypanosoma Cruzi Trypanothione Reductase (Oxidized Form) Length = 485 Back     alignment and structure
>pdb|1NDA|A Chain A, The Structure Of Trypanosoma Cruzi Trypanothione Reductase In The Oxidized And Nadph Reduced State Length = 491 Back     alignment and structure
>pdb|1FEA|A Chain A, Unliganded Crithidia Fasciculata Trypanothione Reductase At 2.2 Angstrom Resolution Length = 490 Back     alignment and structure
>pdb|1TYP|A Chain A, Substrate Interactions Between Trypanothione Reductase And N1-Glutathionylspermidine Disulphide At 0.28-Nm Resolution Length = 487 Back     alignment and structure
>pdb|1TYT|A Chain A, Crystal And Molecular Structure Of Crithidia Fasciculata Trypanothione Reductase At 2.6 Angstroms Resolution Length = 487 Back     alignment and structure
>pdb|2TPR|A Chain A, X-ray Structure Of Trypanothione Reductase From Crithidia Fasciculata At 2.4 Angstroms Resolution Length = 490 Back     alignment and structure
>pdb|2GRT|A Chain A, Human Glutathione Reductase A34e, R37w Mutant, Oxidized Glutathione Complex Length = 461 Back     alignment and structure
>pdb|1GRT|A Chain A, Human Glutathione Reductase A34eR37W MUTANT Length = 478 Back     alignment and structure
>pdb|1XAN|A Chain A, Human Glutathione Reductase In Complex With A Xanthene Inhibitor Length = 461 Back     alignment and structure
>pdb|3DJG|X Chain X, Catalytic Cycle Of Human Glutathione Reductase Near 1 A Resolution Length = 477 Back     alignment and structure
>pdb|1BWC|A Chain A, Structure Of Human Glutathione Reductase Complexed With Ajoene Inhibitor And Subversive Substrate Length = 478 Back     alignment and structure
>pdb|2AAQ|A Chain A, Crystal Structure Analysis Of The Human Glutahione Reductase, Complexed With Gopi Length = 479 Back     alignment and structure
>pdb|2X8C|A Chain A, Thioredoxin Glutathione Reductase From Schistosoma Mansoni With The Reduced C-Terminal End Length = 598 Back     alignment and structure
>pdb|3H4K|A Chain A, Crystal Structure Of The Wild Type Thioredoxin Glutatione Reductase From Schistosoma Mansoni In Complex With Auranofin Length = 598 Back     alignment and structure
>pdb|2V6O|A Chain A, Structure Of Schistosoma Mansoni Thioredoxin-Glutathione Reductase (Smtgr) Length = 596 Back     alignment and structure
>pdb|1GRG|A Chain A, Substrate Binding And Catalysis By Glutathione Reductase As Derived From Refined Enzyme: Substrate Crystal Structures At 2 Angstroms Resolution Length = 478 Back     alignment and structure
>pdb|1DNC|A Chain A, Human Glutathione Reductase Modified By Diglutathione-Dinitroso-Iron Length = 478 Back     alignment and structure
>pdb|1GSN|A Chain A, Human Glutathione Reductase Modified By Dinitrosoglutathione Length = 478 Back     alignment and structure
>pdb|2HQM|A Chain A, Crystal Structure Of Glutathione Reductase Glr1 From The Yeast Saccharomyces Cerevisiae Length = 479 Back     alignment and structure
>pdb|2CFY|A Chain A, Crystal Structure Of Human Thioredoxin Reductase 1 Length = 521 Back     alignment and structure
>pdb|2J3N|A Chain A, X-Ray Structure Of Human Thioredoxin Reductase 1 Length = 519 Back     alignment and structure
>pdb|3QFA|A Chain A, Crystal Structure Of The Human Thioredoxin Reductase-Thioredoxin Complex Length = 519 Back     alignment and structure
>pdb|2ZZ0|A Chain A, Crystal Structure Of Human Thioredoxin Reductase I (Secys 498 Cys) Length = 513 Back     alignment and structure
>pdb|1H6V|A Chain A, Mammalian Thioredoxin Reductase Length = 499 Back     alignment and structure
>pdb|3EAN|A Chain A, Crystal Structure Of Recombinant Rat Selenoprotein Thioredoxin Reductase 1 With Reduced C-Terminal Tail Length = 499 Back     alignment and structure
>pdb|3DGH|A Chain A, Crystal Structure Of Drosophila Thioredoxin Reductase, C-Terminal 8- Residue Truncation Length = 483 Back     alignment and structure
>pdb|2NVK|X Chain X, Crystal Structure Of Thioredoxin Reductase From Drosophila Melanogaster Length = 488 Back     alignment and structure
>pdb|3DH9|A Chain A, Crystal Structure Of Drosophila Thioredoxin Reductase, Wild-Type Length = 482 Back     alignment and structure
>pdb|3DGZ|A Chain A, Crystal Structure Of Mouse Mitochondrial Thioredoxin Reductase, C- Terminal 3-Residue Truncation Length = 488 Back     alignment and structure
>pdb|1ZDL|A Chain A, Crystal Structure Of Mouse Thioredoxin Reductase Type 2 Length = 517 Back     alignment and structure
>pdb|1ONF|A Chain A, Crystal Structure Of Plasmodium Falciparum Glutathione Reductase Length = 500 Back     alignment and structure
>pdb|4B1B|A Chain A, Crystal Structure Of Plasmodium Falciparum Oxidised Thioredoxin Reductase At 2.9 Angstrom Length = 542 Back     alignment and structure
>pdb|1EBD|A Chain A, Dihydrolipoamide Dehydrogenase Complexed With The Binding Domain Of The Dihydrolipoamide Acetylase Length = 455 Back     alignment and structure
>pdb|3LAD|A Chain A, Refined Crystal Structure Of Lipoamide Dehydrogenase From Azotobacter Vinelandii At 2.2 Angstroms Resolution. A Comparison With The Structure Of Glutathione Reductase Length = 476 Back     alignment and structure
>pdb|1LPF|A Chain A, Three-Dimensional Structure Of Lipoamide Dehydrogenase From Pseudomonas Fluorescens At 2.8 Angstroms Resolution. Analysis Of Redox And Thermostability Properties Length = 477 Back     alignment and structure
>pdb|2EQ6|A Chain A, Crystal Structure Of Lipoamide Dehydrogenase From Thermus Thermophilus Hb8 Length = 464 Back     alignment and structure
>pdb|1ZK7|A Chain A, Crystal Structure Of Tn501 Mera Length = 467 Back     alignment and structure
>pdb|1DXL|A Chain A, Dihydrolipoamide Dehydrogenase Of Glycine Decarboxylase From Pisum Sativum Length = 470 Back     alignment and structure
>pdb|1LVL|A Chain A, The Refined Structure Of Pseudomonas Putida Lipoamide Dehydrogenase Complexed With Nad+ At 2.45 Angstroms Resolution Length = 458 Back     alignment and structure
>pdb|2EQ7|A Chain A, Crystal Structure Of Lipoamide Dehydrogenase From Thermus Thermophilus Hb8 With Psbdo Length = 455 Back     alignment and structure
>pdb|2QAE|A Chain A, Crystal Structure Analysis Of Trypanosoma Cruzi Lipoamide Dehydrogenase Length = 468 Back     alignment and structure
>pdb|1ZY8|A Chain A, The Crystal Structure Of Dihydrolipoamide Dehydrogenase And Dihydrolipoamide Dehydrogenase-Binding Protein (Didomain) Subcomplex Of Human Pyruvate Dehydrogenase Complex. Length = 474 Back     alignment and structure
>pdb|1ZMC|A Chain A, Crystal Structure Of Human Dihydrolipoamide Dehydrogenase Complexed To Nad+ Length = 474 Back     alignment and structure
>pdb|3RNM|A Chain A, The Crystal Structure Of The Subunit Binding Of Human Dihydrolipoamide Transacylase (E2b) Bound To Human Dihydrolipoamide Dehydrogenase (E3) Length = 495 Back     alignment and structure
>pdb|3URH|A Chain A, Crystal Structure Of A Dihydrolipoamide Dehydrogenase From Sinorhizobium Meliloti 1021 Length = 491 Back     alignment and structure
>pdb|3II4|A Chain A, Structure Of Mycobacterial Lipoamide Dehydrogenase Bound To A Triazaspirodimethoxybenzoyl Inhibitor Length = 466 Back     alignment and structure
>pdb|1JEH|A Chain A, Crystal Structure Of Yeast E3, Lipoamide Dehydrogenase Length = 478 Back     alignment and structure
>pdb|2A8X|A Chain A, Crystal Structure Of Lipoamide Dehydrogenase From Mycobacterium Tuberculosis Length = 464 Back     alignment and structure
>pdb|1OJT|A Chain A, Structure Of Dihydrolipoamide Dehydrogenase Length = 482 Back     alignment and structure
>pdb|1BHY|A Chain A, Low Temperature Middle Resolution Structure Of P64k From Masc Data Length = 482 Back     alignment and structure
>pdb|1XDI|A Chain A, Crystal Structure Of Lpda (Rv3303c) From Mycobacterium Tuberculosis Length = 499 Back     alignment and structure
>pdb|3IC9|A Chain A, The Structure Of Dihydrolipoamide Dehydrogenase From Colwellia Psychrerythraea 34h. Length = 492 Back     alignment and structure
>pdb|3L8K|A Chain A, Crystal Structure Of A Dihydrolipoyl Dehydrogenase From Sulfolobus Solfataricus Length = 466 Back     alignment and structure
>pdb|1MO9|A Chain A, Nadph Dependent 2-Ketopropyl Coenzyme M OxidoreductaseCARBOXYLASE Complexed With 2-Ketopropyl Coenzyme M Length = 523 Back     alignment and structure
>pdb|3CGC|A Chain A, Pyridine Nucleotide Complexes With Bacillus Anthracis Coenzyme A- Disulfide Reductase: A Structural Analysis Of Dual Nad(p)h Specificity Length = 480 Back     alignment and structure
>pdb|1F8W|A Chain A, Crystal Structure Of Nadh Peroxidase Mutant: R303m Length = 447 Back     alignment and structure
>pdb|3CGB|A Chain A, Pyridine Nucleotide Complexes With Bacillus Anthracis Coenzyme A- Disulfide Reductase: A Structural Analysis Of Dual Nad(P)h Specificity Length = 480 Back     alignment and structure
>pdb|1NHR|A Chain A, An L40c Mutation Converts The Cysteine-Sulfenic Acid Redox Centre In Enterococcal Nadh Peroxidase To A Disulfide Length = 447 Back     alignment and structure
>pdb|1NHQ|A Chain A, Crystallographic Analyses Of Nadh Peroxidase Cys42ala And Cys42ser Mutants: Active Site Structure, Mechanistic Implications, And An Unusual Environment Of Arg303 Length = 447 Back     alignment and structure
>pdb|1NHP|A Chain A, Crystallographic Analyses Of Nadh Peroxidase Cys42ala And Cys42ser Mutants: Active Site Structure, Mechanistic Implications, And An Unusual Environment Of Arg303 Length = 447 Back     alignment and structure
>pdb|1NHS|A Chain A, An L40c Mutation Converts The Cysteine-Sulfenic Acid Redox Centre In Enterococcal Nadh Peroxidase To A Disulfide Length = 447 Back     alignment and structure
>pdb|1JOA|A Chain A, Nadh Peroxidase With Cysteine-Sulfenic Acid Length = 447 Back     alignment and structure
>pdb|2BC1|A Chain A, Structural Analysis Of Streptococcus Pyogenes Nadh Oxidase: C44s Nox Length = 490 Back     alignment and structure
>pdb|2BC0|A Chain A, Structural Analysis Of Streptococcus Pyogenes Nadh Oxidase: Wild-Type Nox Length = 490 Back     alignment and structure
>pdb|3KD9|A Chain A, Crystal Structure Of Pyridine Nucleotide Disulfide Oxidoreductase From Pyrococcus Horikoshii Length = 449 Back     alignment and structure
>pdb|2CDU|A Chain A, The Crystal Structure Of Water-Forming Nad(P)h Oxidase From Lactobacillus Sanfranciscensis Length = 452 Back     alignment and structure
>pdb|4EMW|A Chain A, Crystal Structure Of Staphylococcus Aureus Bound With The Covalent Inhibitor Etvc-Coa Length = 436 Back     alignment and structure
>pdb|4EQS|A Chain A, Crystal Structure Of The Y419f Mutant Of Staphylococcus Aureus Coadr Length = 437 Back     alignment and structure
>pdb|4EQR|A Chain A, Crystal Structure Of The Y361f Mutant Of Staphylococcus Aureus Coadr Length = 437 Back     alignment and structure
>pdb|4EM3|A Chain A, Crystal Structure Of Staphylococcus Aureus Bound With The Covalent Inhibitor Mevs-Coa Length = 437 Back     alignment and structure
>pdb|1YQZ|A Chain A, Structure Of Coenzyme A-Disulfide Reductase From Staphylococcus Aureus Refined At 1.54 Angstrom Resolution Length = 438 Back     alignment and structure
>pdb|4EQW|A Chain A, Crystal Structure Of The Y361f, Y419f Mutant Of Staphylococcus Aureus Coadr Length = 437 Back     alignment and structure
>pdb|4EQX|A Chain A, Crystal Structure Of The C43s Mutant Of Staphylococcus Aureus Coadr Length = 437 Back     alignment and structure
>pdb|2GR3|A Chain A, Crystal Structure Of Ferredoxin Reductase, Bpha4 (Oxidized Form) Length = 408 Back     alignment and structure
>pdb|1D7Y|A Chain A, Crystal Structure Of Nadh-Dependent Ferredoxin Reductase, Bpha4 Length = 408 Back     alignment and structure
>pdb|3OC4|A Chain A, Crystal Structure Of A Pyridine Nucleotide-Disulfide Family Oxidoreductase From The Enterococcus Faecalis V583 Length = 452 Back     alignment and structure
>pdb|3IWA|A Chain A, Crystal Structure Of A Fad-Dependent Pyridine Nucleotide-Disulphide Oxidoreductase From Desulfovibrio Vulgaris Length = 472 Back     alignment and structure
>pdb|3ICR|A Chain A, Crystal Structure Of Oxidized Bacillus Anthracis Coadr-Rhd Length = 588 Back     alignment and structure
>pdb|3NTD|A Chain A, Structure Of The Shewanella Loihica Pv-4 Nadh-Dependent Persulfide Reductase C531s Mutant Length = 565 Back     alignment and structure
>pdb|1F6M|A Chain A, Crystal Structure Of A Complex Between Thioredoxin Reductase, Thioredoxin, And The Nadp+ Analog, Aadp+ Length = 320 Back     alignment and structure
>pdb|3LXD|A Chain A, Crystal Structure Of Ferredoxin Reductase Arr From Novosphingobium Aromaticivorans Length = 415 Back     alignment and structure
>pdb|3NTA|A Chain A, Structure Of The Shewanella Loihica Pv-4 Nadh-Dependent Persulfide Reductase Length = 574 Back     alignment and structure
>pdb|1TDE|A Chain A, Crystal Structure Of Escherichia Coli Thioredoxin Reductase Refined At 2 Angstrom Resolution: Implications For A Large Conformational Change During Catalysis Length = 316 Back     alignment and structure
>pdb|1CL0|A Chain A, Crystal Structure Of Reduced Thioredoxin Reductase From Escherichia Coli Length = 320 Back     alignment and structure
>pdb|3NT6|A Chain A, Structure Of The Shewanella Loihica Pv-4 Nadh-Dependent Persulfide Reductase C43sC531S DOUBLE MUTANT Length = 574 Back     alignment and structure
>pdb|1TDF|A Chain A, Crystal Structure Of Escherichia Coli Thioredoxin Reductase Refined At 2 Angstrom Resolution: Implications For A Large Conformational Change During Catalysis Length = 316 Back     alignment and structure
>pdb|1TRB|A Chain A, Convergent Evolution Of Similar Function In Two Structurally Divergent Enzymes Length = 320 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query551
3o0h_A484 Glutathione reductase; ssgcid, structur genomics, 0.0
1fec_A490 Trypanothione reductase; redox-active center, oxid 0.0
2wpf_A495 Trypanothione reductase; oxidoreductase, trypanoso 0.0
4dna_A463 Probable glutathione reductase; structural genomic 0.0
2r9z_A463 Glutathione amide reductase; NAD, FAD, substrate s 0.0
1ges_A450 Glutathione reductase; oxidoreductase(flavoenzyme) 0.0
3dk9_A478 Grase, GR, glutathione reductase; flavoenzyme, nic 0.0
3dgh_A483 TRXR-1, thioredoxin reductase 1, mitochondrial; ox 0.0
2hqm_A479 GR, grase, glutathione reductase; glutathione redu 0.0
3qfa_A519 Thioredoxin reductase 1, cytoplasmic; protein-prot 0.0
3dgz_A488 Thioredoxin reductase 2; oxidoreductase, rossmann, 0.0
2x8g_A598 Thioredoxin glutathione reductase; redox-active ce 0.0
1onf_A500 GR, grase, glutathione reductase; oxidoreductase; 0.0
1mo9_A523 ORF3; nucleotide binding motifs, nucleotide bindin 1e-159
1zk7_A467 HGII, reductase, mercuric reductase; mercuric ION 1e-110
1xdi_A499 RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno fun 3e-98
2a8x_A464 Dihydrolipoyl dehydrogenase, E3 component of alpha 5e-93
3ic9_A492 Dihydrolipoamide dehydrogenase; APC62701, colwelli 1e-92
2yqu_A455 2-oxoglutarate dehydrogenase E3 component; lipoami 4e-89
1dxl_A470 Dihydrolipoamide dehydrogenase; oxidoreductase, mu 3e-86
1lvl_A458 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 6e-86
1ebd_A455 E3BD, dihydrolipoamide dehydrogenase; redox-active 1e-84
3urh_A491 Dihydrolipoyl dehydrogenase; PSI-biology, structur 2e-84
2eq6_A464 Pyruvate dehydrogenase complex, dihydrolipoamide d 6e-84
3lad_A476 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 1e-81
1ojt_A482 Surface protein; redox-active center, glycolysis, 5e-81
1v59_A478 Dihydrolipoamide dehydrogenase; 2-oxoacid dehydrog 3e-80
2qae_A468 Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystin 4e-80
1zmd_A474 Dihydrolipoyl dehydrogenase; lipoamide dehydrogena 8e-79
3l8k_A466 Dihydrolipoyl dehydrogenase; redox-active center, 5e-76
2cdu_A452 NADPH oxidase; flavoenzyme, oxidoreductase; HET: F 3e-39
3oc4_A452 Oxidoreductase, pyridine nucleotide-disulfide FAM; 5e-38
3cgb_A480 Pyridine nucleotide-disulfide oxidoreductase, CLA; 6e-38
3kd9_A449 Coenzyme A disulfide reductase; PSI-II, NYSGXRC, o 2e-37
2bc0_A490 NADH oxidase; flavoprotein, pyridine nucleotide di 3e-37
3iwa_A472 FAD-dependent pyridine nucleotide-disulphide oxido 2e-36
1nhp_A447 NADH peroxidase; oxidoreductase (H2O2(A)); HET: FA 3e-36
3ics_A588 Coenzyme A-disulfide reductase; pyridine nucleotid 1e-35
3ntd_A565 FAD-dependent pyridine nucleotide-disulphide oxido 1e-33
1yqz_A438 Coenzyme A disulfide reductase; oxidoreductase; HE 1e-32
2v3a_A384 Rubredoxin reductase; alkane degradation, NADH oxi 4e-22
3klj_A385 NAD(FAD)-dependent dehydrogenase, NIRB-family (N- 8e-22
3fg2_P404 Putative rubredoxin reductase; ferredoxin reductas 8e-21
1xhc_A367 NADH oxidase /nitrite reductase; southe collaborat 1e-20
3lxd_A415 FAD-dependent pyridine nucleotide-disulphide oxido 6e-20
3ef6_A410 Toluene 1,2-dioxygenase system ferredoxin--NAD(+) 5e-19
1q1r_A431 Putidaredoxin reductase; glutathione reductase fol 1e-18
4fk1_A304 Putative thioredoxin reductase; structural genomic 4e-18
1m6i_A493 Programmed cell death protein 8; apoptosis, AIF, o 9e-18
2gqw_A408 Ferredoxin reductase; flavoprotein, oxidoreductase 2e-17
3fbs_A297 Oxidoreductase; structural genomics, PSI2, MCSG, p 5e-15
3cty_A319 Thioredoxin reductase; FAD, oxidoreductase, flavin 4e-12
3d1c_A369 Flavin-containing putative monooxygenase; NP_37310 3e-09
1hyu_A521 AHPF, alkyl hydroperoxide reductase subunit F; thi 4e-09
3f8d_A323 Thioredoxin reductase (TRXB-3); redox protein, nuc 2e-08
2zbw_A335 Thioredoxin reductase; redox protein, oxidoreducta 2e-08
1fl2_A310 Alkyl hydroperoxide reductase subunit F; reactive 4e-08
3lzw_A332 Ferredoxin--NADP reductase 2; ferredoxin reductase 7e-08
3r9u_A315 Thioredoxin reductase; structural genomics, center 9e-08
2q0l_A311 TRXR, thioredoxin reductase; bacterial thiredoxin 2e-07
3ab1_A360 Ferredoxin--NADP reductase; oxidoreductase, electr 7e-07
2q7v_A325 Thioredoxin reductase; rossman fold, FAD, flavopro 2e-06
1vdc_A333 NTR, NADPH dependent thioredoxin reductase; hypoth 3e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-06
3s5w_A463 L-ornithine 5-monooxygenase; class B flavin depend 6e-06
1ps9_A671 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel 6e-06
2a87_A335 TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TL 1e-05
3h8l_A409 NADH oxidase; membrane protein, complete form, ros 2e-05
3itj_A338 Thioredoxin reductase 1; disulfide B flavoprotein, 4e-05
1o94_A729 Tmadh, trimethylamine dehydrogenase; electron tran 6e-05
3k30_A690 Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP bi 1e-04
1gte_A 1025 Dihydropyrimidine dehydrogenase; electron transfer 2e-04
1trb_A320 Thioredoxin reductase; oxidoreductase(flavoenzyme) 2e-04
4a9w_A357 Monooxygenase; baeyer-villiger, FAD, oxidoreductas 3e-04
>3o0h_A Glutathione reductase; ssgcid, structur genomics, seattle structural genomics center for infectious gluathione reductase, oxidoreductase; HET: FAD; 1.90A {Bartonella henselae} Length = 484 Back     alignment and structure
 Score =  752 bits (1943), Expect = 0.0
 Identities = 206/486 (42%), Positives = 279/486 (57%), Gaps = 15/486 (3%)

Query: 51  RRRHVAARAKSDNGAELPSHYDFDLFTIGAGSGGVRASRFAANFGASVAICELPFSTISS 110
              H+        G      +DFDLF IG+GSGGVRA+R A   G  VAI E        
Sbjct: 5   HHHHMGTLEAQTQGPGSMGSFDFDLFVIGSGSGGVRAARLAGALGKRVAIAE-------- 56

Query: 111 ETTGGVGGTCVLRGCVPKKLLVYASKFSHEFDESNGFGWKYGTEPQHDWSTLIANKNAEL 170
                +GGTCV+RGCVPKKL  YAS+++ EF +S GFGWKY  +P  +W  L+A KN E+
Sbjct: 57  --EYRIGGTCVIRGCVPKKLYFYASQYAQEFSKSIGFGWKYA-DPIFNWEKLVAAKNKEI 113

Query: 171 QRLTGIYKNILINAGITLIEGRGKIVDPHTVDV--DGKLYSARHILISVGGRPF-IPDIP 227
            RL G+Y+  L N+ + + E R   VD HT+++   G+  SA  ILI+ G +      I 
Sbjct: 114 SRLEGLYREGLQNSNVHIYESRAVFVDEHTLELSVTGERISAEKILIATGAKIVSNSAIK 173

Query: 228 GSEYAIDSDAALDLPSKPEKIAIVGGGYIALEFAGIFSGLTSEVHVFIRQKKVLRGFDED 287
           GS+  + S+   DL   P+ I IVGGGYI +EFA IF GL  +  +  R   +LR FD D
Sbjct: 174 GSDLCLTSNEIFDLEKLPKSIVIVGGGYIGVEFANIFHGLGVKTTLLHRGDLILRNFDYD 233

Query: 288 IRDFVAEQMSLRGIEFHTEESPQAILKSTDGSLSVKTNKGTVDGFSHVMFATGRRPNTKN 347
           +R  + + M  +GI    E +   +   T+   +V    G       VM ATGR PNT  
Sbjct: 234 LRQLLNDAMVAKGISIIYEATVSQVQS-TENCYNVVLTNGQTICADRVMLATGRVPNTTG 292

Query: 348 LGLEKVGVKMTKNGAIEVDEYSGTAVPSIWAVGDVTDRINLTPVALMEGGALAKTLFQAE 407
           LGLE+ GVK+ + GA+ VDE   T V  IWAVGDVT  I LTPVA+ +     K  F+  
Sbjct: 293 LGLERAGVKVNEFGAVVVDEKMTTNVSHIWAVGDVTGHIQLTPVAIHDAMCFVKNAFENT 352

Query: 408 PTKPDYSAVPSAVFSQPPIGQVGLSEEQAIQEYGDIDVFTANFRPLKATLSGLPDRIFMK 467
            T PDY  + +AVFSQP IG VGLSEE A+  Y  ++++   FRP++  LSG P+++FMK
Sbjct: 353 STTPDYDLITTAVFSQPEIGTVGLSEEDALHRYKRVEIYRTVFRPMRNVLSGSPEKMFMK 412

Query: 468 LVLCAKTNKVLGLHMCGEDAPEIVQGFAVAVKAGLTKADFDATVGVHPTAAEEFVTLRTP 527
           LV+  ++  V+G H+ GE+A EI Q   +++K  LTK  FD T+ VHPT +EE VT+  P
Sbjct: 413 LVVDGESRIVVGAHVLGENAGEIAQLIGISLKGKLTKDIFDKTMAVHPTMSEELVTMYKP 472

Query: 528 TRKIRK 533
           +     
Sbjct: 473 SYVYEN 478
>1fec_A Trypanothione reductase; redox-active center, oxidoreductase, flavoprotein, FAD, NADP; HET: FAD; 1.70A {Crithidia fasciculata} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1fea_A* 1feb_A* 2tpr_A* 1tyt_A* 1typ_A* 2jk6_A* 2w0h_A* 2yau_A* 2x50_A* 2ve2_A* Length = 490 Back     alignment and structure
>2wpf_A Trypanothione reductase; oxidoreductase, trypanosomiasis, sleeping sickness, flavoPro redox-active center; HET: FAD WPF; 1.90A {Trypanosoma brucei} PDB: 2wov_A* 2wow_A* 2wp5_A* 2wp6_A* 2wpc_A* 2wpe_A* 2woi_A* 2wba_A* 1nda_A* 1gxf_A* 1bzl_A* 1aog_A* Length = 495 Back     alignment and structure
>4dna_A Probable glutathione reductase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; HET: FAD; 2.80A {Sinorhizobium meliloti} Length = 463 Back     alignment and structure
>2r9z_A Glutathione amide reductase; NAD, FAD, substrate specificity, oxidoreductase; HET: FAD; 2.10A {Marichromatium gracile} PDB: 2rab_A* Length = 463 Back     alignment and structure
>1ges_A Glutathione reductase; oxidoreductase(flavoenzyme); HET: FAD; 1.74A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1geu_A* 1ger_A* 1get_A* Length = 450 Back     alignment and structure
>3dk9_A Grase, GR, glutathione reductase; flavoenzyme, nicotinamide, acetylation, alternative initiation, cytoplasm, FAD, flavoprotein, mitochondrion, NADP; HET: SO4 FAD; 0.95A {Homo sapiens} PDB: 1bwc_A* 1gra_A* 1gre_A* 1grf_A* 1grh_A* 1grb_A* 2gh5_A* 1gsn_A* 3dk4_A* 3dk8_A* 3djj_A* 3grs_A* 3sqp_A* 4gr1_A* 2aaq_A* 1dnc_A* 1grg_A* 1grt_A* 1xan_A* 5grt_A* ... Length = 478 Back     alignment and structure
>3dgh_A TRXR-1, thioredoxin reductase 1, mitochondrial; oxidoreductase, rossmann, flavoprotein, alternative initiati mitochondrion, NADP; HET: FAD; 1.75A {Drosophila melanogaster} PDB: 2nvk_X* 3dh9_A* Length = 483 Back     alignment and structure
>2hqm_A GR, grase, glutathione reductase; glutathione reductase complexed with FAD, oxidoreductase; HET: NAG FAD GSH; 2.40A {Saccharomyces cerevisiae} Length = 479 Back     alignment and structure
>3qfa_A Thioredoxin reductase 1, cytoplasmic; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_A* 2j3n_A* 2zzc_A* 2zzb_A* 2zz0_A* 2cfy_A* 1h6v_A* 3ean_A* 3eao_A* Length = 519 Back     alignment and structure
>3dgz_A Thioredoxin reductase 2; oxidoreductase, rossmann, flavoprotein, FAD, mitochondrion, redox-active center, selenium, selenocysteine, transit PEPT; HET: FAD NA7; 2.25A {Mus musculus} PDB: 1zkq_A* 1zdl_A* Length = 488 Back     alignment and structure
>2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A* Length = 598 Back     alignment and structure
>1onf_A GR, grase, glutathione reductase; oxidoreductase; HET: FAD; 2.60A {Plasmodium falciparum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Length = 500 Back     alignment and structure
>1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A* Length = 523 Back     alignment and structure
>1zk7_A HGII, reductase, mercuric reductase; mercuric ION reductase, oxidoreductase; HET: FAD; 1.60A {Pseudomonas aeruginosa} PDB: 1zx9_A* Length = 467 Back     alignment and structure
>1xdi_A RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno function; HET: FAD; 2.81A {Mycobacterium tuberculosis} SCOP: c.3.1.5 d.87.1.1 Length = 499 Back     alignment and structure
>2a8x_A Dihydrolipoyl dehydrogenase, E3 component of alpha; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha keto acid dehydrogenase; HET: FAD; 2.40A {Mycobacterium tuberculosis} PDB: 3ii4_A* Length = 464 Back     alignment and structure
>3ic9_A Dihydrolipoamide dehydrogenase; APC62701, colwellia psychrer 34H, structural genomics, PSI-2; HET: FAD; 2.15A {Colwellia psychrerythraea} Length = 492 Back     alignment and structure
>2yqu_A 2-oxoglutarate dehydrogenase E3 component; lipoamide dehydrogenase, 2-oxoglutarate dehydrogenase comple pyruvate dehydrogenase complex; HET: FAD; 1.70A {Thermus thermophilus} PDB: 2eq7_A* Length = 455 Back     alignment and structure
>1dxl_A Dihydrolipoamide dehydrogenase; oxidoreductase, multienzyme complex protein, pyruvate dehydrogenase complex, glycine decarboxylase complex; HET: FAD; 3.15A {Pisum sativum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Length = 470 Back     alignment and structure
>1lvl_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD NAD; 2.45A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Length = 458 Back     alignment and structure
>1ebd_A E3BD, dihydrolipoamide dehydrogenase; redox-active center, glycolysis, oxidoreductase; HET: FAD; 2.60A {Geobacillus stearothermophilus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Length = 455 Back     alignment and structure
>3urh_A Dihydrolipoyl dehydrogenase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium; HET: FAD; 1.90A {Sinorhizobium meliloti} Length = 491 Back     alignment and structure
>2eq6_A Pyruvate dehydrogenase complex, dihydrolipoamide dehydrogenase E3 component; oxidoreductase, homodimer, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2eq8_A* 2eq9_A* Length = 464 Back     alignment and structure
>3lad_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD; 2.20A {Azotobacter vinelandii} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1lpf_A* Length = 476 Back     alignment and structure
>1ojt_A Surface protein; redox-active center, glycolysis, oxidoreductase, NAD, flavop FAD, P64K; HET: FAD; 2.75A {Neisseria meningitidis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1bhy_A* Length = 482 Back     alignment and structure
>1v59_A Dihydrolipoamide dehydrogenase; 2-oxoacid dehydroganese complex, pyruvate dehydrogenase complex; HET: FAD NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1jeh_A* Length = 478 Back     alignment and structure
>2qae_A Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystine-oxidoreductase, homodimer; HET: FAD; 1.90A {Trypanosoma cruzi} Length = 468 Back     alignment and structure
>1zmd_A Dihydrolipoyl dehydrogenase; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha- ketoglutarate dehydrogenase; HET: FAD NAI; 2.08A {Homo sapiens} PDB: 1zmc_A* 2f5z_A* 1zy8_A* 3rnm_A* Length = 474 Back     alignment and structure
>3l8k_A Dihydrolipoyl dehydrogenase; redox-active center, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.50A {Sulfolobus solfataricus} Length = 466 Back     alignment and structure
>2cdu_A NADPH oxidase; flavoenzyme, oxidoreductase; HET: FAD ADP; 1.8A {Lactobacillus sanfranciscensis} Length = 452 Back     alignment and structure
>3oc4_A Oxidoreductase, pyridine nucleotide-disulfide FAM; structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.60A {Enterococcus faecalis} Length = 452 Back     alignment and structure
>3cgb_A Pyridine nucleotide-disulfide oxidoreductase, CLA; coenzyme A, flavin adenine dinucleotide, selenomethionine, F flavoprotein; HET: COA FAD; 1.90A {Bacillus anthracis str} PDB: 3cgc_A* 3cgd_A* 3cge_A* Length = 480 Back     alignment and structure
>3kd9_A Coenzyme A disulfide reductase; PSI-II, NYSGXRC, oxidoreductase, structural genomics structure initiative; 2.75A {Pyrococcus horikoshii} Length = 449 Back     alignment and structure
>2bc0_A NADH oxidase; flavoprotein, pyridine nucleotide disulfide oxidoreductase, C(4A)-peroxyflavin, crystallography, conformational dynamics; HET: FAD; 2.00A {Streptococcus pyogenes} PDB: 2bcp_A* 2bc1_A* Length = 490 Back     alignment and structure
>3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris} Length = 472 Back     alignment and structure
>1nhp_A NADH peroxidase; oxidoreductase (H2O2(A)); HET: FAD; 2.00A {Enterococcus faecalis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1npx_A* 1joa_A* 2npx_A* 1nhq_A* 1nhs_A* 1nhr_A* 1f8w_A* Length = 447 Back     alignment and structure
>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Length = 588 Back     alignment and structure
>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* Length = 565 Back     alignment and structure
>1yqz_A Coenzyme A disulfide reductase; oxidoreductase; HET: COA FAD; 1.54A {Staphylococcus aureus} Length = 438 Back     alignment and structure
>2v3a_A Rubredoxin reductase; alkane degradation, NADH oxidoreductase, rubredoxin reductas NAD, flavoprotein, oxidoreductase; HET: FAD; 2.4A {Pseudomonas aeruginosa} PDB: 2v3b_A* Length = 384 Back     alignment and structure
>3klj_A NAD(FAD)-dependent dehydrogenase, NIRB-family (N- domain); FAD-binding protein, GR-fold, oxidoreductase; HET: FAD; 2.10A {Clostridium acetobutylicum} Length = 385 Back     alignment and structure
>3fg2_P Putative rubredoxin reductase; ferredoxin reductase, RPA3782, F flavoprotein, oxidoreductase; HET: FAD; 2.20A {Rhodopseudomonas palustris} Length = 404 Back     alignment and structure
>1xhc_A NADH oxidase /nitrite reductase; southe collaboratory for structural genomics, secsg, hyperthermoph protein structure initiative, PSI; HET: FAD; 2.35A {Pyrococcus furiosus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Length = 367 Back     alignment and structure
>3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans} Length = 415 Back     alignment and structure
>3ef6_A Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase; FAD binding protein, NADH binding protein, aromatic hydrocar catabolism, FAD; HET: FAD; 1.80A {Pseudomonas putida} Length = 410 Back     alignment and structure
>1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A* Length = 431 Back     alignment and structure
>4fk1_A Putative thioredoxin reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MSE FAD; 2.40A {Bacillus anthracis} PDB: 4fk1_C* Length = 304 Back     alignment and structure
>1m6i_A Programmed cell death protein 8; apoptosis, AIF, oxidoreductase; HET: FAD; 1.80A {Homo sapiens} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 3gd3_A* 3gd4_A* 1gv4_A* Length = 493 Back     alignment and structure
>2gqw_A Ferredoxin reductase; flavoprotein, oxidoreductase; HET: FAD; 1.40A {Pseudomonas SP} PDB: 1f3p_A* 1d7y_A* 2gr0_A* 2gr1_A* 2gr2_A* 2yvf_A* 2yvg_A* 2yvj_A* 2gr3_A* Length = 408 Back     alignment and structure
>3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} Length = 297 Back     alignment and structure
>3cty_A Thioredoxin reductase; FAD, oxidoreductase, flavin, flavoprotein; HET: FAD; 2.35A {Thermoplasma acidophilum} Length = 319 Back     alignment and structure
>3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} Length = 369 Back     alignment and structure
>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A Length = 521 Back     alignment and structure
>3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* Length = 323 Back     alignment and structure
>2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus} Length = 335 Back     alignment and structure
>1fl2_A Alkyl hydroperoxide reductase subunit F; reactive oxygen, FAD, disulphi oxidoreductase, oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 Length = 310 Back     alignment and structure
>3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A* Length = 332 Back     alignment and structure
>3r9u_A Thioredoxin reductase; structural genomics, center for structural genomics of infec diseases, csgid, thioredoxin-disulfide reductase, FAD; HET: FAD; 2.36A {Campylobacter jejuni} Length = 315 Back     alignment and structure
>2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A* Length = 311 Back     alignment and structure
>3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum} Length = 360 Back     alignment and structure
>2q7v_A Thioredoxin reductase; rossman fold, FAD, flavoprotein, oxidoreductase, redox- active center; HET: FAD; 1.90A {Deinococcus radiodurans} Length = 325 Back     alignment and structure
>1vdc_A NTR, NADPH dependent thioredoxin reductase; hypothetical protein, redox-active center, oxidoreductase, D oxidoreductase; HET: FAD; 2.50A {Arabidopsis thaliana} SCOP: c.3.1.5 c.3.1.5 PDB: 2whd_A* Length = 333 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A* Length = 463 Back     alignment and structure
>1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 Length = 671 Back     alignment and structure
>2a87_A TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TLS, oxidoreduct structural genomics, PSI, protein structure initiative; HET: FAD NAP; 3.00A {Mycobacterium tuberculosis} Length = 335 Back     alignment and structure
>3h8l_A NADH oxidase; membrane protein, complete form, rossman-like fold, oxidoreductase; HET: FAD; 2.57A {Acidianus ambivalens} PDB: 3h8i_A* Length = 409 Back     alignment and structure
>3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A* Length = 338 Back     alignment and structure
>1o94_A Tmadh, trimethylamine dehydrogenase; electron transport, protein complex; HET: FMN ADP AMP; 2.0A {Methylophilus methylotrophus} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 PDB: 1djn_A* 1o95_A* 2tmd_A* 1djq_A* Length = 729 Back     alignment and structure
>3k30_A Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP binding site, oxidoreductase; HET: FMN ADP; 2.70A {Pimelobacter simplex} Length = 690 Back     alignment and structure
>1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* Length = 1025 Back     alignment and structure
>1trb_A Thioredoxin reductase; oxidoreductase(flavoenzyme); HET: FAD; 2.00A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 PDB: 1cl0_A* 1f6m_A* 1tdf_A* 1tde_A* Length = 320 Back     alignment and structure
>4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} Length = 357 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query551
4b1b_A542 TRXR, thioredoxin reductase; oxidoreductase, FAD, 100.0
4dna_A463 Probable glutathione reductase; structural genomic 100.0
2wpf_A495 Trypanothione reductase; oxidoreductase, trypanoso 100.0
3o0h_A484 Glutathione reductase; ssgcid, structur genomics, 100.0
1ges_A450 Glutathione reductase; oxidoreductase(flavoenzyme) 100.0
3dk9_A478 Grase, GR, glutathione reductase; flavoenzyme, nic 100.0
1fec_A490 Trypanothione reductase; redox-active center, oxid 100.0
2r9z_A463 Glutathione amide reductase; NAD, FAD, substrate s 100.0
3dgz_A488 Thioredoxin reductase 2; oxidoreductase, rossmann, 100.0
3ic9_A492 Dihydrolipoamide dehydrogenase; APC62701, colwelli 100.0
3dgh_A483 TRXR-1, thioredoxin reductase 1, mitochondrial; ox 100.0
3qfa_A519 Thioredoxin reductase 1, cytoplasmic; protein-prot 100.0
2hqm_A479 GR, grase, glutathione reductase; glutathione redu 100.0
1onf_A500 GR, grase, glutathione reductase; oxidoreductase; 100.0
3urh_A491 Dihydrolipoyl dehydrogenase; PSI-biology, structur 100.0
3l8k_A466 Dihydrolipoyl dehydrogenase; redox-active center, 100.0
3lad_A476 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 100.0
1ojt_A482 Surface protein; redox-active center, glycolysis, 100.0
2eq6_A464 Pyruvate dehydrogenase complex, dihydrolipoamide d 100.0
2qae_A468 Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystin 100.0
1ebd_A455 E3BD, dihydrolipoamide dehydrogenase; redox-active 100.0
1xdi_A499 RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno fun 100.0
1zmd_A474 Dihydrolipoyl dehydrogenase; lipoamide dehydrogena 100.0
2a8x_A464 Dihydrolipoyl dehydrogenase, E3 component of alpha 100.0
1dxl_A470 Dihydrolipoamide dehydrogenase; oxidoreductase, mu 100.0
1zk7_A467 HGII, reductase, mercuric reductase; mercuric ION 100.0
1lvl_A458 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 100.0
1mo9_A523 ORF3; nucleotide binding motifs, nucleotide bindin 100.0
2yqu_A455 2-oxoglutarate dehydrogenase E3 component; lipoami 100.0
1v59_A478 Dihydrolipoamide dehydrogenase; 2-oxoacid dehydrog 100.0
2x8g_A598 Thioredoxin glutathione reductase; redox-active ce 100.0
4eqs_A437 Coenzyme A disulfide reductase; oxidoreductase; HE 100.0
3oc4_A452 Oxidoreductase, pyridine nucleotide-disulfide FAM; 100.0
3kd9_A449 Coenzyme A disulfide reductase; PSI-II, NYSGXRC, o 100.0
2cdu_A452 NADPH oxidase; flavoenzyme, oxidoreductase; HET: F 100.0
3iwa_A472 FAD-dependent pyridine nucleotide-disulphide oxido 100.0
2bc0_A490 NADH oxidase; flavoprotein, pyridine nucleotide di 100.0
1nhp_A447 NADH peroxidase; oxidoreductase (H2O2(A)); HET: FA 100.0
3cgb_A480 Pyridine nucleotide-disulfide oxidoreductase, CLA; 100.0
3ics_A588 Coenzyme A-disulfide reductase; pyridine nucleotid 100.0
3ntd_A565 FAD-dependent pyridine nucleotide-disulphide oxido 100.0
2v3a_A384 Rubredoxin reductase; alkane degradation, NADH oxi 100.0
3klj_A385 NAD(FAD)-dependent dehydrogenase, NIRB-family (N- 100.0
1xhc_A367 NADH oxidase /nitrite reductase; southe collaborat 100.0
1q1r_A431 Putidaredoxin reductase; glutathione reductase fol 100.0
2gqw_A408 Ferredoxin reductase; flavoprotein, oxidoreductase 100.0
3lxd_A415 FAD-dependent pyridine nucleotide-disulphide oxido 100.0
3ef6_A410 Toluene 1,2-dioxygenase system ferredoxin--NAD(+) 100.0
3fg2_P404 Putative rubredoxin reductase; ferredoxin reductas 100.0
4gcm_A312 TRXR, thioredoxin reductase; FAD/NAD-linked reduct 100.0
4a5l_A314 Thioredoxin reductase; oxidoreductase, redox metab 100.0
1m6i_A493 Programmed cell death protein 8; apoptosis, AIF, o 100.0
2q7v_A325 Thioredoxin reductase; rossman fold, FAD, flavopro 100.0
2q0l_A311 TRXR, thioredoxin reductase; bacterial thiredoxin 100.0
3cty_A319 Thioredoxin reductase; FAD, oxidoreductase, flavin 100.0
3r9u_A315 Thioredoxin reductase; structural genomics, center 100.0
4fk1_A304 Putative thioredoxin reductase; structural genomic 100.0
3f8d_A323 Thioredoxin reductase (TRXB-3); redox protein, nuc 100.0
1trb_A320 Thioredoxin reductase; oxidoreductase(flavoenzyme) 100.0
1fl2_A310 Alkyl hydroperoxide reductase subunit F; reactive 100.0
2zbw_A335 Thioredoxin reductase; redox protein, oxidoreducta 100.0
3fbs_A297 Oxidoreductase; structural genomics, PSI2, MCSG, p 100.0
2a87_A335 TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TL 100.0
3ab1_A360 Ferredoxin--NADP reductase; oxidoreductase, electr 100.0
3itj_A338 Thioredoxin reductase 1; disulfide B flavoprotein, 100.0
3lzw_A332 Ferredoxin--NADP reductase 2; ferredoxin reductase 100.0
4g6h_A502 Rotenone-insensitive NADH-ubiquinone oxidoreducta 100.0
1vdc_A333 NTR, NADPH dependent thioredoxin reductase; hypoth 100.0
1hyu_A521 AHPF, alkyl hydroperoxide reductase subunit F; thi 100.0
3d1c_A369 Flavin-containing putative monooxygenase; NP_37310 100.0
4a9w_A357 Monooxygenase; baeyer-villiger, FAD, oxidoreductas 100.0
2vdc_G456 Glutamate synthase [NADPH] small chain; oxidoreduc 100.0
3sx6_A437 Sulfide-quinone reductase, putative; sulfide:quino 100.0
1gte_A 1025 Dihydropyrimidine dehydrogenase; electron transfer 100.0
2xve_A464 Flavin-containing monooxygenase; oxidoreductase; H 99.98
3h8l_A409 NADH oxidase; membrane protein, complete form, ros 99.98
3vrd_B401 FCCB subunit, flavocytochrome C flavin subunit; su 99.97
1lqt_A456 FPRA; NADP+ derivative, oxidoreductase, structural 99.97
1cjc_A460 Protein (adrenodoxin reductase); flavoenzyme, MAD 99.97
2gv8_A447 Monooxygenase; FMO, FAD, NADPH, cofactor complex, 99.97
3h28_A430 Sulfide-quinone reductase; monotopic membrane prot 99.97
3hyw_A430 Sulfide-quinone reductase; monotopic membrane prot 99.97
1o94_A729 Tmadh, trimethylamine dehydrogenase; electron tran 99.97
3k30_A690 Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP bi 99.96
2gag_A 965 Heterotetrameric sarcosine oxidase alpha-subunit; 99.96
3s5w_A463 L-ornithine 5-monooxygenase; class B flavin depend 99.96
1ps9_A671 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel 99.96
3gwf_A540 Cyclohexanone monooxygenase; flavoprotein biocatal 99.95
1y56_A493 Hypothetical protein PH1363; dehydrogenase, protei 99.95
3uox_A545 Otemo; baeyer-villiger monooxygenase, oxidoreducta 99.94
4ap3_A549 Steroid monooxygenase; oxidoreductase, baeyer-vill 99.93
1w4x_A542 Phenylacetone monooxygenase; baeyer-villiger, FAD; 99.91
2ywl_A180 Thioredoxin reductase related protein; uncharacter 99.9
2e5v_A472 L-aspartate oxidase; archaea, oxidoreductase; HET: 99.81
4b63_A501 L-ornithine N5 monooxygenase; oxidoreductase, side 99.79
3fpz_A326 Thiazole biosynthetic enzyme; FAD, mitochondrion, 99.68
2gqf_A401 Hypothetical protein HI0933; structural genomics, 99.67
2cul_A232 Glucose-inhibited division protein A-related PROT 99.62
3k7m_X431 6-hydroxy-L-nicotine oxidase; enantiomeric substra 99.6
3ces_A 651 MNMG, tRNA uridine 5-carboxymethylaminomethyl modi 99.46
2zxi_A 637 TRNA uridine 5-carboxymethylaminomethyl modificat 99.33
1rp0_A284 ARA6, thiazole biosynthetic enzyme; protein ligand 99.27
3dme_A369 Conserved exported protein; structural genomics, P 99.24
3v76_A417 Flavoprotein; structural genomics, PSI-biology, NE 99.16
1ryi_A382 Glycine oxidase; flavoprotein, protein-inhibitor c 99.07
1kf6_A 602 Fumarate reductase flavoprotein; respiration, fuma 99.06
3nlc_A549 Uncharacterized protein VP0956; FAD-binding protei 99.05
1y56_B382 Sarcosine oxidase; dehydrogenase, protein-protein 99.05
2gf3_A389 MSOX, monomeric sarcosine oxidase; flavoprotein ox 99.05
3ps9_A676 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 99.04
1chu_A540 Protein (L-aspartate oxidase); flavoenzyme, NAD bi 99.03
3pvc_A689 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 99.03
2gag_B405 Heterotetrameric sarcosine oxidase beta-subunit; f 99.02
2oln_A397 NIKD protein; flavoprotein, rossmann fold, oxidore 99.02
3dje_A438 Fructosyl amine: oxygen oxidoreductase; fructosyl- 99.0
3cp8_A 641 TRNA uridine 5-carboxymethylaminomethyl modificati 98.99
3nix_A421 Flavoprotein/dehydrogenase; structural genomics, P 98.97
2i0z_A447 NAD(FAD)-utilizing dehydrogenases; structural geno 98.97
2uzz_A372 N-methyl-L-tryptophan oxidase; N-methyltryptophan 98.91
4dgk_A501 Phytoene dehydrogenase; the FAD/NAD(P)-binding ros 98.89
3i3l_A 591 Alkylhalidase CMLS; flavin-dependent halogenase, c 98.84
3gyx_A 662 Adenylylsulfate reductase; oxidoreductase; HET: FA 98.83
3cgv_A397 Geranylgeranyl reductase related protein; NP_39399 98.82
3axb_A448 Putative oxidoreductase; dinucleotide-binding fold 98.82
2cul_A232 Glucose-inhibited division protein A-related PROT 98.82
1pj5_A 830 N,N-dimethylglycine oxidase; channelling, FAD bind 98.8
3ka7_A425 Oxidoreductase; structural genomics, PSI-2, protei 98.8
3nyc_A381 D-arginine dehydrogenase; FAD, imino-arginine, oxi 98.78
4at0_A510 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidore 98.77
3rp8_A407 Flavoprotein monooxygenase; FAD-binding protein, o 98.76
1qo8_A566 Flavocytochrome C3 fumarate reductase; oxidoreduct 98.76
1s3e_A520 Amine oxidase [flavin-containing] B; human monoami 98.76
3nrn_A421 Uncharacterized protein PF1083; alpha-beta protein 98.75
2bry_A497 NEDD9 interacting protein with calponin homology a 98.74
4gut_A776 Lysine-specific histone demethylase 1B; histone de 98.74
3oz2_A397 Digeranylgeranylglycerophospholipid reductase; str 98.74
1y0p_A571 Fumarate reductase flavoprotein subunit; flavocyto 98.73
4a9w_A357 Monooxygenase; baeyer-villiger, FAD, oxidoreductas 98.72
2ywl_A180 Thioredoxin reductase related protein; uncharacter 98.71
1rp0_A284 ARA6, thiazole biosynthetic enzyme; protein ligand 98.69
3e1t_A 512 Halogenase; flavoprotein; HET: FAD; 2.05A {Chondro 98.66
3da1_A 561 Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9 98.66
3qj4_A342 Renalase; FAD/NAD(P)-binding rossmann fold superfa 98.65
2gmh_A 584 Electron transfer flavoprotein-ubiquinone oxidored 98.62
3jsk_A344 Cypbp37 protein; octameric thiazole synthase, bios 98.62
1d4d_A572 Flavocytochrome C fumarate reductase; oxidoreducta 98.61
2bry_A497 NEDD9 interacting protein with calponin homology a 98.61
3lzw_A332 Ferredoxin--NADP reductase 2; ferredoxin reductase 98.6
2wdq_A 588 Succinate dehydrogenase flavoprotein subunit; succ 98.6
3nks_A477 Protoporphyrinogen oxidase; FAD containing protein 98.59
3kkj_A336 Amine oxidase, flavin-containing; oxidoreductase, 98.59
3f8d_A323 Thioredoxin reductase (TRXB-3); redox protein, nuc 98.58
2vvm_A495 Monoamine oxidase N; FAD, peroxisome, flavoprotein 98.58
3fmw_A 570 Oxygenase; mithramycin, baeyer-villiger, flavin bi 98.57
2qa1_A 500 PGAE, polyketide oxygenase PGAE; FAD, angucycline, 98.56
3p1w_A475 Rabgdi protein; GDI RAB, malaria, structural genom 98.55
2e4g_A550 Tryptophan halogenase; flavin-binding, rebeccamyci 98.55
2zbw_A335 Thioredoxin reductase; redox protein, oxidoreducta 98.55
3ab1_A360 Ferredoxin--NADP reductase; oxidoreductase, electr 98.54
2qa2_A 499 CABE, polyketide oxygenase CABE; FAD, angucycline, 98.54
3c96_A410 Flavin-containing monooxygenase; FAD, oxidoreducta 98.52
3fbs_A297 Oxidoreductase; structural genomics, PSI2, MCSG, p 98.51
3i6d_A470 Protoporphyrinogen oxidase; protein-inhibitor comp 98.5
3itj_A338 Thioredoxin reductase 1; disulfide B flavoprotein, 98.5
2q0l_A311 TRXR, thioredoxin reductase; bacterial thiredoxin 98.49
3c4n_A405 Uncharacterized protein DR_0571; alpha-beta protei 98.49
2gjc_A326 Thiazole biosynthetic enzyme, mitochondrial; gluta 98.47
2aqj_A538 Tryptophan halogenase, pRNA; flavin-dependent halo 98.46
2h88_A 621 Succinate dehydrogenase flavoprotein subunit; comp 98.45
2gqf_A401 Hypothetical protein HI0933; structural genomics, 98.45
3klj_A385 NAD(FAD)-dependent dehydrogenase, NIRB-family (N- 98.44
3alj_A379 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; 98.44
2qcu_A501 Aerobic glycerol-3-phosphate dehydrogenase; glycer 98.43
1fl2_A310 Alkyl hydroperoxide reductase subunit F; reactive 98.41
3d1c_A369 Flavin-containing putative monooxygenase; NP_37310 98.41
3alj_A379 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; 98.4
2q7v_A325 Thioredoxin reductase; rossman fold, FAD, flavopro 98.39
1vdc_A333 NTR, NADPH dependent thioredoxin reductase; hypoth 98.39
2pyx_A526 Tryptophan halogenase; structural genomics, JOI fo 98.39
2x3n_A399 Probable FAD-dependent monooxygenase; oxidoreducta 98.38
3sx6_A 437 Sulfide-quinone reductase, putative; sulfide:quino 98.37
2weu_A511 Tryptophan 5-halogenase; regioselectivity, antifun 98.37
4fk1_A304 Putative thioredoxin reductase; structural genomic 98.36
4ap3_A 549 Steroid monooxygenase; oxidoreductase, baeyer-vill 98.35
2bs2_A 660 Quinol-fumarate reductase flavoprotein subunit A; 98.35
3gwf_A 540 Cyclohexanone monooxygenase; flavoprotein biocatal 98.35
3hyw_A 430 Sulfide-quinone reductase; monotopic membrane prot 98.34
2gv8_A447 Monooxygenase; FMO, FAD, NADPH, cofactor complex, 98.34
2x3n_A399 Probable FAD-dependent monooxygenase; oxidoreducta 98.3
2rgh_A 571 Alpha-glycerophosphate oxidase; flavoprotein oxida 98.3
1jnr_A 643 Adenylylsulfate reductase; oxidoreductase; HET: FA 98.3
3cty_A319 Thioredoxin reductase; FAD, oxidoreductase, flavin 98.29
3atr_A453 Conserved archaeal protein; saturating double bond 98.28
1trb_A320 Thioredoxin reductase; oxidoreductase(flavoenzyme) 98.27
1yvv_A336 Amine oxidase, flavin-containing; oxidoreductase, 98.27
3h8l_A409 NADH oxidase; membrane protein, complete form, ros 98.27
2vou_A397 2,6-dihydroxypyridine hydroxylase; oxidoreductase, 98.27
1q1r_A 431 Putidaredoxin reductase; glutathione reductase fol 98.27
3ihg_A535 RDME; flavoenzyme, anthracycline, polyketide biosy 98.26
3r9u_A315 Thioredoxin reductase; structural genomics, center 98.26
2xdo_A398 TETX2 protein; tetracycline degradation, tigecycli 98.26
2xve_A464 Flavin-containing monooxygenase; oxidoreductase; H 98.26
3ef6_A410 Toluene 1,2-dioxygenase system ferredoxin--NAD(+) 98.26
3h28_A 430 Sulfide-quinone reductase; monotopic membrane prot 98.26
2dkh_A 639 3-hydroxybenzoate hydroxylase; flavoprotein, monoo 98.25
1hyu_A521 AHPF, alkyl hydroperoxide reductase subunit F; thi 98.25
2r0c_A 549 REBC; flavin adenine dinucleotide, monooxygenase, 98.23
2a87_A335 TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TL 98.23
3vrd_B401 FCCB subunit, flavocytochrome C flavin subunit; su 98.23
3fg2_P404 Putative rubredoxin reductase; ferredoxin reductas 98.22
1xhc_A367 NADH oxidase /nitrite reductase; southe collaborat 98.22
3uox_A 545 Otemo; baeyer-villiger monooxygenase, oxidoreducta 98.22
4a5l_A314 Thioredoxin reductase; oxidoreductase, redox metab 98.21
3ces_A 651 MNMG, tRNA uridine 5-carboxymethylaminomethyl modi 98.21
1k0i_A394 P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, h 98.2
3lxd_A415 FAD-dependent pyridine nucleotide-disulphide oxido 98.19
4gde_A513 UDP-galactopyranose mutase; flavin adenine dinucle 98.18
3g5s_A443 Methylenetetrahydrofolate--tRNA-(uracil-5-)- methy 98.15
3kd9_A 449 Coenzyme A disulfide reductase; PSI-II, NYSGXRC, o 98.13
2bcg_G453 Secretory pathway GDP dissociation inhibitor; RABG 98.13
1k0i_A394 P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, h 98.13
2zxi_A 637 TRNA uridine 5-carboxymethylaminomethyl modificat 98.12
1v0j_A399 UDP-galactopyranose mutase; flavoprotein, isomeras 98.12
3cp8_A 641 TRNA uridine 5-carboxymethylaminomethyl modificati 98.11
3oc4_A 452 Oxidoreductase, pyridine nucleotide-disulfide FAM; 98.1
2vou_A397 2,6-dihydroxypyridine hydroxylase; oxidoreductase, 98.09
4gcm_A312 TRXR, thioredoxin reductase; FAD/NAD-linked reduct 98.09
3atr_A453 Conserved archaeal protein; saturating double bond 98.08
4hb9_A412 Similarities with probable monooxygenase; flavin, 98.07
2gqw_A408 Ferredoxin reductase; flavoprotein, oxidoreductase 98.05
2xdo_A398 TETX2 protein; tetracycline degradation, tigecycli 98.04
1w4x_A 542 Phenylacetone monooxygenase; baeyer-villiger, FAD; 98.04
2e1m_A376 L-glutamate oxidase; L-amino acid oxidase, FAD, L- 98.02
3ics_A 588 Coenzyme A-disulfide reductase; pyridine nucleotid 98.02
3ihg_A 535 RDME; flavoenzyme, anthracycline, polyketide biosy 98.01
2b9w_A424 Putative aminooxidase; isomerase, conjugated linol 98.0
3hdq_A397 UDP-galactopyranose mutase; substrate and inhibito 97.99
1yvv_A336 Amine oxidase, flavin-containing; oxidoreductase, 97.98
3ntd_A 565 FAD-dependent pyridine nucleotide-disulphide oxido 97.98
3s5w_A463 L-ornithine 5-monooxygenase; class B flavin depend 97.97
3iwa_A 472 FAD-dependent pyridine nucleotide-disulphide oxido 97.96
1c0p_A363 D-amino acid oxidase; alpha-beta-alpha motif, flav 97.93
2cdu_A 452 NADPH oxidase; flavoenzyme, oxidoreductase; HET: F 97.92
1rsg_A516 FMS1 protein; FAD binding motif, oxidoreductase; H 97.91
1nhp_A 447 NADH peroxidase; oxidoreductase (H2O2(A)); HET: FA 97.91
2bc0_A 490 NADH oxidase; flavoprotein, pyridine nucleotide di 97.91
4g6h_A 502 Rotenone-insensitive NADH-ubiquinone oxidoreducta 97.89
3ihm_A430 Styrene monooxygenase A; rossman fold, anti-parall 97.89
1pn0_A 665 Phenol 2-monooxygenase; two dimers, TLS refinement 97.89
2jae_A489 L-amino acid oxidase; oxidoreductase, dimerisation 97.88
2yg5_A453 Putrescine oxidase; oxidoreductase, flavin; HET: F 97.88
2ivd_A478 PPO, PPOX, protoporphyrinogen oxidase; porphyrin b 97.88
1i8t_A367 UDP-galactopyranose mutase; rossman fold, FAD, con 97.87
1sez_A504 Protoporphyrinogen oxidase, mitochondrial; FAD-bin 97.87
2vdc_G456 Glutamate synthase [NADPH] small chain; oxidoreduc 97.87
1d5t_A433 Guanine nucleotide dissociation inhibitor; ultra-h 97.85
3cgb_A 480 Pyridine nucleotide-disulfide oxidoreductase, CLA; 97.85
3l8k_A 466 Dihydrolipoyl dehydrogenase; redox-active center, 97.82
1m6i_A 493 Programmed cell death protein 8; apoptosis, AIF, o 97.81
3pl8_A623 Pyranose 2-oxidase; substrate complex, H167A mutan 97.8
4eqs_A 437 Coenzyme A disulfide reductase; oxidoreductase; HE 97.8
2qae_A 468 Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystin 97.79
2bi7_A384 UDP-galactopyranose mutase; FAD, flavoprotein, iso 97.74
3lov_A475 Protoporphyrinogen oxidase; structural genomics, J 97.73
1zk7_A 467 HGII, reductase, mercuric reductase; mercuric ION 97.73
1zmd_A 474 Dihydrolipoyl dehydrogenase; lipoamide dehydrogena 97.73
4dsg_A484 UDP-galactopyranose mutase; rossmann fold, flavin 97.72
1dxl_A 470 Dihydrolipoamide dehydrogenase; oxidoreductase, mu 97.71
1ebd_A 455 E3BD, dihydrolipoamide dehydrogenase; redox-active 97.71
1ojt_A 482 Surface protein; redox-active center, glycolysis, 97.7
1v59_A 478 Dihydrolipoamide dehydrogenase; 2-oxoacid dehydrog 97.69
1y56_A493 Hypothetical protein PH1363; dehydrogenase, protei 97.68
2hqm_A 479 GR, grase, glutathione reductase; glutathione redu 97.67
2iid_A498 L-amino-acid oxidase; flavoenzyme, FAD binding dom 97.67
2a8x_A 464 Dihydrolipoyl dehydrogenase, E3 component of alpha 97.67
1cjc_A 460 Protein (adrenodoxin reductase); flavoenzyme, MAD 97.65
3urh_A 491 Dihydrolipoyl dehydrogenase; PSI-biology, structur 97.65
2aqj_A 538 Tryptophan halogenase, pRNA; flavin-dependent halo 97.63
2yqu_A 455 2-oxoglutarate dehydrogenase E3 component; lipoami 97.62
1lvl_A458 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 97.62
1xdi_A 499 RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno fun 97.61
2v3a_A384 Rubredoxin reductase; alkane degradation, NADH oxi 97.61
3jsk_A344 Cypbp37 protein; octameric thiazole synthase, bios 97.56
1b37_A472 Protein (polyamine oxidase); flavin-dependent amin 97.55
1ges_A450 Glutathione reductase; oxidoreductase(flavoenzyme) 97.52
1lqt_A 456 FPRA; NADP+ derivative, oxidoreductase, structural 97.51
1mo9_A 523 ORF3; nucleotide binding motifs, nucleotide bindin 97.51
4hb9_A412 Similarities with probable monooxygenase; flavin, 97.51
3qfa_A 519 Thioredoxin reductase 1, cytoplasmic; protein-prot 97.47
1gte_A 1025 Dihydropyrimidine dehydrogenase; electron transfer 97.47
2r9z_A 463 Glutathione amide reductase; NAD, FAD, substrate s 97.46
2eq6_A 464 Pyruvate dehydrogenase complex, dihydrolipoamide d 97.45
3o0h_A 484 Glutathione reductase; ssgcid, structur genomics, 97.44
3lad_A 476 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 97.43
3g3e_A351 D-amino-acid oxidase; FAD, flavoprotein, oxidoredu 97.43
2z3y_A662 Lysine-specific histone demethylase 1; chromatin, 97.42
1onf_A500 GR, grase, glutathione reductase; oxidoreductase; 97.4
3c4a_A381 Probable tryptophan hydroxylase VIOD; alpha-beta p 97.38
2e5v_A472 L-aspartate oxidase; archaea, oxidoreductase; HET: 97.38
1fec_A 490 Trypanothione reductase; redox-active center, oxid 97.37
4dna_A 463 Probable glutathione reductase; structural genomic 97.36
2gag_A 965 Heterotetrameric sarcosine oxidase alpha-subunit; 97.35
1ps9_A671 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel 97.35
2xag_A852 Lysine-specific histone demethylase 1; amine oxida 97.35
3dk9_A 478 Grase, GR, glutathione reductase; flavoenzyme, nic 97.33
2wpf_A495 Trypanothione reductase; oxidoreductase, trypanoso 97.3
4b1b_A542 TRXR, thioredoxin reductase; oxidoreductase, FAD, 97.28
3dgh_A 483 TRXR-1, thioredoxin reductase 1, mitochondrial; ox 97.27
3k30_A690 Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP bi 97.26
3dgz_A 488 Thioredoxin reductase 2; oxidoreductase, rossmann, 97.23
2x8g_A 598 Thioredoxin glutathione reductase; redox-active ce 97.15
1kf6_A 602 Fumarate reductase flavoprotein; respiration, fuma 97.13
1kdg_A546 CDH, cellobiose dehydrogenase; GMC oxidoreductase, 97.1
1o94_A729 Tmadh, trimethylamine dehydrogenase; electron tran 97.08
3ic9_A492 Dihydrolipoamide dehydrogenase; APC62701, colwelli 97.04
3t37_A526 Probable dehydrogenase; BET alpha beta fold, ADP b 97.0
1ju2_A536 HydroxynitrIle lyase; flavin, GMC oxidoreductase, 96.96
3q9t_A577 Choline dehydrogenase and related flavoproteins; g 96.93
3c4a_A381 Probable tryptophan hydroxylase VIOD; alpha-beta p 96.91
4gde_A 513 UDP-galactopyranose mutase; flavin adenine dinucle 96.9
1coy_A507 Cholesterol oxidase; oxidoreductase(oxygen recepto 96.75
1vg0_A650 RAB proteins geranylgeranyltransferase component A 96.71
3qvp_A583 Glucose oxidase; oxidoreductase; HET: NAG BMA MAN 96.68
1chu_A 540 Protein (L-aspartate oxidase); flavoenzyme, NAD bi 96.67
3ayj_A 721 Pro-enzyme of L-phenylalanine oxidase; amino acid 96.67
1n4w_A504 CHOD, cholesterol oxidase; flavoenzyme, steroid me 96.54
3fim_B566 ARYL-alcohol oxidase; AAO, lignin degradation, oxi 96.51
3pl8_A 623 Pyranose 2-oxidase; substrate complex, H167A mutan 96.33
1gpe_A587 Protein (glucose oxidase); oxidoreductase(flavopro 96.25
2jbv_A546 Choline oxidase; alcohol oxidation, flavoenyzme ox 96.21
4b63_A501 L-ornithine N5 monooxygenase; oxidoreductase, side 96.08
3kkj_A336 Amine oxidase, flavin-containing; oxidoreductase, 95.38
3gyx_A 662 Adenylylsulfate reductase; oxidoreductase; HET: FA 95.05
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 94.32
4dgk_A 501 Phytoene dehydrogenase; the FAD/NAD(P)-binding ros 94.25
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 94.2
3dfz_A223 SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase 94.13
1lss_A140 TRK system potassium uptake protein TRKA homolog; 94.04
3rp8_A407 Flavoprotein monooxygenase; FAD-binding protein, o 93.81
2iid_A 498 L-amino-acid oxidase; flavoenzyme, FAD binding dom 93.77
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 93.61
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 93.6
3eag_A326 UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME 93.6
1id1_A153 Putative potassium channel protein; RCK domain, E. 93.54
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 93.51
3c96_A410 Flavin-containing monooxygenase; FAD, oxidoreducta 93.38
3lk7_A 451 UDP-N-acetylmuramoylalanine--D-glutamate ligase; a 93.36
3oz2_A397 Digeranylgeranylglycerophospholipid reductase; str 93.24
2bcg_G453 Secretory pathway GDP dissociation inhibitor; RABG 93.19
3ihm_A 430 Styrene monooxygenase A; rossman fold, anti-parall 93.15
1d5t_A433 Guanine nucleotide dissociation inhibitor; ultra-h 93.06
2qa2_A 499 CABE, polyketide oxygenase CABE; FAD, angucycline, 92.95
3nix_A 421 Flavoprotein/dehydrogenase; structural genomics, P 92.94
3i3l_A 591 Alkylhalidase CMLS; flavin-dependent halogenase, c 92.61
3hwr_A318 2-dehydropantoate 2-reductase; YP_299159.1, PANE/A 92.57
2qa1_A 500 PGAE, polyketide oxygenase PGAE; FAD, angucycline, 92.53
2r0c_A 549 REBC; flavin adenine dinucleotide, monooxygenase, 92.41
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 92.38
3nrn_A 421 Uncharacterized protein PF1083; alpha-beta protein 92.38
2pyx_A 526 Tryptophan halogenase; structural genomics, JOI fo 92.2
3fmw_A 570 Oxygenase; mithramycin, baeyer-villiger, flavin bi 92.04
2hmt_A144 YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane 92.02
3ka7_A 425 Oxidoreductase; structural genomics, PSI-2, protei 91.9
3fpz_A326 Thiazole biosynthetic enzyme; FAD, mitochondrion, 91.85
4e12_A283 Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1 91.61
1f0y_A302 HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive 91.5
3nks_A 477 Protoporphyrinogen oxidase; FAD containing protein 91.49
3dme_A369 Conserved exported protein; structural genomics, P 91.45
3k7m_X 431 6-hydroxy-L-nicotine oxidase; enantiomeric substra 91.44
3dfz_A223 SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase 91.37
3v76_A417 Flavoprotein; structural genomics, PSI-biology, NE 91.33
2jae_A 489 L-amino acid oxidase; oxidoreductase, dimerisation 91.33
2e1m_A376 L-glutamate oxidase; L-amino acid oxidase, FAD, L- 91.2
2oln_A397 NIKD protein; flavoprotein, rossmann fold, oxidore 91.18
1ryi_A382 Glycine oxidase; flavoprotein, protein-inhibitor c 91.07
3l4b_C218 TRKA K+ channel protien TM1088B; potassium channel 90.97
3cgv_A397 Geranylgeranyl reductase related protein; NP_39399 90.9
2b9w_A424 Putative aminooxidase; isomerase, conjugated linol 90.84
2dkh_A 639 3-hydroxybenzoate hydroxylase; flavoprotein, monoo 90.83
1kyq_A274 Met8P, siroheme biosynthesis protein Met8; homodim 90.83
2e4g_A 550 Tryptophan halogenase; flavin-binding, rebeccamyci 90.81
2uzz_A372 N-methyl-L-tryptophan oxidase; N-methyltryptophan 90.8
1t2d_A322 LDH-P, L-lactate dehydrogenase; ternary complex, o 90.79
3g5s_A 443 Methylenetetrahydrofolate--tRNA-(uracil-5-)- methy 90.79
2ewd_A317 Lactate dehydrogenase,; protein-substrate_cofactor 90.76
1c0p_A363 D-amino acid oxidase; alpha-beta-alpha motif, flav 90.74
2gf3_A389 MSOX, monomeric sarcosine oxidase; flavoprotein ox 90.72
2bs2_A 660 Quinol-fumarate reductase flavoprotein subunit A; 90.69
3c85_A183 Putative glutathione-regulated potassium-efflux S 90.63
3qj4_A342 Renalase; FAD/NAD(P)-binding rossmann fold superfa 90.61
3ado_A319 Lambda-crystallin; L-gulonate 3-dehydrogenase, str 90.4
1rsg_A 516 FMS1 protein; FAD binding motif, oxidoreductase; H 90.37
1vg0_A 650 RAB proteins geranylgeranyltransferase component A 90.32
4dio_A405 NAD(P) transhydrogenase subunit alpha PART 1; stru 90.3
2weu_A 511 Tryptophan 5-halogenase; regioselectivity, antifun 90.27
2x5o_A439 UDP-N-acetylmuramoylalanine--D-glutamate ligase; A 90.19
1b37_A472 Protein (polyamine oxidase); flavin-dependent amin 90.19
1y56_B382 Sarcosine oxidase; dehydrogenase, protein-protein 90.18
1pn0_A 665 Phenol 2-monooxygenase; two dimers, TLS refinement 90.17
1s3e_A 520 Amine oxidase [flavin-containing] B; human monoami 89.91
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 89.91
2bi7_A384 UDP-galactopyranose mutase; FAD, flavoprotein, iso 89.86
3lk7_A451 UDP-N-acetylmuramoylalanine--D-glutamate ligase; a 89.85
1bg6_A359 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L 89.82
3nyc_A381 D-arginine dehydrogenase; FAD, imino-arginine, oxi 89.56
3e1t_A 512 Halogenase; flavoprotein; HET: FAD; 2.05A {Chondro 89.49
2a9f_A398 Putative malic enzyme ((S)-malate:NAD+ oxidoreduct 89.48
2ivd_A 478 PPO, PPOX, protoporphyrinogen oxidase; porphyrin b 89.46
3i6d_A 470 Protoporphyrinogen oxidase; protein-inhibitor comp 89.41
3i83_A320 2-dehydropantoate 2-reductase; structural genomics 89.29
1sez_A 504 Protoporphyrinogen oxidase, mitochondrial; FAD-bin 89.2
3hn7_A 524 UDP-N-acetylmuramate-L-alanine ligase; ATP-binding 89.09
2yg5_A 453 Putrescine oxidase; oxidoreductase, flavin; HET: F 89.02
3hn2_A312 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, str 88.93
3dje_A 438 Fructosyl amine: oxygen oxidoreductase; fructosyl- 88.9
2gag_B405 Heterotetrameric sarcosine oxidase beta-subunit; f 88.79
3nlc_A 549 Uncharacterized protein VP0956; FAD-binding protei 88.71
4hv4_A 494 UDP-N-acetylmuramate--L-alanine ligase; MURC, yers 88.66
3k6j_A460 Protein F01G10.3, confirmed by transcript evidenc; 88.65
2ew2_A316 2-dehydropantoate 2-reductase, putative; alpha-str 88.64
3p2y_A381 Alanine dehydrogenase/pyridine nucleotide transhy; 88.62
1jnr_A 643 Adenylylsulfate reductase; oxidoreductase; HET: FA 88.61
3hdq_A397 UDP-galactopyranose mutase; substrate and inhibito 88.58
3ghy_A335 Ketopantoate reductase protein; oxidoreductase, NA 88.55
1lld_A319 L-lactate dehydrogenase; oxidoreductase(CHOH (D)-N 88.52
2i0z_A 447 NAD(FAD)-utilizing dehydrogenases; structural geno 88.45
3ps9_A676 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 88.38
2vvm_A 495 Monoamine oxidase N; FAD, peroxisome, flavoprotein 88.19
3pvc_A 689 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 88.16
3g3e_A351 D-amino-acid oxidase; FAD, flavoprotein, oxidoredu 88.08
1pzg_A331 LDH, lactate dehydrogenase; apicomplexa, APAD, tet 88.04
4g65_A461 TRK system potassium uptake protein TRKA; structur 87.89
2hjr_A328 Malate dehydrogenase; malaria, structural genomics 87.83
2qcu_A 501 Aerobic glycerol-3-phosphate dehydrogenase; glycer 87.75
1id1_A153 Putative potassium channel protein; RCK domain, E. 87.73
3gg2_A450 Sugar dehydrogenase, UDP-glucose/GDP-mannose dehyd 87.67
3c4n_A405 Uncharacterized protein DR_0571; alpha-beta protei 87.64
3ego_A307 Probable 2-dehydropantoate 2-reductase; structural 87.6
1vl6_A388 Malate oxidoreductase; TM0542, NAD-dependent malic 87.54
1ez4_A318 Lactate dehydrogenase; rossmann fold, oxidoreducta 87.51
1y6j_A318 L-lactate dehydrogenase; southeast collaboratory f 87.49
2raf_A209 Putative dinucleotide-binding oxidoreductase; NP_7 87.45
1v0j_A399 UDP-galactopyranose mutase; flavoprotein, isomeras 87.43
1x13_A401 NAD(P) transhydrogenase subunit alpha; NAD(H)-bind 87.41
1i8t_A367 UDP-galactopyranose mutase; rossman fold, FAD, con 87.36
1lss_A140 TRK system potassium uptake protein TRKA homolog; 87.32
2v6b_A304 L-LDH, L-lactate dehydrogenase; oxidoreductase, ra 87.21
2y0c_A478 BCEC, UDP-glucose dehydrogenase; oxidoreductase, c 87.2
3qha_A296 Putative oxidoreductase; seattle structural genomi 87.06
3eag_A326 UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME 87.05
1ur5_A309 Malate dehydrogenase; oxidoreductase, tricarboxyli 87.02
3ado_A319 Lambda-crystallin; L-gulonate 3-dehydrogenase, str 86.9
2rgh_A 571 Alpha-glycerophosphate oxidase; flavoprotein oxida 86.83
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 86.8
3tl2_A315 Malate dehydrogenase; center for structural genomi 86.77
2z3y_A 662 Lysine-specific histone demethylase 1; chromatin, 86.75
3g17_A294 Similar to 2-dehydropantoate 2-reductase; structur 86.73
2dpo_A319 L-gulonate 3-dehydrogenase; structural genomics, N 86.69
4ffl_A363 PYLC; amino acid, biosynthesis of pyrrolysine, iso 86.58
1y0p_A 571 Fumarate reductase flavoprotein subunit; flavocyto 86.54
1jw9_B249 Molybdopterin biosynthesis MOEB protein; MOEB: mod 86.38
2xag_A 852 Lysine-specific histone demethylase 1; amine oxida 86.35
3doj_A310 AT3G25530, dehydrogenase-like protein; gamma-hydro 86.31
1l7d_A384 Nicotinamide nucleotide transhydrogenase, subunit 86.28
3g79_A478 NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; 86.23
3hwr_A318 2-dehydropantoate 2-reductase; YP_299159.1, PANE/A 86.1
3k96_A356 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA 86.09
2q3e_A467 UDP-glucose 6-dehydrogenase; hexamer, structural g 86.07
2raf_A209 Putative dinucleotide-binding oxidoreductase; NP_7 86.03
1ks9_A291 KPA reductase;, 2-dehydropantoate 2-reductase; PAN 85.92
3da1_A 561 Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9 85.89
1pjc_A361 Protein (L-alanine dehydrogenase); oxidoreductase, 85.87
3lov_A475 Protoporphyrinogen oxidase; structural genomics, J 85.86
3axb_A 448 Putative oxidoreductase; dinucleotide-binding fold 85.84
3vtf_A444 UDP-glucose 6-dehydrogenase; two discrete alpha/be 85.72
3cky_A301 2-hydroxymethyl glutarate dehydrogenase; rossmann 85.38
1qo8_A 566 Flavocytochrome C3 fumarate reductase; oxidoreduct 85.29
3l9w_A413 Glutathione-regulated potassium-efflux system Pro 85.23
3ego_A307 Probable 2-dehydropantoate 2-reductase; structural 85.2
2gjc_A326 Thiazole biosynthetic enzyme, mitochondrial; gluta 84.97
4dsg_A 484 UDP-galactopyranose mutase; rossmann fold, flavin 84.93
2hmt_A144 YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane 84.87
3dhn_A227 NAD-dependent epimerase/dehydratase; reductase, PF 84.87
3gvi_A324 Malate dehydrogenase; NAD, oxidoreductase, tricarb 84.86
4e12_A283 Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1 84.76
3pqe_A326 L-LDH, L-lactate dehydrogenase; FBP, oxidoreductas 84.7
4e21_A358 6-phosphogluconate dehydrogenase (decarboxylating; 84.68
4at0_A 510 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidore 84.6
3oj0_A144 Glutr, glutamyl-tRNA reductase; structural genomic 84.56
1kyq_A274 Met8P, siroheme biosynthesis protein Met8; homodim 84.52
1zcj_A463 Peroxisomal bifunctional enzyme; peroxisomal multi 84.35
1z82_A335 Glycerol-3-phosphate dehydrogenase; TM0378, struct 84.31
3l4b_C218 TRKA K+ channel protien TM1088B; potassium channel 84.04
1y7t_A327 Malate dehydrogenase; NAD-dependent-MDH-NADPH comp 84.04
3p7m_A321 Malate dehydrogenase; putative dehydrogenase, enzy 83.9
1pjq_A457 CYSG, siroheme synthase; rossman fold, nucleotide 83.84
3pid_A432 UDP-glucose 6-dehydrogenase; rossmann fold, oxidor 83.82
2qrj_A394 Saccharopine dehydrogenase, NAD+, L-lysine- formin 83.82
1mv8_A436 GMD, GDP-mannose 6-dehydrogenase; rossman fold, do 83.81
2gmh_A 584 Electron transfer flavoprotein-ubiquinone oxidored 83.75
>4b1b_A TRXR, thioredoxin reductase; oxidoreductase, FAD, NADPH, thiol-mediated redox metabolism, pyridine nucleotide-disulfide oxidoreductase; HET: FAD; 2.90A {Plasmodium falciparum} Back     alignment and structure
Probab=100.00  E-value=2.8e-78  Score=643.43  Aligned_cols=452  Identities=35%  Similarity=0.611  Sum_probs=377.9

Q ss_pred             CccEEEECCChHHHHHHHHHHhCCCcEEEEccCCCCCCCCCCCCCCCeeccCCCcchHHHHHhhhhhhHhh-hccCCCcc
Q 008860           72 DFDLFTIGAGSGGVRASRFAANFGASVAICELPFSTISSETTGGVGGTCVLRGCVPKKLLVYASKFSHEFD-ESNGFGWK  150 (551)
Q Consensus        72 ~~dVvIIGgG~aGl~aA~~l~~~G~~V~liE~~~~~~~~~~~~~~GG~~~~~g~~p~~~l~~~~~~~~~~~-~~~~~g~~  150 (551)
                      +|||+|||||+||+.||.++++.|.+|+|||+.... ....++.+||+|+|+||+|+|.|+.+++..+..+ +...||+.
T Consensus        42 dYDviVIG~GpaG~~aA~~aa~~G~kValIE~~~~~-~~~~k~~lGGtCln~GCIPsK~L~~aa~~~~~~~~~~~~~Gi~  120 (542)
T 4b1b_A           42 DYDYVVIGGGPGGMASAKEAAAHGARVLLFDYVKPS-SQGTKWGIGGTCVNVGCVPKKLMHYAGHMGSIFKLDSKAYGWK  120 (542)
T ss_dssp             SEEEEEECCSHHHHHHHHHHHTTTCCEEEECCCCCC-TTCCCCCSSHHHHHHSHHHHHHHHHHHHHHHHHHHTGGGGTEE
T ss_pred             CCCEEEECCCHHHHHHHHHHHHCCCeEEEEeccccc-cccccCCCCCcccccchHHHHHHHHHHHHHHHHHhhhHhcCcc
Confidence            599999999999999999999999999999931100 0112456999999999999999999998887776 56678887


Q ss_pred             cCCCCCCChHHHHHHHHHHHHHHHHHHHHHHHhCCeEEEEeEEEEecCCEEEE-------cCEEEEeCeEEEcCCCCCCC
Q 008860          151 YGTEPQHDWSTLIANKNAELQRLTGIYKNILINAGITLIEGRGKIVDPHTVDV-------DGKLYSARHILISVGGRPFI  223 (551)
Q Consensus       151 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~~~~~i~~~~v~v-------~g~~~~~d~lviAtG~~p~~  223 (551)
                      .. ...+||..++.+.+..++++...+...+++.+|+++.+.+.+++++++.+       +++.+.+|++|||||++|..
T Consensus       121 ~~-~~~~d~~~~~~~~~~~v~~l~~~~~~~l~~~~V~~i~G~a~f~~~~~v~V~~~~~~~~~~~i~a~~iiIATGs~P~~  199 (542)
T 4b1b_A          121 FD-NLKHDWKKLVTTVQSHIRSLNFSYMTGLRSSKVKYINGLAKLKDKNTVSYYLKGDLSKEETVTGKYILIATGCRPHI  199 (542)
T ss_dssp             EE-EEEECHHHHHHHHHHHHHHHHHHHHHHHHHTTCEEECEEEEEEETTEEEEEEC--CCCEEEEEEEEEEECCCEEECC
T ss_pred             cC-cccccHHHHHHHHHHHHHHHHHHHHHHHHhCCCEEEeeeEEEcCCCcceEeecccCCceEEEeeeeEEeccCCCCCC
Confidence            64 46789999999999999999888888999999999999999999999887       34679999999999999999


Q ss_pred             CCCCCC--CceecchhhhcCCCCCCeEEEEcCcHHHHHHHHHHHhCCCeEEEEeecCccCCCCCHHHHHHHHHHHHhcCc
Q 008860          224 PDIPGS--EYAIDSDAALDLPSKPEKIAIVGGGYIALEFAGIFSGLTSEVHVFIRQKKVLRGFDEDIRDFVAEQMSLRGI  301 (551)
Q Consensus       224 p~i~g~--~~~~~~~~~~~~~~~~~~vvViG~G~~g~e~a~~l~~~g~~Vtlv~~~~~~l~~~~~~~~~~l~~~l~~~Gv  301 (551)
                      |+.++.  +.+++++++++++++|++++|||+|++|+|+|..|+++|.+||++.+ +.+++.+|+++++.+.+.|+++||
T Consensus       200 P~~~~~~~~~~~ts~~~l~l~~lP~~lvIIGgG~IGlE~A~~~~~lG~~VTii~~-~~~L~~~D~ei~~~l~~~l~~~gi  278 (542)
T 4b1b_A          200 PDDVEGAKELSITSDDIFSLKKDPGKTLVVGASYVALECSGFLNSLGYDVTVAVR-SIVLRGFDQQCAVKVKLYMEEQGV  278 (542)
T ss_dssp             CSSSBTHHHHCBCHHHHTTCSSCCCSEEEECCSHHHHHHHHHHHHHTCCEEEEES-SCSSTTSCHHHHHHHHHHHHHTTC
T ss_pred             CCcccCCCccccCchhhhccccCCceEEEECCCHHHHHHHHHHHhcCCeEEEecc-cccccccchhHHHHHHHHHHhhcc
Confidence            875543  35789999999999999999999999999999999999999999987 567889999999999999999999


Q ss_pred             EEEcCcccEEEEEcCCceEEEEECCCeEEEeeEEEEecCcCCCCCCCCccccCeeecCCCCe-EeCCCCCCCCCcEEEeC
Q 008860          302 EFHTEESPQAILKSTDGSLSVKTNKGTVDGFSHVMFATGRRPNTKNLGLEKVGVKMTKNGAI-EVDEYSGTAVPSIWAVG  380 (551)
Q Consensus       302 ~i~~~~~v~~i~~~~~~~~~V~~~~G~~i~~d~vi~a~G~~p~~~~l~l~~~gl~~~~~G~i-~vd~~~~t~~~~vya~G  380 (551)
                      ++++++.+++++..+++ +.|.+.+++++.+|.|++|+|++||++.|+++..++.++.+|++ .+|+++||++|||||+|
T Consensus       279 ~~~~~~~v~~~~~~~~~-~~v~~~~~~~~~~D~vLvAvGR~Pnt~~L~le~~gv~~~~~~~~i~vd~~~~Ts~p~IyAiG  357 (542)
T 4b1b_A          279 MFKNGILPKKLTKMDDK-ILVEFSDKTSELYDTVLYAIGRKGDIDGLNLESLNMNVNKSNNKIIADHLSCTNIPSIFAVG  357 (542)
T ss_dssp             EEEETCCEEEEEEETTE-EEEEETTSCEEEESEEEECSCEEESCGGGCGGGTTCCEETTTTEECCCTTSBCSSTTEEECT
T ss_pred             eeecceEEEEEEecCCe-EEEEEcCCCeEEEEEEEEcccccCCccccCcccceeeecccCceEeccccccccCCCeEEec
Confidence            99999999999987766 78889999899999999999999999999999999999877665 78899999999999999


Q ss_pred             cCCCC-CCChHHHHHhHHHHHHHHcCCCCCCCCCCCccEEEecCCceEEeeCCHHHHHhcCC--CeEEEEeeccCcccc-
Q 008860          381 DVTDR-INLTPVALMEGGALAKTLFQAEPTKPDYSAVPSAVFSQPPIGQVGLSEEQAIQEYG--DIDVFTANFRPLKAT-  456 (551)
Q Consensus       381 D~~~~-~~~~~~A~~~g~~aa~~i~g~~~~~~~~~~~~~~~~~~~~~~~vGl~~~~a~~~~~--~~~~~~~~~~~~~~~-  456 (551)
                      ||++. +.+++.|.+||+++++|++|......+|..+|+++|++|++++||+||+||++++.  ++.++...+.....+ 
T Consensus       358 Dv~~~~p~La~~A~~eg~~aa~~i~g~~~~~~d~~~iP~~vft~PeiA~VGlTE~eA~~~g~~~~v~~~~~~~~~~~~~~  437 (542)
T 4b1b_A          358 DVAENVPELAPVAIKAGEILARRLFKDSDEIMDYSYIPTSIYTPIEYGACGYSEEKAYELYGKSNVEVFLQEFNNLEISA  437 (542)
T ss_dssp             TSBTTCCCCHHHHHHHHHHHHHHHHSCCCCCCCCSSCCEEECSSSCEEEEECCHHHHHHHHCTTTEEEEEC---------
T ss_pred             cccCCchhHHHHHHHHHHHHHHHHhcCCCcccCCCCCceEEeCCCCeEEEeCCHHHHHHhCCCCcEEEEEeeccchhhhh
Confidence            99976 68999999999999999999887778999999999999999999999999998864  455555444333221 


Q ss_pred             --------------cccCCCcEEEEEEE-ECCCCeEEEEEEECCChhHHHHHHHHHHHCCCCHHHHccCcccCCCchHHH
Q 008860          457 --------------LSGLPDRIFMKLVL-CAKTNKVLGLHMCGEDAPEIVQGFAVAVKAGLTKADFDATVGVHPTAAEEF  521 (551)
Q Consensus       457 --------------~~~~~~~~~~kl~~-~~~~~~ilG~~~~g~~~~e~i~~~~~~i~~~~~~~~l~~~~~~~pt~~e~~  521 (551)
                                    .....+.+|+|+++ ++++++|||+|++|++|+|+|+.+++||++++|++||.+++|+|||++|+|
T Consensus       438 ~~~~~~~~~~~~~~~~~~~~~g~vKli~~~~~t~~ILGa~ivG~~A~ElI~~~alAi~~~~t~~dl~~~i~~HPTlsE~l  517 (542)
T 4b1b_A          438 VHRQKHIRAQKDEYDLDVSSTCLAKLVCLKNEDNRVIGFHYVGPNAGEVTQGMALALRLKVKKKDFDNCIGIHPTDAESF  517 (542)
T ss_dssp             --------------------CCCEEEEEETTTTTBEEEEEEESTTHHHHHHHHHHHHHTCCBHHHHHHC-----------
T ss_pred             hhhhhhhhcccccccccCCCceEEEEEEEeCCCCEEEEEEEECCCHHHHHHHHHHHHHcCCCHHHHhccCCcCCCHHHHH
Confidence                          12245678999996 567899999999999999999999999999999999999999999999999


Q ss_pred             HHHHhh
Q 008860          522 VTLRTP  527 (551)
Q Consensus       522 ~~~~~~  527 (551)
                      .++...
T Consensus       518 ~~~~~t  523 (542)
T 4b1b_A          518 MNLFVT  523 (542)
T ss_dssp             ------
T ss_pred             HHHHHH
Confidence            886443
>4dna_A Probable glutathione reductase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; HET: FAD; 2.80A {Sinorhizobium meliloti} Back     alignment and structure
>2wpf_A Trypanothione reductase; oxidoreductase, trypanosomiasis, sleeping sickness, flavoPro redox-active center; HET: FAD WPF; 1.90A {Trypanosoma brucei} PDB: 2wov_A* 2wow_A* 2wp5_A* 2wp6_A* 2wpc_A* 2wpe_A* 2woi_A* 2wba_A* 1nda_A* 1gxf_A* 1bzl_A* 1aog_A* Back     alignment and structure
>3o0h_A Glutathione reductase; ssgcid, structur genomics, seattle structural genomics center for infectious gluathione reductase, oxidoreductase; HET: FAD; 1.90A {Bartonella henselae} Back     alignment and structure
>1ges_A Glutathione reductase; oxidoreductase(flavoenzyme); HET: FAD; 1.74A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1geu_A* 1ger_A* 1get_A* Back     alignment and structure
>3dk9_A Grase, GR, glutathione reductase; flavoenzyme, nicotinamide, acetylation, alternative initiation, cytoplasm, FAD, flavoprotein, mitochondrion, NADP; HET: SO4 FAD; 0.95A {Homo sapiens} PDB: 1bwc_A* 1gra_A* 1gre_A* 1grf_A* 1grh_A* 1grb_A* 2gh5_A* 1gsn_A* 3dk4_A* 3dk8_A* 3djj_A* 3grs_A* 3sqp_A* 4gr1_A* 2aaq_A* 1dnc_A* 1grg_A* 1grt_A* 1xan_A* 5grt_A* ... Back     alignment and structure
>1fec_A Trypanothione reductase; redox-active center, oxidoreductase, flavoprotein, FAD, NADP; HET: FAD; 1.70A {Crithidia fasciculata} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1fea_A* 1feb_A* 2tpr_A* 1tyt_A* 1typ_A* 2jk6_A* 2w0h_A* 2yau_A* 2x50_A* 2ve2_A* Back     alignment and structure
>2r9z_A Glutathione amide reductase; NAD, FAD, substrate specificity, oxidoreductase; HET: FAD; 2.10A {Marichromatium gracile} PDB: 2rab_A* Back     alignment and structure
>3dgz_A Thioredoxin reductase 2; oxidoreductase, rossmann, flavoprotein, FAD, mitochondrion, redox-active center, selenium, selenocysteine, transit PEPT; HET: FAD NA7; 2.25A {Mus musculus} PDB: 1zkq_A* 1zdl_A* Back     alignment and structure
>3ic9_A Dihydrolipoamide dehydrogenase; APC62701, colwellia psychrer 34H, structural genomics, PSI-2; HET: FAD; 2.15A {Colwellia psychrerythraea} Back     alignment and structure
>3dgh_A TRXR-1, thioredoxin reductase 1, mitochondrial; oxidoreductase, rossmann, flavoprotein, alternative initiati mitochondrion, NADP; HET: FAD; 1.75A {Drosophila melanogaster} PDB: 2nvk_X* 3dh9_A* Back     alignment and structure
>3qfa_A Thioredoxin reductase 1, cytoplasmic; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_A* 2j3n_A* 2zzc_A* 2zzb_A* 2zz0_A* 2cfy_A* 1h6v_A* 3ean_A* 3eao_A* Back     alignment and structure
>2hqm_A GR, grase, glutathione reductase; glutathione reductase complexed with FAD, oxidoreductase; HET: NAG FAD GSH; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1onf_A GR, grase, glutathione reductase; oxidoreductase; HET: FAD; 2.60A {Plasmodium falciparum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3urh_A Dihydrolipoyl dehydrogenase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium; HET: FAD; 1.90A {Sinorhizobium meliloti} Back     alignment and structure
>3l8k_A Dihydrolipoyl dehydrogenase; redox-active center, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>3lad_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD; 2.20A {Azotobacter vinelandii} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1lpf_A* Back     alignment and structure
>1ojt_A Surface protein; redox-active center, glycolysis, oxidoreductase, NAD, flavop FAD, P64K; HET: FAD; 2.75A {Neisseria meningitidis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1bhy_A* Back     alignment and structure
>2eq6_A Pyruvate dehydrogenase complex, dihydrolipoamide dehydrogenase E3 component; oxidoreductase, homodimer, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2eq8_A* 2eq9_A* Back     alignment and structure
>2qae_A Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystine-oxidoreductase, homodimer; HET: FAD; 1.90A {Trypanosoma cruzi} Back     alignment and structure
>1ebd_A E3BD, dihydrolipoamide dehydrogenase; redox-active center, glycolysis, oxidoreductase; HET: FAD; 2.60A {Geobacillus stearothermophilus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1xdi_A RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno function; HET: FAD; 2.81A {Mycobacterium tuberculosis} SCOP: c.3.1.5 d.87.1.1 Back     alignment and structure
>1zmd_A Dihydrolipoyl dehydrogenase; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha- ketoglutarate dehydrogenase; HET: FAD NAI; 2.08A {Homo sapiens} PDB: 1zmc_A* 2f5z_A* 1zy8_A* 3rnm_A* Back     alignment and structure
>2a8x_A Dihydrolipoyl dehydrogenase, E3 component of alpha; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha keto acid dehydrogenase; HET: FAD; 2.40A {Mycobacterium tuberculosis} PDB: 3ii4_A* Back     alignment and structure
>1dxl_A Dihydrolipoamide dehydrogenase; oxidoreductase, multienzyme complex protein, pyruvate dehydrogenase complex, glycine decarboxylase complex; HET: FAD; 3.15A {Pisum sativum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1zk7_A HGII, reductase, mercuric reductase; mercuric ION reductase, oxidoreductase; HET: FAD; 1.60A {Pseudomonas aeruginosa} PDB: 1zx9_A* Back     alignment and structure
>1lvl_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD NAD; 2.45A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A* Back     alignment and structure
>2yqu_A 2-oxoglutarate dehydrogenase E3 component; lipoamide dehydrogenase, 2-oxoglutarate dehydrogenase comple pyruvate dehydrogenase complex; HET: FAD; 1.70A {Thermus thermophilus} PDB: 2eq7_A* Back     alignment and structure
>1v59_A Dihydrolipoamide dehydrogenase; 2-oxoacid dehydroganese complex, pyruvate dehydrogenase complex; HET: FAD NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1jeh_A* Back     alignment and structure
>2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A* Back     alignment and structure
>4eqs_A Coenzyme A disulfide reductase; oxidoreductase; HET: COA FAD; 1.50A {Staphylococcus aureus subsp} PDB: 1yqz_A* 4eqw_A* 4em4_A* 4em3_A* 4eqr_A* 4emw_A* 4eqx_A* Back     alignment and structure
>3oc4_A Oxidoreductase, pyridine nucleotide-disulfide FAM; structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.60A {Enterococcus faecalis} Back     alignment and structure
>3kd9_A Coenzyme A disulfide reductase; PSI-II, NYSGXRC, oxidoreductase, structural genomics structure initiative; 2.75A {Pyrococcus horikoshii} Back     alignment and structure
>2cdu_A NADPH oxidase; flavoenzyme, oxidoreductase; HET: FAD ADP; 1.8A {Lactobacillus sanfranciscensis} Back     alignment and structure
>3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris} Back     alignment and structure
>1nhp_A NADH peroxidase; oxidoreductase (H2O2(A)); HET: FAD; 2.00A {Enterococcus faecalis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1npx_A* 1joa_A* 2npx_A* 1nhq_A* 1nhs_A* 1nhr_A* 1f8w_A* Back     alignment and structure
>3cgb_A Pyridine nucleotide-disulfide oxidoreductase, CLA; coenzyme A, flavin adenine dinucleotide, selenomethionine, F flavoprotein; HET: COA FAD; 1.90A {Bacillus anthracis str} PDB: 3cgc_A* 3cgd_A* 3cge_A* Back     alignment and structure
>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Back     alignment and structure
>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* Back     alignment and structure
>2v3a_A Rubredoxin reductase; alkane degradation, NADH oxidoreductase, rubredoxin reductas NAD, flavoprotein, oxidoreductase; HET: FAD; 2.4A {Pseudomonas aeruginosa} PDB: 2v3b_A* Back     alignment and structure
>3klj_A NAD(FAD)-dependent dehydrogenase, NIRB-family (N- domain); FAD-binding protein, GR-fold, oxidoreductase; HET: FAD; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>1xhc_A NADH oxidase /nitrite reductase; southe collaboratory for structural genomics, secsg, hyperthermoph protein structure initiative, PSI; HET: FAD; 2.35A {Pyrococcus furiosus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A* Back     alignment and structure
>2gqw_A Ferredoxin reductase; flavoprotein, oxidoreductase; HET: FAD; 1.40A {Pseudomonas SP} PDB: 1f3p_A* 1d7y_A* 2gr0_A* 2gr1_A* 2gr2_A* 2yvf_A* 2yvg_A* 2yvj_A* 2gr3_A* Back     alignment and structure
>3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>3ef6_A Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase; FAD binding protein, NADH binding protein, aromatic hydrocar catabolism, FAD; HET: FAD; 1.80A {Pseudomonas putida} PDB: 4emi_A* 4emj_A* Back     alignment and structure
>3fg2_P Putative rubredoxin reductase; ferredoxin reductase, RPA3782, F flavoprotein, oxidoreductase; HET: FAD; 2.20A {Rhodopseudomonas palustris} Back     alignment and structure
>4gcm_A TRXR, thioredoxin reductase; FAD/NAD-linked reductases, PYR redox 2 family, structural GE joint center for structural genomics, JCSG; HET: MSE FAD NAP EPE; 1.80A {Staphylococcus aureus subsp} Back     alignment and structure
>4a5l_A Thioredoxin reductase; oxidoreductase, redox metabolism, oxidative stress; HET: NDP FAD; 1.66A {Entamoeba histolytica} PDB: 4a65_A* Back     alignment and structure
>1m6i_A Programmed cell death protein 8; apoptosis, AIF, oxidoreductase; HET: FAD; 1.80A {Homo sapiens} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 3gd3_A* 3gd4_A* 1gv4_A* Back     alignment and structure
>2q7v_A Thioredoxin reductase; rossman fold, FAD, flavoprotein, oxidoreductase, redox- active center; HET: FAD; 1.90A {Deinococcus radiodurans} Back     alignment and structure
>2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A* Back     alignment and structure
>3cty_A Thioredoxin reductase; FAD, oxidoreductase, flavin, flavoprotein; HET: FAD; 2.35A {Thermoplasma acidophilum} Back     alignment and structure
>3r9u_A Thioredoxin reductase; structural genomics, center for structural genomics of infec diseases, csgid, thioredoxin-disulfide reductase, FAD; HET: FAD; 2.36A {Campylobacter jejuni} Back     alignment and structure
>4fk1_A Putative thioredoxin reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MSE FAD; 2.40A {Bacillus anthracis} PDB: 4fk1_C* Back     alignment and structure
>3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* Back     alignment and structure
>1trb_A Thioredoxin reductase; oxidoreductase(flavoenzyme); HET: FAD; 2.00A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 PDB: 1cl0_A* 1f6m_A* 1tdf_A* 1tde_A* Back     alignment and structure
>1fl2_A Alkyl hydroperoxide reductase subunit F; reactive oxygen, FAD, disulphi oxidoreductase, oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 Back     alignment and structure
>2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus} Back     alignment and structure
>3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} Back     alignment and structure
>2a87_A TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TLS, oxidoreduct structural genomics, PSI, protein structure initiative; HET: FAD NAP; 3.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum} Back     alignment and structure
>3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A* Back     alignment and structure
>3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A* Back     alignment and structure
>4g6h_A Rotenone-insensitive NADH-ubiquinone oxidoreducta mitochondrial; rossmann fold, electron transfer, FAD, oxidoreductase; HET: FAD NAD; 2.26A {Saccharomyces cerevisiae} PDB: 4g6g_A* 4g73_A* 4g74_A* 4g9k_A* 4gap_A* 4gav_A* Back     alignment and structure
>1vdc_A NTR, NADPH dependent thioredoxin reductase; hypothetical protein, redox-active center, oxidoreductase, D oxidoreductase; HET: FAD; 2.50A {Arabidopsis thaliana} SCOP: c.3.1.5 c.3.1.5 PDB: 2whd_A* Back     alignment and structure
>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A Back     alignment and structure
>3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} Back     alignment and structure
>4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} Back     alignment and structure
>2vdc_G Glutamate synthase [NADPH] small chain; oxidoreductase, amidotransferase, ammonia assimilation, iron, zymogen; HET: OMT FMN AKG FAD; 9.50A {Azospirillum brasilense} Back     alignment and structure
>3sx6_A Sulfide-quinone reductase, putative; sulfide:quinone oxidoreductase, Cys356Ala variant, integral membrane protein; HET: FAD LMT DCQ; 1.80A {Acidithiobacillus ferrooxidans} PDB: 3t0k_A* 3szc_A* 3sz0_A* 3t2z_A* 3t31_A* 3sy4_A* 3syi_A* 3sxi_A* 3t14_A* 3t2k_A* 3szw_A* 3szf_A* 3kpg_A* 3kpi_A* 3t2y_A* 3kpk_A* Back     alignment and structure
>1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* Back     alignment and structure
>2xve_A Flavin-containing monooxygenase; oxidoreductase; HET: FAD; 1.99A {Methylophaga aminisulfidivorans} PDB: 2xvf_A* 2xvh_A* 2xvi_A* 2xvj_A* 2xlt_A* 2vqb_A* 2vq7_A* 2xlu_A* 2xlp_A* 2xls_A* 2xlr_A* Back     alignment and structure
>3h8l_A NADH oxidase; membrane protein, complete form, rossman-like fold, oxidoreductase; HET: FAD; 2.57A {Acidianus ambivalens} PDB: 3h8i_A* Back     alignment and structure
>3vrd_B FCCB subunit, flavocytochrome C flavin subunit; sulfide oxidation, heme C binding, FAD binding, electron TRA oxidoreductase complex; HET: HEC FAD; 1.50A {Thermochromatium tepidum} PDB: 1fcd_A* Back     alignment and structure
>1lqt_A FPRA; NADP+ derivative, oxidoreductase, structural G PSI, protein structure initiative, TB structural genomics consortium, TBSGC; HET: FAD ODP; 1.05A {Mycobacterium tuberculosis} SCOP: c.3.1.1 c.4.1.1 PDB: 1lqu_A* 2c7g_A* Back     alignment and structure
>1cjc_A Protein (adrenodoxin reductase); flavoenzyme, MAD analysis, electron transferase, oxidoreductase; HET: FAD; 1.70A {Bos taurus} SCOP: c.3.1.1 c.4.1.1 PDB: 1e1k_A* 1e1l_A* 1e1m_A* 1e1n_A* 1e6e_A* Back     alignment and structure
>2gv8_A Monooxygenase; FMO, FAD, NADPH, cofactor complex, PSI, structura genomics, protein structure initiative; HET: FAD NDP; 2.10A {Schizosaccharomyces pombe} SCOP: c.3.1.5 c.3.1.5 PDB: 2gvc_A* 1vqw_A* Back     alignment and structure
>3hyw_A Sulfide-quinone reductase; monotopic membrane protein, flavoprotein, polysulfur, oxidoreductase; HET: FAD DCQ LMT; 2.00A {Aquifex aeolicus} PDB: 3hyv_A* 3hyx_A* Back     alignment and structure
>1o94_A Tmadh, trimethylamine dehydrogenase; electron transport, protein complex; HET: FMN ADP AMP; 2.0A {Methylophilus methylotrophus} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 PDB: 1djn_A* 1o95_A* 2tmd_A* 1djq_A* Back     alignment and structure
>3k30_A Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP binding site, oxidoreductase; HET: FMN ADP; 2.70A {Pimelobacter simplex} Back     alignment and structure
>2gag_A Heterotetrameric sarcosine oxidase alpha-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_A* 1x31_A* 1vrq_A* 3ad7_A* 3ad8_A* 3ad9_A* 3ada_A* Back     alignment and structure
>3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A* Back     alignment and structure
>1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 Back     alignment and structure
>3gwf_A Cyclohexanone monooxygenase; flavoprotein biocatalysis baeyer-villiger oxidation green CH monooxygenase, oxidoreductase; HET: FAD NAP; 2.20A {Rhodococcus SP} PDB: 3gwd_A* 3ucl_A* Back     alignment and structure
>1y56_A Hypothetical protein PH1363; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>3uox_A Otemo; baeyer-villiger monooxygenase, oxidoreductase; HET: FAD; 1.96A {Pseudomonas putida} PDB: 3uov_A* 3uoy_A* 3uoz_A* 3up4_A* 3up5_A* Back     alignment and structure
>4ap3_A Steroid monooxygenase; oxidoreductase, baeyer-villiger; HET: FAD NAP; 2.39A {Rhodococcus rhodochrous} PDB: 4aox_A* 4aos_A* 4ap1_A* Back     alignment and structure
>1w4x_A Phenylacetone monooxygenase; baeyer-villiger, FAD; HET: FAD; 1.7A {Thermobifida fusca} SCOP: c.3.1.5 c.3.1.5 PDB: 2ylr_A* 2yls_A* 2ylt_A* 2ym1_A* 2ylw_A* 2ym2_A* 2ylx_A* 2ylz_A* Back     alignment and structure
>2ywl_A Thioredoxin reductase related protein; uncharacterized conserved protein, rossmann fold, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2cvj_A* Back     alignment and structure
>2e5v_A L-aspartate oxidase; archaea, oxidoreductase; HET: FAD; 2.09A {Sulfolobus tokodaii} Back     alignment and structure
>4b63_A L-ornithine N5 monooxygenase; oxidoreductase, siderophore, flavin; HET: FAD NAP; 1.90A {Aspergillus fumigatus} PDB: 4b64_A* 4b65_A* 4b66_A* 4b67_A* 4b68_A* 4b69_A* Back     alignment and structure
>2gqf_A Hypothetical protein HI0933; structural genomics, FAD-utilizing protein, flavoprotein, PS protein structure initiative; HET: FAD; 2.70A {Haemophilus influenzae} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>2cul_A Glucose-inhibited division protein A-related PROT probable oxidoreductase; rossmann fold, protein-FAD complex; HET: FAD; 1.65A {Thermus thermophilus} SCOP: c.3.1.7 Back     alignment and structure
>3k7m_X 6-hydroxy-L-nicotine oxidase; enantiomeric substrates, flavoenzymes, nicotine degradation, oxidoreductase; HET: FAD GP7; 1.95A {Arthrobacter nicotinovorans} PDB: 3k7q_X* 3ng7_X* 3ngc_X* 3nh3_X* 3nho_X* 3nk0_X* 3nk1_X* 3nk2_X* 3nn0_X* 3nn6_X* 3k7t_A* Back     alignment and structure
>3ces_A MNMG, tRNA uridine 5-carboxymethylaminomethyl modificat GIDA, GIDA; tRNA modification, FAD binding domain, structural genomics; 2.41A {Escherichia coli} PDB: 3cp2_A 3g05_A Back     alignment and structure
>2zxi_A TRNA uridine 5-carboxymethylaminomethyl modificat MNMG; modification, 5-carboxymethylaminomethyl uridine, WOBB uridine, FAD; HET: FAD; 2.30A {Aquifex aeolicus} PDB: 2zxh_A* 2e57_A* Back     alignment and structure
>1rp0_A ARA6, thiazole biosynthetic enzyme; protein ligand complex, biosynthetic protein; HET: AHZ HTO; 1.60A {Arabidopsis thaliana} SCOP: c.3.1.6 Back     alignment and structure
>3dme_A Conserved exported protein; structural genomics, PSI-2, PROT structure initiative, northeast structural genomics consort NESG; HET: FAD TLA; 1.70A {Bordetella pertussis} Back     alignment and structure
>3v76_A Flavoprotein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: FDA; 2.51A {Sinorhizobium meliloti} Back     alignment and structure
>1ryi_A Glycine oxidase; flavoprotein, protein-inhibitor complex, oxidoreductase; HET: FAD; 1.80A {Bacillus subtilis} SCOP: c.3.1.2 d.16.1.3 PDB: 3if9_A* 1ng4_A* 1ng3_A* Back     alignment and structure
>1kf6_A Fumarate reductase flavoprotein; respiration, fumarate reductace, succinate dehydrogenase, CO quinol, quinone, oxidoreductase; HET: FAD HQO CE1 1PE; 2.70A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1kfy_A* 1l0v_A* 2b76_A* 3cir_A* 3p4p_A* 3p4q_A* 3p4r_A* 3p4s_A* Back     alignment and structure
>3nlc_A Uncharacterized protein VP0956; FAD-binding protein, NESG, structural genomics, PSI-2, prote structure initiative; HET: FAD; 2.15A {Vibrio parahaemolyticus} Back     alignment and structure
>1y56_B Sarcosine oxidase; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>2gf3_A MSOX, monomeric sarcosine oxidase; flavoprotein oxidase, inhibitor 2-furoic acid, oxidoreductas; HET: FAD; 1.30A {Bacillus SP} SCOP: c.3.1.2 d.16.1.3 PDB: 1el7_A* 1el8_A* 1el9_A* 1eli_A* 1l9e_A* 2a89_A* 2gb0_A* 1el5_A* 3qse_A* 3qsm_A* 3qss_A* 3bhk_A* 3bhf_A* 3m12_A* 3m13_A* 3m0o_A* 1l9c_A* 1l9d_A* 1zov_A* Back     alignment and structure
>3ps9_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; rossmann fold, oxidase, methyl transferase, FAD; HET: FAD SAM; 2.54A {Escherichia coli} PDB: 3awi_A* Back     alignment and structure
>1chu_A Protein (L-aspartate oxidase); flavoenzyme, NAD biosynthesis, FAD, oxidoreductase; 2.20A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1knr_A* 1knp_A* Back     alignment and structure
>3pvc_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; structural genomics, PSI-biology; HET: FAD; 2.31A {Yersinia pestis} PDB: 3sgl_A* Back     alignment and structure
>2gag_B Heterotetrameric sarcosine oxidase beta-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_B* 1x31_B* 1vrq_B* 3ad7_B* 3ad8_B* 3ad9_B* 3ada_B* Back     alignment and structure
>2oln_A NIKD protein; flavoprotein, rossmann fold, oxidoreductase; HET: FAD; 1.15A {Streptomyces tendae} PDB: 2olo_A* 3hzl_A* 2q6u_A* Back     alignment and structure
>3dje_A Fructosyl amine: oxygen oxidoreductase; fructosyl-amino acid, amadoriase, deglycation, fructosamine oxidase; HET: MSE FAD FSA EPE; 1.60A {Aspergillus fumigatus} PDB: 3djd_A* Back     alignment and structure
>3cp8_A TRNA uridine 5-carboxymethylaminomethyl modification enzyme GIDA; rossmann fold, FAD-binding domain, dinucleotide-binding motif; HET: FAD; 3.20A {Chlorobium tepidum} Back     alignment and structure
>3nix_A Flavoprotein/dehydrogenase; structural genomics, PSI-2, NES protein structure initiative, northeast structural genomics consortium; HET: FAD; 2.60A {Cytophaga hutchinsonii} Back     alignment and structure
>2i0z_A NAD(FAD)-utilizing dehydrogenases; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: FAD; 1.84A {Bacillus cereus} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>2uzz_A N-methyl-L-tryptophan oxidase; N-methyltryptophan oxidase (MTOX), oxidative demethylation of N-methyl-L-tryptophan, FAD, flavoenzyme; HET: FAD; 3.2A {Escherichia coli} Back     alignment and structure
>4dgk_A Phytoene dehydrogenase; the FAD/NAD(P)-binding rossmann fold, oxidoreductase; 2.35A {Pantoea ananatis} Back     alignment and structure
>3i3l_A Alkylhalidase CMLS; flavin-dependent halogenase, chloramphenicol biosynthesis, halogenation reaction, structural genomics; HET: FAD; 2.20A {Streptomyces venezuelae} Back     alignment and structure
>3gyx_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 3.20A {Desulfovibrio gigas} Back     alignment and structure
>3axb_A Putative oxidoreductase; dinucleotide-binding fold; HET: FAD; 1.92A {Aeropyrum pernix} PDB: 3vqr_A* Back     alignment and structure
>2cul_A Glucose-inhibited division protein A-related PROT probable oxidoreductase; rossmann fold, protein-FAD complex; HET: FAD; 1.65A {Thermus thermophilus} SCOP: c.3.1.7 Back     alignment and structure
>1pj5_A N,N-dimethylglycine oxidase; channelling, FAD binding, folate binding, amine oxidase, oxidoreductase; HET: FAD; 1.61A {Arthrobacter globiformis} SCOP: b.44.2.1 c.3.1.2 d.16.1.5 d.250.1.1 PDB: 1pj6_A* 1pj7_A* 3gsi_A* Back     alignment and structure
>3ka7_A Oxidoreductase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: FAD; 1.80A {Methanosarcina mazei} Back     alignment and structure
>3nyc_A D-arginine dehydrogenase; FAD, imino-arginine, oxidoreductas; HET: FAD IAR; 1.06A {Pseudomonas aeruginosa} PDB: 3nye_A* 3nyf_A* 3sm8_A* Back     alignment and structure
>4at0_A 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidoreductase, dehydogenase, steroid catabolism; HET: FAD; 1.60A {Rhodococcus jostii} PDB: 4at2_A* Back     alignment and structure
>3rp8_A Flavoprotein monooxygenase; FAD-binding protein, oxidoreductase; HET: FAD; 1.97A {Klebsiella pneumoniae} PDB: 3rp7_A* 3rp6_A* Back     alignment and structure
>1qo8_A Flavocytochrome C3 fumarate reductase; oxidoreductase; HET: HEM FAD; 2.15A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 Back     alignment and structure
>1s3e_A Amine oxidase [flavin-containing] B; human monoamine oxidase, inhibitor binding, rasagiline, enantioselectivity, oxidoreductase; HET: FAD RHP; 1.60A {Homo sapiens} SCOP: c.3.1.2 d.16.1.5 PDB: 1gos_A* 1oj9_A* 1ojb_A* 1ojc_A* 1ojd_A* 1s2q_A* 1s2y_A* 1oja_A* 1s3b_A* 2bk3_A* 2byb_A* 2c64_A* 2c65_A* 2c66_A* 2c67_A* 2c70_A* 2v5z_A* 2v60_A* 2v61_A* 2vrl_A* ... Back     alignment and structure
>3nrn_A Uncharacterized protein PF1083; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: AMP; 2.10A {Pyrococcus furiosus} Back     alignment and structure
>2bry_A NEDD9 interacting protein with calponin homology and LIM domains; transport, coiled coil, cytoskeleton, FAD, flavoprotein, metal-binding, zinc; HET: FAD; 1.45A {Mus musculus} PDB: 2c4c_A* 2bra_A* Back     alignment and structure
>4gut_A Lysine-specific histone demethylase 1B; histone demethylase; HET: FAD PGE; 2.00A {Homo sapiens} PDB: 4gur_A* 4gus_A* 4guu_A* 4fwe_A* 4fwf_A* 4fwj_A* 4gu1_A* Back     alignment and structure
>3oz2_A Digeranylgeranylglycerophospholipid reductase; structural genomics, joint center for structural genomics; HET: MSE FAD OZ2; 1.60A {Thermoplasma acidophilum} Back     alignment and structure
>1y0p_A Fumarate reductase flavoprotein subunit; flavocytochrome, mesaconate, oxidoreductase; HET: HEM FAD; 1.50A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1qjd_A* 2b7s_A* 1jry_A* 2b7r_A* 1ksu_A* 1jrz_A* 1jrx_A* 1m64_A* 1p2h_A* 1p2e_A* 1kss_A* 1e39_A* 1q9i_A* 1lj1_A* Back     alignment and structure
>4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} Back     alignment and structure
>2ywl_A Thioredoxin reductase related protein; uncharacterized conserved protein, rossmann fold, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2cvj_A* Back     alignment and structure
>1rp0_A ARA6, thiazole biosynthetic enzyme; protein ligand complex, biosynthetic protein; HET: AHZ HTO; 1.60A {Arabidopsis thaliana} SCOP: c.3.1.6 Back     alignment and structure
>3e1t_A Halogenase; flavoprotein; HET: FAD; 2.05A {Chondromyces crocatus} Back     alignment and structure
>3da1_A Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9KDW6 X-RAY, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.70A {Bacillus halodurans} Back     alignment and structure
>3qj4_A Renalase; FAD/NAD(P)-binding rossmann fold superfamily, flavin contain oxidoreductase, monoamine oxidase, NAD, extracellular, oxidoreductase; HET: FAD; 2.50A {Homo sapiens} Back     alignment and structure
>2gmh_A Electron transfer flavoprotein-ubiquinone oxidoreductase; HET: BHG FAD UQ5; 2.50A {Sus scrofa} SCOP: c.3.1.2 d.16.1.8 d.58.1.6 PDB: 2gmj_A* Back     alignment and structure
>3jsk_A Cypbp37 protein; octameric thiazole synthase, biosynthetic protein; HET: AHZ; 2.70A {Neurospora crassa} Back     alignment and structure
>1d4d_A Flavocytochrome C fumarate reductase; oxidoreductase; HET: HEM FAD; 2.50A {Shewanella oneidensis} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1d4e_A* 1d4c_A* Back     alignment and structure
>2bry_A NEDD9 interacting protein with calponin homology and LIM domains; transport, coiled coil, cytoskeleton, FAD, flavoprotein, metal-binding, zinc; HET: FAD; 1.45A {Mus musculus} PDB: 2c4c_A* 2bra_A* Back     alignment and structure
>3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A* Back     alignment and structure
>2wdq_A Succinate dehydrogenase flavoprotein subunit; succinate dehydrogenase activity, cell inner membrane, trica acid cycle; HET: FAD HEM CBE; 2.40A {Escherichia coli} PDB: 1nen_A* 2acz_A* 1nek_A* 2wdr_A* 2wdv_A* 2wp9_A* 2ws3_A* 2wu2_A* 2wu5_A* Back     alignment and structure
>3nks_A Protoporphyrinogen oxidase; FAD containing protein, PPO, variegate porphyria disease, VP oxidoreductase-oxidoreductase inhibitor complex; HET: ACJ FAD; 1.90A {Homo sapiens} Back     alignment and structure
>3kkj_A Amine oxidase, flavin-containing; oxidoreductase, PSR10, Q888A4, X-RAY, structure, PSI, protein structure initiative; HET: FAD; 2.50A {Pseudomonas syringae PV} Back     alignment and structure
>3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* Back     alignment and structure
>2vvm_A Monoamine oxidase N; FAD, peroxisome, flavoprotein, oxidoreductase, enantioselectivity, directed evolution variant; HET: FAD; 1.85A {Aspergillus niger} PDB: 2vvl_A* 2vvl_G* Back     alignment and structure
>3fmw_A Oxygenase; mithramycin, baeyer-villiger, flavin binding protein, oxidoreductase; HET: FAD; 2.89A {Streptomyces argillaceus} Back     alignment and structure
>2qa1_A PGAE, polyketide oxygenase PGAE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 1.80A {Streptomyces} Back     alignment and structure
>3p1w_A Rabgdi protein; GDI RAB, malaria, structural genomics consortium, SGC, trans PF10_0345, protein transport; 1.85A {Plasmodium falciparum 3D7} Back     alignment and structure
>2e4g_A Tryptophan halogenase; flavin-binding, rebeccamycin biosynthesis, biosynthetic protein, flavoprotein; HET: TRP; 2.08A {Lechevalieria aerocolonigenes} PDB: 2o9z_A 2oa1_A* 2oal_A* 2oam_A Back     alignment and structure
>2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus} Back     alignment and structure
>3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum} Back     alignment and structure
>2qa2_A CABE, polyketide oxygenase CABE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 2.70A {Streptomyces} Back     alignment and structure
>3c96_A Flavin-containing monooxygenase; FAD, oxidoreductase, PF01266, NESG, PAR240, structural genomics, PSI-2; HET: FAD; 1.90A {Pseudomonas aeruginosa PAO1} SCOP: c.3.1.2 d.16.1.2 PDB: 2rgj_A* Back     alignment and structure
>3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} Back     alignment and structure
>3i6d_A Protoporphyrinogen oxidase; protein-inhibitor complex, cytoplasm, FAD, flavoprotein, oxidoreductase, porphyrin biosynthesis; HET: FAD ACJ; 2.90A {Bacillus subtilis} Back     alignment and structure
>3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A* Back     alignment and structure
>2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A* Back     alignment and structure
>3c4n_A Uncharacterized protein DR_0571; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.40A {Deinococcus radiodurans R1} Back     alignment and structure
>2gjc_A Thiazole biosynthetic enzyme, mitochondrial; glutathione reductase type II family, thiazole synthase, mitochondria DNA repair; HET: AHZ; 1.82A {Saccharomyces cerevisiae} PDB: 3fpz_A* Back     alignment and structure
>2aqj_A Tryptophan halogenase, pRNA; flavin-dependent halogenase, helical bundle, sandwiched sheets, structural genomics; HET: TRP FAD; 1.80A {Pseudomonas fluorescens} PDB: 2apg_A* 2ar8_A* 2ard_A* 2jkc_A* Back     alignment and structure
>2h88_A Succinate dehydrogenase flavoprotein subunit; complex II, membrane protein, heme protein, iron sulfur PROT cytochrome B, oxidoreductase; HET: FAD BHG HEM UNL; 1.74A {Gallus gallus} PDB: 1yq4_A* 1yq3_A* 2fbw_A* 2h89_A* 2wqy_A* 1zoy_A* 1zp0_A* 3abv_A* 3ae1_A* 3ae2_A* 3ae3_A* 3ae4_A* 3ae5_A* 3ae6_A* 3ae7_A* 3ae8_A* 3ae9_A* 3aea_A* 3aeb_A* 3aec_A* ... Back     alignment and structure
>2gqf_A Hypothetical protein HI0933; structural genomics, FAD-utilizing protein, flavoprotein, PS protein structure initiative; HET: FAD; 2.70A {Haemophilus influenzae} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>3klj_A NAD(FAD)-dependent dehydrogenase, NIRB-family (N- domain); FAD-binding protein, GR-fold, oxidoreductase; HET: FAD; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>3alj_A 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; alpha/beta fold, oxidoreductase; HET: FAD; 1.48A {Mesorhizobium loti} PDB: 3alh_A* 3ali_A* 3gmb_A* 3gmc_A* 3alk_A* 3alm_A* 3all_A* Back     alignment and structure
>2qcu_A Aerobic glycerol-3-phosphate dehydrogenase; glycerol-3-phoshate dehydrogenase, oxidoreductase; HET: BOG FAD TAM; 1.75A {Escherichia coli} PDB: 2r45_A* 2r46_A* 2r4e_A* 2r4j_A* Back     alignment and structure
>1fl2_A Alkyl hydroperoxide reductase subunit F; reactive oxygen, FAD, disulphi oxidoreductase, oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 Back     alignment and structure
>3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} Back     alignment and structure
>3alj_A 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; alpha/beta fold, oxidoreductase; HET: FAD; 1.48A {Mesorhizobium loti} PDB: 3alh_A* 3ali_A* 3gmb_A* 3gmc_A* 3alk_A* 3alm_A* 3all_A* Back     alignment and structure
>2q7v_A Thioredoxin reductase; rossman fold, FAD, flavoprotein, oxidoreductase, redox- active center; HET: FAD; 1.90A {Deinococcus radiodurans} Back     alignment and structure
>1vdc_A NTR, NADPH dependent thioredoxin reductase; hypothetical protein, redox-active center, oxidoreductase, D oxidoreductase; HET: FAD; 2.50A {Arabidopsis thaliana} SCOP: c.3.1.5 c.3.1.5 PDB: 2whd_A* Back     alignment and structure
>2pyx_A Tryptophan halogenase; structural genomics, JOI for structural genomics, JCSG, protein structure initiative biosynthetic protein; HET: MSE TLA PG4; 1.50A {Shewanella frigidimarina} Back     alignment and structure
>2x3n_A Probable FAD-dependent monooxygenase; oxidoreductase; HET: FAD; 1.75A {Pseudomonas aeruginosa} Back     alignment and structure
>3sx6_A Sulfide-quinone reductase, putative; sulfide:quinone oxidoreductase, Cys356Ala variant, integral membrane protein; HET: FAD LMT DCQ; 1.80A {Acidithiobacillus ferrooxidans} PDB: 3t0k_A* 3szc_A* 3sz0_A* 3t2z_A* 3t31_A* 3sy4_A* 3syi_A* 3sxi_A* 3t14_A* 3t2k_A* 3szw_A* 3szf_A* 3kpg_A* 3kpi_A* 3t2y_A* 3kpk_A* Back     alignment and structure
>2weu_A Tryptophan 5-halogenase; regioselectivity, antifungal protei; HET: TRP; 1.70A {Streptomyces rugosporus} PDB: 2wet_A* 2wes_A* Back     alignment and structure
>4fk1_A Putative thioredoxin reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MSE FAD; 2.40A {Bacillus anthracis} PDB: 4fk1_C* Back     alignment and structure
>4ap3_A Steroid monooxygenase; oxidoreductase, baeyer-villiger; HET: FAD NAP; 2.39A {Rhodococcus rhodochrous} PDB: 4aox_A* 4aos_A* 4ap1_A* Back     alignment and structure
>2bs2_A Quinol-fumarate reductase flavoprotein subunit A; 2Fe-2S, 3Fe-4S, 4Fe-4S, citric acid cycle, dihaem cytochrome B; HET: FAD HEM LMT; 1.78A {Wolinella succinogenes} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 2bs3_A* 1e7p_A* 2bs4_A* 1qlb_A* Back     alignment and structure
>3gwf_A Cyclohexanone monooxygenase; flavoprotein biocatalysis baeyer-villiger oxidation green CH monooxygenase, oxidoreductase; HET: FAD NAP; 2.20A {Rhodococcus SP} PDB: 3gwd_A* 3ucl_A* Back     alignment and structure
>3hyw_A Sulfide-quinone reductase; monotopic membrane protein, flavoprotein, polysulfur, oxidoreductase; HET: FAD DCQ LMT; 2.00A {Aquifex aeolicus} PDB: 3hyv_A* 3hyx_A* Back     alignment and structure
>2gv8_A Monooxygenase; FMO, FAD, NADPH, cofactor complex, PSI, structura genomics, protein structure initiative; HET: FAD NDP; 2.10A {Schizosaccharomyces pombe} SCOP: c.3.1.5 c.3.1.5 PDB: 2gvc_A* 1vqw_A* Back     alignment and structure
>2x3n_A Probable FAD-dependent monooxygenase; oxidoreductase; HET: FAD; 1.75A {Pseudomonas aeruginosa} Back     alignment and structure
>2rgh_A Alpha-glycerophosphate oxidase; flavoprotein oxidase, oxidoreductase; HET: FAD; 2.30A {Streptococcus SP} PDB: 2rgo_A* Back     alignment and structure
>1jnr_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 1.60A {Archaeoglobus fulgidus dsm 4304} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1jnz_A* 2fjb_A* 2fja_A* 2fjd_A* 2fje_A* Back     alignment and structure
>3cty_A Thioredoxin reductase; FAD, oxidoreductase, flavin, flavoprotein; HET: FAD; 2.35A {Thermoplasma acidophilum} Back     alignment and structure
>3atr_A Conserved archaeal protein; saturating double bonds, archaeal membrane precursor, like 2 geranylgeranylglyceryl phosphate; HET: FDA; 1.80A {Sulfolobus acidocaldarius} PDB: 3atq_A* Back     alignment and structure
>1trb_A Thioredoxin reductase; oxidoreductase(flavoenzyme); HET: FAD; 2.00A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 PDB: 1cl0_A* 1f6m_A* 1tdf_A* 1tde_A* Back     alignment and structure
>3h8l_A NADH oxidase; membrane protein, complete form, rossman-like fold, oxidoreductase; HET: FAD; 2.57A {Acidianus ambivalens} PDB: 3h8i_A* Back     alignment and structure
>2vou_A 2,6-dihydroxypyridine hydroxylase; oxidoreductase, aromatic hydroxylase, nicotine degradation, mono-oxygenase; HET: FAD; 2.6A {Arthrobacter nicotinovorans} SCOP: c.3.1.2 d.16.1.2 Back     alignment and structure
>1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A* Back     alignment and structure
>3ihg_A RDME; flavoenzyme, anthracycline, polyketide biosynthesis, merohedral twinning, enzyme mechanism, hydroxylase, flavoprotein; HET: FAD VAK; 2.49A {Streptomyces purpurascens} Back     alignment and structure
>3r9u_A Thioredoxin reductase; structural genomics, center for structural genomics of infec diseases, csgid, thioredoxin-disulfide reductase, FAD; HET: FAD; 2.36A {Campylobacter jejuni} Back     alignment and structure
>2xdo_A TETX2 protein; tetracycline degradation, tigecycline, flavin, bacteroides F oxidoreductase; HET: FAD; 2.09A {Bacteroides thetaiotaomicron} PDB: 2y6q_A* 2xyo_A* 2y6r_A* 3p9u_A* Back     alignment and structure
>2xve_A Flavin-containing monooxygenase; oxidoreductase; HET: FAD; 1.99A {Methylophaga aminisulfidivorans} PDB: 2xvf_A* 2xvh_A* 2xvi_A* 2xvj_A* 2xlt_A* 2vqb_A* 2vq7_A* 2xlu_A* 2xlp_A* 2xls_A* 2xlr_A* Back     alignment and structure
>3ef6_A Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase; FAD binding protein, NADH binding protein, aromatic hydrocar catabolism, FAD; HET: FAD; 1.80A {Pseudomonas putida} PDB: 4emi_A* 4emj_A* Back     alignment and structure
>2dkh_A 3-hydroxybenzoate hydroxylase; flavoprotein, monooxygenase, complex, oxidoreductase; HET: FAD 3HB; 1.80A {Comamonas testosteroni} PDB: 2dki_A* Back     alignment and structure
>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A Back     alignment and structure
>2r0c_A REBC; flavin adenine dinucleotide, monooxygenase, oxidoreductase; HET: FAD; 1.80A {Lechevalieria aerocolonigenes} PDB: 2r0g_A* 2r0p_A* 3ept_A* Back     alignment and structure
>2a87_A TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TLS, oxidoreduct structural genomics, PSI, protein structure initiative; HET: FAD NAP; 3.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3vrd_B FCCB subunit, flavocytochrome C flavin subunit; sulfide oxidation, heme C binding, FAD binding, electron TRA oxidoreductase complex; HET: HEC FAD; 1.50A {Thermochromatium tepidum} PDB: 1fcd_A* Back     alignment and structure
>3fg2_P Putative rubredoxin reductase; ferredoxin reductase, RPA3782, F flavoprotein, oxidoreductase; HET: FAD; 2.20A {Rhodopseudomonas palustris} Back     alignment and structure
>1xhc_A NADH oxidase /nitrite reductase; southe collaboratory for structural genomics, secsg, hyperthermoph protein structure initiative, PSI; HET: FAD; 2.35A {Pyrococcus furiosus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3uox_A Otemo; baeyer-villiger monooxygenase, oxidoreductase; HET: FAD; 1.96A {Pseudomonas putida} PDB: 3uov_A* 3uoy_A* 3uoz_A* 3up4_A* 3up5_A* Back     alignment and structure
>4a5l_A Thioredoxin reductase; oxidoreductase, redox metabolism, oxidative stress; HET: NDP FAD; 1.66A {Entamoeba histolytica} PDB: 4a65_A* Back     alignment and structure
>3ces_A MNMG, tRNA uridine 5-carboxymethylaminomethyl modificat GIDA, GIDA; tRNA modification, FAD binding domain, structural genomics; 2.41A {Escherichia coli} PDB: 3cp2_A 3g05_A Back     alignment and structure
>1k0i_A P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, hydrolase; HET: FAD PHB; 1.80A {Pseudomonas aeruginosa} SCOP: c.3.1.2 d.16.1.2 PDB: 1k0j_A* 1k0l_A* 1doc_A* 1d7l_A* 1dod_A* 1doe_A* 1ius_A* 1iut_A* 1iuu_A* 1iuv_A* 1iuw_A* 1iux_A* 1pxb_A* 1pxc_A* 1dob_A* 1ykj_A* 1pxa_A* 1pbe_A* 1pdh_A* 1phh_A* ... Back     alignment and structure
>3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>4gde_A UDP-galactopyranose mutase; flavin adenine dinucleotide binding, nucleotide binding, MUT isomerase; HET: FDA; 2.20A {Aspergillus fumigatus} PDB: 3ute_A* 3utg_A* 3uth_A* 4gdc_A* 4gdd_A* 3utf_A* 3ukh_A* 3ukf_A* 3uka_A* 3ukl_A* 3ukk_A* 3ukq_A* 3ukp_A* Back     alignment and structure
>3g5s_A Methylenetetrahydrofolate--tRNA-(uracil-5-)- methyltransferase TRMFO; tRNA methyltransferase FAD folate, FAD, flavoprotein; HET: MSE FAD GSH; 1.05A {Thermus thermophilus} PDB: 3g5q_A* 3g5r_A* Back     alignment and structure
>3kd9_A Coenzyme A disulfide reductase; PSI-II, NYSGXRC, oxidoreductase, structural genomics structure initiative; 2.75A {Pyrococcus horikoshii} Back     alignment and structure
>2bcg_G Secretory pathway GDP dissociation inhibitor; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.3.1.3 c.3.1.3 d.16.1.6 PDB: 1ukv_G* 3cpi_G 3cph_G 3cpj_G* Back     alignment and structure
>1k0i_A P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, hydrolase; HET: FAD PHB; 1.80A {Pseudomonas aeruginosa} SCOP: c.3.1.2 d.16.1.2 PDB: 1k0j_A* 1k0l_A* 1doc_A* 1d7l_A* 1dod_A* 1doe_A* 1ius_A* 1iut_A* 1iuu_A* 1iuv_A* 1iuw_A* 1iux_A* 1pxb_A* 1pxc_A* 1dob_A* 1ykj_A* 1pxa_A* 1pbe_A* 1pdh_A* 1phh_A* ... Back     alignment and structure
>2zxi_A TRNA uridine 5-carboxymethylaminomethyl modificat MNMG; modification, 5-carboxymethylaminomethyl uridine, WOBB uridine, FAD; HET: FAD; 2.30A {Aquifex aeolicus} PDB: 2zxh_A* 2e57_A* Back     alignment and structure
>1v0j_A UDP-galactopyranose mutase; flavoprotein, isomerase; HET: FAD BCN; 2.25A {Mycobacterium tuberculosis} Back     alignment and structure
>3cp8_A TRNA uridine 5-carboxymethylaminomethyl modification enzyme GIDA; rossmann fold, FAD-binding domain, dinucleotide-binding motif; HET: FAD; 3.20A {Chlorobium tepidum} Back     alignment and structure
>3oc4_A Oxidoreductase, pyridine nucleotide-disulfide FAM; structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.60A {Enterococcus faecalis} Back     alignment and structure
>2vou_A 2,6-dihydroxypyridine hydroxylase; oxidoreductase, aromatic hydroxylase, nicotine degradation, mono-oxygenase; HET: FAD; 2.6A {Arthrobacter nicotinovorans} SCOP: c.3.1.2 d.16.1.2 Back     alignment and structure
>4gcm_A TRXR, thioredoxin reductase; FAD/NAD-linked reductases, PYR redox 2 family, structural GE joint center for structural genomics, JCSG; HET: MSE FAD NAP EPE; 1.80A {Staphylococcus aureus subsp} Back     alignment and structure
>3atr_A Conserved archaeal protein; saturating double bonds, archaeal membrane precursor, like 2 geranylgeranylglyceryl phosphate; HET: FDA; 1.80A {Sulfolobus acidocaldarius} PDB: 3atq_A* Back     alignment and structure
>4hb9_A Similarities with probable monooxygenase; flavin, structural genomics, NEW YORK structural genomics RE consortium, nysgrc, PSI; HET: MSE FAD; 1.93A {Photorhabdus luminescens} Back     alignment and structure
>2gqw_A Ferredoxin reductase; flavoprotein, oxidoreductase; HET: FAD; 1.40A {Pseudomonas SP} PDB: 1f3p_A* 1d7y_A* 2gr0_A* 2gr1_A* 2gr2_A* 2yvf_A* 2yvg_A* 2yvj_A* 2gr3_A* Back     alignment and structure
>2xdo_A TETX2 protein; tetracycline degradation, tigecycline, flavin, bacteroides F oxidoreductase; HET: FAD; 2.09A {Bacteroides thetaiotaomicron} PDB: 2y6q_A* 2xyo_A* 2y6r_A* 3p9u_A* Back     alignment and structure
>1w4x_A Phenylacetone monooxygenase; baeyer-villiger, FAD; HET: FAD; 1.7A {Thermobifida fusca} SCOP: c.3.1.5 c.3.1.5 PDB: 2ylr_A* 2yls_A* 2ylt_A* 2ym1_A* 2ylw_A* 2ym2_A* 2ylx_A* 2ylz_A* Back     alignment and structure
>2e1m_A L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP} Back     alignment and structure
>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Back     alignment and structure
>3ihg_A RDME; flavoenzyme, anthracycline, polyketide biosynthesis, merohedral twinning, enzyme mechanism, hydroxylase, flavoprotein; HET: FAD VAK; 2.49A {Streptomyces purpurascens} Back     alignment and structure
>2b9w_A Putative aminooxidase; isomerase, conjugated linoleic acid, FAD; HET: FAD 12P; 1.95A {Propionibacterium acnes} PDB: 2b9x_A* 2b9y_A* 2ba9_A* 2bab_A* 2bac_A* Back     alignment and structure
>3hdq_A UDP-galactopyranose mutase; substrate and inhibitor, isomerase; HET: GDU FAD; 2.36A {Deinococcus radiodurans} PDB: 3hdy_A* 3he3_A* 3mj4_A* Back     alignment and structure
>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* Back     alignment and structure
>3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A* Back     alignment and structure
>3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris} Back     alignment and structure
>1c0p_A D-amino acid oxidase; alpha-beta-alpha motif, flavin containing protein, oxidoreductase; HET: FAD; 1.20A {Rhodosporidium toruloides} SCOP: c.4.1.2 d.16.1.3 PDB: 1c0i_A* 1c0l_A* 1c0k_A* Back     alignment and structure
>2cdu_A NADPH oxidase; flavoenzyme, oxidoreductase; HET: FAD ADP; 1.8A {Lactobacillus sanfranciscensis} Back     alignment and structure
>1rsg_A FMS1 protein; FAD binding motif, oxidoreductase; HET: FAD; 1.90A {Saccharomyces cerevisiae} PDB: 1z6l_A* 3bi2_A* 3bi4_A* 3bi5_A* 3bnm_B* 3bnu_B* 3cn8_B* 3cnd_B* 3cnp_B* 3cns_A* 3cnt_B* 1yy5_A* 1xpq_A* Back     alignment and structure
>1nhp_A NADH peroxidase; oxidoreductase (H2O2(A)); HET: FAD; 2.00A {Enterococcus faecalis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1npx_A* 1joa_A* 2npx_A* 1nhq_A* 1nhs_A* 1nhr_A* 1f8w_A* Back     alignment and structure
>4g6h_A Rotenone-insensitive NADH-ubiquinone oxidoreducta mitochondrial; rossmann fold, electron transfer, FAD, oxidoreductase; HET: FAD NAD; 2.26A {Saccharomyces cerevisiae} PDB: 4g6g_A* 4g73_A* 4g74_A* 4g9k_A* 4gap_A* 4gav_A* Back     alignment and structure
>3ihm_A Styrene monooxygenase A; rossman fold, anti-parallel beta strands, dimer, cavity, oxidoreductase; 2.30A {Pseudomonas putida} Back     alignment and structure
>1pn0_A Phenol 2-monooxygenase; two dimers, TLS refinement, oxidoreductase; HET: FAD; 1.70A {Trichosporon cutaneum} SCOP: c.3.1.2 c.47.1.10 d.16.1.2 PDB: 1foh_A* Back     alignment and structure
>2jae_A L-amino acid oxidase; oxidoreductase, dimerisation mode, hydride transfer mechanism, GR2-family, flavoenzyme, FAD containing; HET: FAD; 1.25A {Rhodococcus opacus} PDB: 2jb1_A* 2jb2_A* 2jb3_A* Back     alignment and structure
>2yg5_A Putrescine oxidase; oxidoreductase, flavin; HET: FAD; 1.90A {Rhodococcus erythropolis} PDB: 2yg6_A* 2yg3_A* 2yg4_A* 2yg7_A* 3rha_A* Back     alignment and structure
>2ivd_A PPO, PPOX, protoporphyrinogen oxidase; porphyrin biosynthesis, chlorophyll biosynthesis, oxidoreductase, HAEM biosynthesis, heme biosynthesis; HET: ACJ FAD TWN; 2.3A {Myxococcus xanthus} SCOP: c.3.1.2 d.16.1.5 PDB: 2ive_A* Back     alignment and structure
>1i8t_A UDP-galactopyranose mutase; rossman fold, FAD, contractase, isomerase; HET: FAD; 2.40A {Escherichia coli} SCOP: c.4.1.3 d.16.1.7 Back     alignment and structure
>1sez_A Protoporphyrinogen oxidase, mitochondrial; FAD-binding, para-hydroxy-benzoate-hydroxylase fold (PHBH- fold), monotopic membrane-binding domain; HET: FAD OMN TON; 2.90A {Nicotiana tabacum} SCOP: c.3.1.2 d.16.1.5 Back     alignment and structure
>2vdc_G Glutamate synthase [NADPH] small chain; oxidoreductase, amidotransferase, ammonia assimilation, iron, zymogen; HET: OMT FMN AKG FAD; 9.50A {Azospirillum brasilense} Back     alignment and structure
>1d5t_A Guanine nucleotide dissociation inhibitor; ultra-high resolution, hydrolase inhibitor; 1.04A {Bos taurus} SCOP: c.3.1.3 d.16.1.6 PDB: 1lv0_A* 1gnd_A Back     alignment and structure
>3cgb_A Pyridine nucleotide-disulfide oxidoreductase, CLA; coenzyme A, flavin adenine dinucleotide, selenomethionine, F flavoprotein; HET: COA FAD; 1.90A {Bacillus anthracis str} PDB: 3cgc_A* 3cgd_A* 3cge_A* Back     alignment and structure
>3l8k_A Dihydrolipoyl dehydrogenase; redox-active center, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>1m6i_A Programmed cell death protein 8; apoptosis, AIF, oxidoreductase; HET: FAD; 1.80A {Homo sapiens} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 3gd3_A* 3gd4_A* 1gv4_A* Back     alignment and structure
>3pl8_A Pyranose 2-oxidase; substrate complex, H167A mutant, homotetramer, GMC oxidoredu PHBH fold, rossmann domain, oxidoreductase; HET: FAD MES G3F; 1.35A {Trametes ochracea} PDB: 2igo_A* 3lsm_A* 2ign_A* 3k4c_A* 1tt0_A* 2igk_A* 3k4b_A* 3lsk_A* 3bg6_A* 3lsh_A* 3lsi_A* 2igm_A* 3k4j_A* 3k4m_A* 3bg7_A* 3k4k_A* 3k4l_A* 3bly_A* 1tzl_A* 3fdy_A* ... Back     alignment and structure
>4eqs_A Coenzyme A disulfide reductase; oxidoreductase; HET: COA FAD; 1.50A {Staphylococcus aureus subsp} PDB: 1yqz_A* 4eqw_A* 4em4_A* 4em3_A* 4eqr_A* 4emw_A* 4eqx_A* Back     alignment and structure
>2qae_A Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystine-oxidoreductase, homodimer; HET: FAD; 1.90A {Trypanosoma cruzi} Back     alignment and structure
>2bi7_A UDP-galactopyranose mutase; FAD, flavoprotein, isomerase, lipopolysaccharide biosynthesi; HET: FAD; 2.0A {Klebsiella pneumoniae} SCOP: c.4.1.3 d.16.1.7 PDB: 2bi8_A* 1wam_A* 3inr_A* 3gf4_A* 3int_A* 3kyb_A* Back     alignment and structure
>3lov_A Protoporphyrinogen oxidase; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: FAD; 2.06A {Exiguobacterium sibiricum} Back     alignment and structure
>1zk7_A HGII, reductase, mercuric reductase; mercuric ION reductase, oxidoreductase; HET: FAD; 1.60A {Pseudomonas aeruginosa} PDB: 1zx9_A* Back     alignment and structure
>1zmd_A Dihydrolipoyl dehydrogenase; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha- ketoglutarate dehydrogenase; HET: FAD NAI; 2.08A {Homo sapiens} PDB: 1zmc_A* 2f5z_A* 1zy8_A* 3rnm_A* Back     alignment and structure
>4dsg_A UDP-galactopyranose mutase; rossmann fold, flavin adenine dinucleotide, isomerase; HET: FAD UDP; 2.25A {Trypanosoma cruzi} PDB: 4dsh_A* Back     alignment and structure
>1dxl_A Dihydrolipoamide dehydrogenase; oxidoreductase, multienzyme complex protein, pyruvate dehydrogenase complex, glycine decarboxylase complex; HET: FAD; 3.15A {Pisum sativum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1ebd_A E3BD, dihydrolipoamide dehydrogenase; redox-active center, glycolysis, oxidoreductase; HET: FAD; 2.60A {Geobacillus stearothermophilus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1ojt_A Surface protein; redox-active center, glycolysis, oxidoreductase, NAD, flavop FAD, P64K; HET: FAD; 2.75A {Neisseria meningitidis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1bhy_A* Back     alignment and structure
>1v59_A Dihydrolipoamide dehydrogenase; 2-oxoacid dehydroganese complex, pyruvate dehydrogenase complex; HET: FAD NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1jeh_A* Back     alignment and structure
>1y56_A Hypothetical protein PH1363; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>2hqm_A GR, grase, glutathione reductase; glutathione reductase complexed with FAD, oxidoreductase; HET: NAG FAD GSH; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2iid_A L-amino-acid oxidase; flavoenzyme, FAD binding domain, reaction mechanism, sustrat binding, oxidoreductase; HET: NAG FUC PHE FAD; 1.80A {Calloselasma rhodostoma} SCOP: c.3.1.2 d.16.1.5 PDB: 1f8s_A* 1f8r_A* 1reo_A* 1tdk_A* 1tdn_A* 1tdo_A* 3kve_A* 4e0v_A* Back     alignment and structure
>2a8x_A Dihydrolipoyl dehydrogenase, E3 component of alpha; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha keto acid dehydrogenase; HET: FAD; 2.40A {Mycobacterium tuberculosis} PDB: 3ii4_A* Back     alignment and structure
>1cjc_A Protein (adrenodoxin reductase); flavoenzyme, MAD analysis, electron transferase, oxidoreductase; HET: FAD; 1.70A {Bos taurus} SCOP: c.3.1.1 c.4.1.1 PDB: 1e1k_A* 1e1l_A* 1e1m_A* 1e1n_A* 1e6e_A* Back     alignment and structure
>3urh_A Dihydrolipoyl dehydrogenase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium; HET: FAD; 1.90A {Sinorhizobium meliloti} Back     alignment and structure
>2aqj_A Tryptophan halogenase, pRNA; flavin-dependent halogenase, helical bundle, sandwiched sheets, structural genomics; HET: TRP FAD; 1.80A {Pseudomonas fluorescens} PDB: 2apg_A* 2ar8_A* 2ard_A* 2jkc_A* Back     alignment and structure
>2yqu_A 2-oxoglutarate dehydrogenase E3 component; lipoamide dehydrogenase, 2-oxoglutarate dehydrogenase comple pyruvate dehydrogenase complex; HET: FAD; 1.70A {Thermus thermophilus} PDB: 2eq7_A* Back     alignment and structure
>1lvl_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD NAD; 2.45A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1xdi_A RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno function; HET: FAD; 2.81A {Mycobacterium tuberculosis} SCOP: c.3.1.5 d.87.1.1 Back     alignment and structure
>2v3a_A Rubredoxin reductase; alkane degradation, NADH oxidoreductase, rubredoxin reductas NAD, flavoprotein, oxidoreductase; HET: FAD; 2.4A {Pseudomonas aeruginosa} PDB: 2v3b_A* Back     alignment and structure
>3jsk_A Cypbp37 protein; octameric thiazole synthase, biosynthetic protein; HET: AHZ; 2.70A {Neurospora crassa} Back     alignment and structure
>1b37_A Protein (polyamine oxidase); flavin-dependent amine oxidase, oxidoreductase; HET: NAG FCA MAN FAD; 1.90A {Zea mays} SCOP: c.3.1.2 d.16.1.5 PDB: 1b5q_A* 1h81_A* 1h82_A* 1h83_A* 1h84_A* 1h86_A* 3kpf_A* 3ku9_A* 3l1r_A* Back     alignment and structure
>1ges_A Glutathione reductase; oxidoreductase(flavoenzyme); HET: FAD; 1.74A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1geu_A* 1ger_A* 1get_A* Back     alignment and structure
>1lqt_A FPRA; NADP+ derivative, oxidoreductase, structural G PSI, protein structure initiative, TB structural genomics consortium, TBSGC; HET: FAD ODP; 1.05A {Mycobacterium tuberculosis} SCOP: c.3.1.1 c.4.1.1 PDB: 1lqu_A* 2c7g_A* Back     alignment and structure
>1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A* Back     alignment and structure
>4hb9_A Similarities with probable monooxygenase; flavin, structural genomics, NEW YORK structural genomics RE consortium, nysgrc, PSI; HET: MSE FAD; 1.93A {Photorhabdus luminescens} Back     alignment and structure
>3qfa_A Thioredoxin reductase 1, cytoplasmic; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_A* 2j3n_A* 2zzc_A* 2zzb_A* 2zz0_A* 2cfy_A* 1h6v_A* 3ean_A* 3eao_A* Back     alignment and structure
>1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* Back     alignment and structure
>2r9z_A Glutathione amide reductase; NAD, FAD, substrate specificity, oxidoreductase; HET: FAD; 2.10A {Marichromatium gracile} PDB: 2rab_A* Back     alignment and structure
>2eq6_A Pyruvate dehydrogenase complex, dihydrolipoamide dehydrogenase E3 component; oxidoreductase, homodimer, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2eq8_A* 2eq9_A* Back     alignment and structure
>3o0h_A Glutathione reductase; ssgcid, structur genomics, seattle structural genomics center for infectious gluathione reductase, oxidoreductase; HET: FAD; 1.90A {Bartonella henselae} Back     alignment and structure
>3lad_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD; 2.20A {Azotobacter vinelandii} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1lpf_A* Back     alignment and structure
>3g3e_A D-amino-acid oxidase; FAD, flavoprotein, oxidoreductase, PER; HET: FAD G3E; 2.20A {Homo sapiens} PDB: 3cuk_A* 2e48_A* 2e49_A* 2e4a_A* 2e82_A* 2du8_A* 1ve9_A* 1dao_A* 1ddo_A* 1kif_A* 1an9_A* 1evi_A* Back     alignment and structure
>2z3y_A Lysine-specific histone demethylase 1; chromatin, nucleosome, transcription, LSD1, alternative splicing, chromatin regulator, coiled coil; HET: F2N; 2.25A {Homo sapiens} SCOP: a.4.1.18 c.3.1.2 d.16.1.5 PDB: 2ejr_A* 2z5u_A* 3abt_A* 3abu_A* 2y48_A* 2v1d_A* 2h94_A* 2iw5_A* 2uxn_A* 2uxx_A* 2hko_A* 2dw4_A* 2x0l_A* 2l3d_A Back     alignment and structure
>1onf_A GR, grase, glutathione reductase; oxidoreductase; HET: FAD; 2.60A {Plasmodium falciparum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3c4a_A Probable tryptophan hydroxylase VIOD; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.30A {Chromobacterium violaceum atcc 12472} Back     alignment and structure
>2e5v_A L-aspartate oxidase; archaea, oxidoreductase; HET: FAD; 2.09A {Sulfolobus tokodaii} Back     alignment and structure
>1fec_A Trypanothione reductase; redox-active center, oxidoreductase, flavoprotein, FAD, NADP; HET: FAD; 1.70A {Crithidia fasciculata} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1fea_A* 1feb_A* 2tpr_A* 1tyt_A* 1typ_A* 2jk6_A* 2w0h_A* 2yau_A* 2x50_A* 2ve2_A* Back     alignment and structure
>4dna_A Probable glutathione reductase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; HET: FAD; 2.80A {Sinorhizobium meliloti} Back     alignment and structure
>2gag_A Heterotetrameric sarcosine oxidase alpha-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_A* 1x31_A* 1vrq_A* 3ad7_A* 3ad8_A* 3ad9_A* 3ada_A* Back     alignment and structure
>1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 Back     alignment and structure
>2xag_A Lysine-specific histone demethylase 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_A* 2xah_A* 2xaj_A* 2xaq_A* 2xas_A* 2com_A Back     alignment and structure
>3dk9_A Grase, GR, glutathione reductase; flavoenzyme, nicotinamide, acetylation, alternative initiation, cytoplasm, FAD, flavoprotein, mitochondrion, NADP; HET: SO4 FAD; 0.95A {Homo sapiens} PDB: 1bwc_A* 1gra_A* 1gre_A* 1grf_A* 1grh_A* 1grb_A* 2gh5_A* 1gsn_A* 3dk4_A* 3dk8_A* 3djj_A* 3grs_A* 3sqp_A* 4gr1_A* 2aaq_A* 1dnc_A* 1grg_A* 1grt_A* 1xan_A* 5grt_A* ... Back     alignment and structure
>2wpf_A Trypanothione reductase; oxidoreductase, trypanosomiasis, sleeping sickness, flavoPro redox-active center; HET: FAD WPF; 1.90A {Trypanosoma brucei} PDB: 2wov_A* 2wow_A* 2wp5_A* 2wp6_A* 2wpc_A* 2wpe_A* 2woi_A* 2wba_A* 1nda_A* 1gxf_A* 1bzl_A* 1aog_A* Back     alignment and structure
>4b1b_A TRXR, thioredoxin reductase; oxidoreductase, FAD, NADPH, thiol-mediated redox metabolism, pyridine nucleotide-disulfide oxidoreductase; HET: FAD; 2.90A {Plasmodium falciparum} Back     alignment and structure
>3dgh_A TRXR-1, thioredoxin reductase 1, mitochondrial; oxidoreductase, rossmann, flavoprotein, alternative initiati mitochondrion, NADP; HET: FAD; 1.75A {Drosophila melanogaster} PDB: 2nvk_X* 3dh9_A* Back     alignment and structure
>3k30_A Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP binding site, oxidoreductase; HET: FMN ADP; 2.70A {Pimelobacter simplex} Back     alignment and structure
>3dgz_A Thioredoxin reductase 2; oxidoreductase, rossmann, flavoprotein, FAD, mitochondrion, redox-active center, selenium, selenocysteine, transit PEPT; HET: FAD NA7; 2.25A {Mus musculus} PDB: 1zkq_A* 1zdl_A* Back     alignment and structure
>2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A* Back     alignment and structure
>1kf6_A Fumarate reductase flavoprotein; respiration, fumarate reductace, succinate dehydrogenase, CO quinol, quinone, oxidoreductase; HET: FAD HQO CE1 1PE; 2.70A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1kfy_A* 1l0v_A* 2b76_A* 3cir_A* 3p4p_A* 3p4q_A* 3p4r_A* 3p4s_A* Back     alignment and structure
>1kdg_A CDH, cellobiose dehydrogenase; GMC oxidoreductase, PHBH fold, alpha/beta structure, rossman 6-hydroxylated FAD, oxidoreductase; HET: NAG MAN 6FA EMT; 1.50A {Phanerochaete chrysosporium} SCOP: c.3.1.2 d.16.1.1 PDB: 1naa_A* Back     alignment and structure
>1o94_A Tmadh, trimethylamine dehydrogenase; electron transport, protein complex; HET: FMN ADP AMP; 2.0A {Methylophilus methylotrophus} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 PDB: 1djn_A* 1o95_A* 2tmd_A* 1djq_A* Back     alignment and structure
>3ic9_A Dihydrolipoamide dehydrogenase; APC62701, colwellia psychrer 34H, structural genomics, PSI-2; HET: FAD; 2.15A {Colwellia psychrerythraea} Back     alignment and structure
>3t37_A Probable dehydrogenase; BET alpha beta fold, ADP binding, oxidoreductase; HET: FAD; 2.19A {Mesorhizobium loti} Back     alignment and structure
>1ju2_A HydroxynitrIle lyase; flavin, GMC oxidoreductase, almond, cyanogenesis; HET: NAG NDG FUC BMA MAN FAD; 1.47A {Prunus dulcis} SCOP: c.3.1.2 d.16.1.1 PDB: 3gdp_A* 3gdn_A* Back     alignment and structure
>3q9t_A Choline dehydrogenase and related flavoproteins; glucose-methanol-choline oxidoreductase family, formate OXID formyl-FAD, oxidoreductase; HET: FAY; 2.24A {Aspergillus oryzae} Back     alignment and structure
>3c4a_A Probable tryptophan hydroxylase VIOD; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.30A {Chromobacterium violaceum atcc 12472} Back     alignment and structure
>4gde_A UDP-galactopyranose mutase; flavin adenine dinucleotide binding, nucleotide binding, MUT isomerase; HET: FDA; 2.20A {Aspergillus fumigatus} PDB: 3ute_A* 3utg_A* 3uth_A* 4gdc_A* 4gdd_A* 3utf_A* 3ukh_A* 3ukf_A* 3uka_A* 3ukl_A* 3ukk_A* 3ukq_A* 3ukp_A* Back     alignment and structure
>1coy_A Cholesterol oxidase; oxidoreductase(oxygen receptor); HET: AND FAD; 1.80A {Brevibacterium sterolicum} SCOP: c.3.1.2 d.16.1.1 PDB: 3cox_A* Back     alignment and structure
>1vg0_A RAB proteins geranylgeranyltransferase component A 1; RAB prenylation, post-translational modification, protein binding/protein transport complex; HET: GER GDP PG4; 2.20A {Rattus norvegicus} SCOP: c.3.1.3 d.16.1.6 PDB: 1vg9_A* 1ltx_R* Back     alignment and structure
>3qvp_A Glucose oxidase; oxidoreductase; HET: NAG BMA MAN FAD; 1.20A {Aspergillus niger} PDB: 1gal_A* 1cf3_A* 3qvr_A* Back     alignment and structure
>1chu_A Protein (L-aspartate oxidase); flavoenzyme, NAD biosynthesis, FAD, oxidoreductase; 2.20A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1knr_A* 1knp_A* Back     alignment and structure
>3ayj_A Pro-enzyme of L-phenylalanine oxidase; amino acid oxidase, flavoenzyme, L- binding, oxidoreductase; HET: FAD PHE; 1.10A {Pseudomonas} PDB: 2yr4_A* 2yr6_A* 3ayi_A* 2yr5_A* 3ayl_A* Back     alignment and structure
>1n4w_A CHOD, cholesterol oxidase; flavoenzyme, steroid metabolism, oxidoreductase, atomic RESO; HET: FAD; 0.92A {Streptomyces SP} SCOP: c.3.1.2 d.16.1.1 PDB: 1b4v_A* 1n1p_A* 1n4u_A* 1n4v_A* 1mxt_A* 2gew_A* 1b8s_A* 3gyi_A* 1cc2_A* 3gyj_A* 1ijh_A* 1cbo_A* 3b3r_A* 3b6d_A* 3cnj_A* Back     alignment and structure
>3fim_B ARYL-alcohol oxidase; AAO, lignin degradation, oxidoreductase, flavoprotein; HET: FAD; 2.55A {Pleurotus eryngii} Back     alignment and structure
>3pl8_A Pyranose 2-oxidase; substrate complex, H167A mutant, homotetramer, GMC oxidoredu PHBH fold, rossmann domain, oxidoreductase; HET: FAD MES G3F; 1.35A {Trametes ochracea} PDB: 2igo_A* 3lsm_A* 2ign_A* 3k4c_A* 1tt0_A* 2igk_A* 3k4b_A* 3lsk_A* 3bg6_A* 3lsh_A* 3lsi_A* 2igm_A* 3k4j_A* 3k4m_A* 3bg7_A* 3k4k_A* 3k4l_A* 3bly_A* 1tzl_A* 3fdy_A* ... Back     alignment and structure
>1gpe_A Protein (glucose oxidase); oxidoreductase(flavoprotein); HET: NAG BMA MAN FAD; 1.80A {Penicillium amagasakiense} SCOP: c.3.1.2 d.16.1.1 Back     alignment and structure
>2jbv_A Choline oxidase; alcohol oxidation, flavoenyzme oxidase, covalently linked FAD, C4A-adduct, flavoprotein, oxidoreductase; HET: FAO; 1.86A {Arthrobacter globiformis} PDB: 3nne_A* 3ljp_A* Back     alignment and structure
>4b63_A L-ornithine N5 monooxygenase; oxidoreductase, siderophore, flavin; HET: FAD NAP; 1.90A {Aspergillus fumigatus} PDB: 4b64_A* 4b65_A* 4b66_A* 4b67_A* 4b68_A* 4b69_A* Back     alignment and structure
>3kkj_A Amine oxidase, flavin-containing; oxidoreductase, PSR10, Q888A4, X-RAY, structure, PSI, protein structure initiative; HET: FAD; 2.50A {Pseudomonas syringae PV} Back     alignment and structure
>3gyx_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 3.20A {Desulfovibrio gigas} Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>4dgk_A Phytoene dehydrogenase; the FAD/NAD(P)-binding rossmann fold, oxidoreductase; 2.35A {Pantoea ananatis} Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>3dfz_A SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase, cobalamin biosynthesis, NAD, oxidoreducta porphyrin biosynthesis; 2.30A {Bacillus megaterium} Back     alignment and structure
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Back     alignment and structure
>3rp8_A Flavoprotein monooxygenase; FAD-binding protein, oxidoreductase; HET: FAD; 1.97A {Klebsiella pneumoniae} PDB: 3rp7_A* 3rp6_A* Back     alignment and structure
>2iid_A L-amino-acid oxidase; flavoenzyme, FAD binding domain, reaction mechanism, sustrat binding, oxidoreductase; HET: NAG FUC PHE FAD; 1.80A {Calloselasma rhodostoma} SCOP: c.3.1.2 d.16.1.5 PDB: 1f8s_A* 1f8r_A* 1reo_A* 1tdk_A* 1tdn_A* 1tdo_A* 3kve_A* 4e0v_A* Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>3eag_A UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME diaminopimelate ligase; UDP-N-acetylmuramate:L-alanyl-G glutamyl-MESO-diaminopimelate ligase; 2.55A {Neisseria meningitidis MC58} Back     alignment and structure
>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>3c96_A Flavin-containing monooxygenase; FAD, oxidoreductase, PF01266, NESG, PAR240, structural genomics, PSI-2; HET: FAD; 1.90A {Pseudomonas aeruginosa PAO1} SCOP: c.3.1.2 d.16.1.2 PDB: 2rgj_A* Back     alignment and structure
>3lk7_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; agalacitae, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: MSE; 1.50A {Streptococcus agalactiae} Back     alignment and structure
>3oz2_A Digeranylgeranylglycerophospholipid reductase; structural genomics, joint center for structural genomics; HET: MSE FAD OZ2; 1.60A {Thermoplasma acidophilum} Back     alignment and structure
>2bcg_G Secretory pathway GDP dissociation inhibitor; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.3.1.3 c.3.1.3 d.16.1.6 PDB: 1ukv_G* 3cpi_G 3cph_G 3cpj_G* Back     alignment and structure
>3ihm_A Styrene monooxygenase A; rossman fold, anti-parallel beta strands, dimer, cavity, oxidoreductase; 2.30A {Pseudomonas putida} Back     alignment and structure
>1d5t_A Guanine nucleotide dissociation inhibitor; ultra-high resolution, hydrolase inhibitor; 1.04A {Bos taurus} SCOP: c.3.1.3 d.16.1.6 PDB: 1lv0_A* 1gnd_A Back     alignment and structure
>2qa2_A CABE, polyketide oxygenase CABE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 2.70A {Streptomyces} Back     alignment and structure
>3nix_A Flavoprotein/dehydrogenase; structural genomics, PSI-2, NES protein structure initiative, northeast structural genomics consortium; HET: FAD; 2.60A {Cytophaga hutchinsonii} Back     alignment and structure
>3i3l_A Alkylhalidase CMLS; flavin-dependent halogenase, chloramphenicol biosynthesis, halogenation reaction, structural genomics; HET: FAD; 2.20A {Streptomyces venezuelae} Back     alignment and structure
>3hwr_A 2-dehydropantoate 2-reductase; YP_299159.1, PANE/APBA family ketopantoate reductase, struct genomics, joint center for structural genomics; HET: NDP BCN; 2.15A {Ralstonia eutropha} Back     alignment and structure
>2qa1_A PGAE, polyketide oxygenase PGAE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 1.80A {Streptomyces} Back     alignment and structure
>2r0c_A REBC; flavin adenine dinucleotide, monooxygenase, oxidoreductase; HET: FAD; 1.80A {Lechevalieria aerocolonigenes} PDB: 2r0g_A* 2r0p_A* 3ept_A* Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>3nrn_A Uncharacterized protein PF1083; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: AMP; 2.10A {Pyrococcus furiosus} Back     alignment and structure
>2pyx_A Tryptophan halogenase; structural genomics, JOI for structural genomics, JCSG, protein structure initiative biosynthetic protein; HET: MSE TLA PG4; 1.50A {Shewanella frigidimarina} Back     alignment and structure
>3fmw_A Oxygenase; mithramycin, baeyer-villiger, flavin binding protein, oxidoreductase; HET: FAD; 2.89A {Streptomyces argillaceus} Back     alignment and structure
>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* Back     alignment and structure
>3ka7_A Oxidoreductase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: FAD; 1.80A {Methanosarcina mazei} Back     alignment and structure
>3fpz_A Thiazole biosynthetic enzyme; FAD, mitochondrion, N thiamine biosynthesis, transit peptide, biosynthetic protei; HET: AHZ; 1.82A {Saccharomyces cerevisiae} Back     alignment and structure
>4e12_A Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1.93A {Acinetobacter baylyi} PDB: 4dyd_A* 4e13_A* Back     alignment and structure
>1f0y_A HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive ternary complex, oxidoreductase; HET: CAA NAD; 1.80A {Homo sapiens} SCOP: a.100.1.3 c.2.1.6 PDB: 3rqs_A 1lsj_A* 1il0_A* 1lso_A* 1m76_A* 1m75_A* 1f14_A 1f12_A 1f17_A* 3had_A* 2hdh_A* 3hdh_A* Back     alignment and structure
>3nks_A Protoporphyrinogen oxidase; FAD containing protein, PPO, variegate porphyria disease, VP oxidoreductase-oxidoreductase inhibitor complex; HET: ACJ FAD; 1.90A {Homo sapiens} Back     alignment and structure
>3dme_A Conserved exported protein; structural genomics, PSI-2, PROT structure initiative, northeast structural genomics consort NESG; HET: FAD TLA; 1.70A {Bordetella pertussis} Back     alignment and structure
>3k7m_X 6-hydroxy-L-nicotine oxidase; enantiomeric substrates, flavoenzymes, nicotine degradation, oxidoreductase; HET: FAD GP7; 1.95A {Arthrobacter nicotinovorans} PDB: 3k7q_X* 3ng7_X* 3ngc_X* 3nh3_X* 3nho_X* 3nk0_X* 3nk1_X* 3nk2_X* 3nn0_X* 3nn6_X* 3k7t_A* Back     alignment and structure
>3dfz_A SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase, cobalamin biosynthesis, NAD, oxidoreducta porphyrin biosynthesis; 2.30A {Bacillus megaterium} Back     alignment and structure
>3v76_A Flavoprotein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: FDA; 2.51A {Sinorhizobium meliloti} Back     alignment and structure
>2jae_A L-amino acid oxidase; oxidoreductase, dimerisation mode, hydride transfer mechanism, GR2-family, flavoenzyme, FAD containing; HET: FAD; 1.25A {Rhodococcus opacus} PDB: 2jb1_A* 2jb2_A* 2jb3_A* Back     alignment and structure
>2e1m_A L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP} Back     alignment and structure
>2oln_A NIKD protein; flavoprotein, rossmann fold, oxidoreductase; HET: FAD; 1.15A {Streptomyces tendae} PDB: 2olo_A* 3hzl_A* 2q6u_A* Back     alignment and structure
>1ryi_A Glycine oxidase; flavoprotein, protein-inhibitor complex, oxidoreductase; HET: FAD; 1.80A {Bacillus subtilis} SCOP: c.3.1.2 d.16.1.3 PDB: 3if9_A* 1ng4_A* 1ng3_A* Back     alignment and structure
>3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} Back     alignment and structure
>2b9w_A Putative aminooxidase; isomerase, conjugated linoleic acid, FAD; HET: FAD 12P; 1.95A {Propionibacterium acnes} PDB: 2b9x_A* 2b9y_A* 2ba9_A* 2bab_A* 2bac_A* Back     alignment and structure
>2dkh_A 3-hydroxybenzoate hydroxylase; flavoprotein, monooxygenase, complex, oxidoreductase; HET: FAD 3HB; 1.80A {Comamonas testosteroni} PDB: 2dki_A* Back     alignment and structure
>1kyq_A Met8P, siroheme biosynthesis protein Met8; homodimer, oxidoreductase, lyase; HET: NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.2.1.11 e.37.1.1 Back     alignment and structure
>2e4g_A Tryptophan halogenase; flavin-binding, rebeccamycin biosynthesis, biosynthetic protein, flavoprotein; HET: TRP; 2.08A {Lechevalieria aerocolonigenes} PDB: 2o9z_A 2oa1_A* 2oal_A* 2oam_A Back     alignment and structure
>2uzz_A N-methyl-L-tryptophan oxidase; N-methyltryptophan oxidase (MTOX), oxidative demethylation of N-methyl-L-tryptophan, FAD, flavoenzyme; HET: FAD; 3.2A {Escherichia coli} Back     alignment and structure
>1t2d_A LDH-P, L-lactate dehydrogenase; ternary complex, oxidoreductase; HET: NAD; 1.10A {Plasmodium falciparum} SCOP: c.2.1.5 d.162.1.1 PDB: 1t25_A* 1t26_A* 1t2c_A* 1t24_A* 2x8l_A 2ydn_A* 2a94_A* 1u4s_A* 1u5a_A* 1u5c_A* 1u4o_A* 1t2e_A* 1xiv_A* 1ceq_A 1ldg_A* 1cet_A* 1oc4_A* 2a92_A* 2aa3_A* Back     alignment and structure
>3g5s_A Methylenetetrahydrofolate--tRNA-(uracil-5-)- methyltransferase TRMFO; tRNA methyltransferase FAD folate, FAD, flavoprotein; HET: MSE FAD GSH; 1.05A {Thermus thermophilus} PDB: 3g5q_A* 3g5r_A* Back     alignment and structure
>2ewd_A Lactate dehydrogenase,; protein-substrate_cofactor analog complex, oxidoreductase; HET: A3D; 2.00A {Cryptosporidium parvum} PDB: 2frm_A 2fn7_A* 2fnz_A* 2fm3_A Back     alignment and structure
>1c0p_A D-amino acid oxidase; alpha-beta-alpha motif, flavin containing protein, oxidoreductase; HET: FAD; 1.20A {Rhodosporidium toruloides} SCOP: c.4.1.2 d.16.1.3 PDB: 1c0i_A* 1c0l_A* 1c0k_A* Back     alignment and structure
>2gf3_A MSOX, monomeric sarcosine oxidase; flavoprotein oxidase, inhibitor 2-furoic acid, oxidoreductas; HET: FAD; 1.30A {Bacillus SP} SCOP: c.3.1.2 d.16.1.3 PDB: 1el7_A* 1el8_A* 1el9_A* 1eli_A* 1l9e_A* 2a89_A* 2gb0_A* 1el5_A* 3qse_A* 3qsm_A* 3qss_A* 3bhk_A* 3bhf_A* 3m12_A* 3m13_A* 3m0o_A* 1l9c_A* 1l9d_A* 1zov_A* Back     alignment and structure
>2bs2_A Quinol-fumarate reductase flavoprotein subunit A; 2Fe-2S, 3Fe-4S, 4Fe-4S, citric acid cycle, dihaem cytochrome B; HET: FAD HEM LMT; 1.78A {Wolinella succinogenes} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 2bs3_A* 1e7p_A* 2bs4_A* 1qlb_A* Back     alignment and structure
>3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3qj4_A Renalase; FAD/NAD(P)-binding rossmann fold superfamily, flavin contain oxidoreductase, monoamine oxidase, NAD, extracellular, oxidoreductase; HET: FAD; 2.50A {Homo sapiens} Back     alignment and structure
>3ado_A Lambda-crystallin; L-gulonate 3-dehydrogenase, structural genomics, riken struc genomics/proteomics initiative, RSGI, acetylation; 1.70A {Oryctolagus cuniculus} PDB: 3adp_A* 3f3s_A* Back     alignment and structure
>1rsg_A FMS1 protein; FAD binding motif, oxidoreductase; HET: FAD; 1.90A {Saccharomyces cerevisiae} PDB: 1z6l_A* 3bi2_A* 3bi4_A* 3bi5_A* 3bnm_B* 3bnu_B* 3cn8_B* 3cnd_B* 3cnp_B* 3cns_A* 3cnt_B* 1yy5_A* 1xpq_A* Back     alignment and structure
>1vg0_A RAB proteins geranylgeranyltransferase component A 1; RAB prenylation, post-translational modification, protein binding/protein transport complex; HET: GER GDP PG4; 2.20A {Rattus norvegicus} SCOP: c.3.1.3 d.16.1.6 PDB: 1vg9_A* 1ltx_R* Back     alignment and structure
>4dio_A NAD(P) transhydrogenase subunit alpha PART 1; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.60A {Sinorhizobium meliloti} Back     alignment and structure
>2weu_A Tryptophan 5-halogenase; regioselectivity, antifungal protei; HET: TRP; 1.70A {Streptomyces rugosporus} PDB: 2wet_A* 2wes_A* Back     alignment and structure
>2x5o_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; ATP-binding, cell cycle, cell division, cell shape, cell WAL biogenesis/degradation; HET: KCX VSV; 1.46A {Escherichia coli} PDB: 2wjp_A* 2xpc_A* 2y1o_A* 2jff_A* 2jfh_A* 2uuo_A* 2uup_A* 2vtd_A* 2vte_A* 2jfg_A* 2y66_A* 2y67_A* 2y68_A* 4uag_A* 1e0d_A* 1uag_A* 1eeh_A* 3uag_A* 2uag_A* Back     alignment and structure
>1b37_A Protein (polyamine oxidase); flavin-dependent amine oxidase, oxidoreductase; HET: NAG FCA MAN FAD; 1.90A {Zea mays} SCOP: c.3.1.2 d.16.1.5 PDB: 1b5q_A* 1h81_A* 1h82_A* 1h83_A* 1h84_A* 1h86_A* 3kpf_A* 3ku9_A* 3l1r_A* Back     alignment and structure
>1y56_B Sarcosine oxidase; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>1pn0_A Phenol 2-monooxygenase; two dimers, TLS refinement, oxidoreductase; HET: FAD; 1.70A {Trichosporon cutaneum} SCOP: c.3.1.2 c.47.1.10 d.16.1.2 PDB: 1foh_A* Back     alignment and structure
>1s3e_A Amine oxidase [flavin-containing] B; human monoamine oxidase, inhibitor binding, rasagiline, enantioselectivity, oxidoreductase; HET: FAD RHP; 1.60A {Homo sapiens} SCOP: c.3.1.2 d.16.1.5 PDB: 1gos_A* 1oj9_A* 1ojb_A* 1ojc_A* 1ojd_A* 1s2q_A* 1s2y_A* 1oja_A* 1s3b_A* 2bk3_A* 2byb_A* 2c64_A* 2c65_A* 2c66_A* 2c67_A* 2c70_A* 2v5z_A* 2v60_A* 2v61_A* 2vrl_A* ... Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>2bi7_A UDP-galactopyranose mutase; FAD, flavoprotein, isomerase, lipopolysaccharide biosynthesi; HET: FAD; 2.0A {Klebsiella pneumoniae} SCOP: c.4.1.3 d.16.1.7 PDB: 2bi8_A* 1wam_A* 3inr_A* 3gf4_A* 3int_A* 3kyb_A* Back     alignment and structure
>3lk7_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; agalacitae, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: MSE; 1.50A {Streptococcus agalactiae} Back     alignment and structure
>1bg6_A N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L) stereospecific opine dehydrogenase, oxidoreductase; 1.80A {Arthrobacter SP} SCOP: a.100.1.5 c.2.1.6 Back     alignment and structure
>3nyc_A D-arginine dehydrogenase; FAD, imino-arginine, oxidoreductas; HET: FAD IAR; 1.06A {Pseudomonas aeruginosa} PDB: 3nye_A* 3nyf_A* 3sm8_A* Back     alignment and structure
>3e1t_A Halogenase; flavoprotein; HET: FAD; 2.05A {Chondromyces crocatus} Back     alignment and structure
>2a9f_A Putative malic enzyme ((S)-malate:NAD+ oxidoreductase (decarboxylating)); hypothetical protein, structural genomics, PSI; 2.50A {Streptococcus pyogenes} Back     alignment and structure
>2ivd_A PPO, PPOX, protoporphyrinogen oxidase; porphyrin biosynthesis, chlorophyll biosynthesis, oxidoreductase, HAEM biosynthesis, heme biosynthesis; HET: ACJ FAD TWN; 2.3A {Myxococcus xanthus} SCOP: c.3.1.2 d.16.1.5 PDB: 2ive_A* Back     alignment and structure
>3i6d_A Protoporphyrinogen oxidase; protein-inhibitor complex, cytoplasm, FAD, flavoprotein, oxidoreductase, porphyrin biosynthesis; HET: FAD ACJ; 2.90A {Bacillus subtilis} Back     alignment and structure
>3i83_A 2-dehydropantoate 2-reductase; structural genomics, oxidoreductase, NADP, pantothenate BIOS PSI-2, protein structure initiative; 1.90A {Methylococcus capsulatus} Back     alignment and structure
>1sez_A Protoporphyrinogen oxidase, mitochondrial; FAD-binding, para-hydroxy-benzoate-hydroxylase fold (PHBH- fold), monotopic membrane-binding domain; HET: FAD OMN TON; 2.90A {Nicotiana tabacum} SCOP: c.3.1.2 d.16.1.5 Back     alignment and structure
>3hn7_A UDP-N-acetylmuramate-L-alanine ligase; ATP-binding, nucleotide-binding, structural genomics, joint for structural genomics, JCSG; HET: MSE; 1.65A {Psychrobacter arcticus 273-4} Back     alignment and structure
>2yg5_A Putrescine oxidase; oxidoreductase, flavin; HET: FAD; 1.90A {Rhodococcus erythropolis} PDB: 2yg6_A* 2yg3_A* 2yg4_A* 2yg7_A* 3rha_A* Back     alignment and structure
>3hn2_A 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, structural GE protein structure initiative; 2.50A {Geobacter metallireducens} Back     alignment and structure
>3dje_A Fructosyl amine: oxygen oxidoreductase; fructosyl-amino acid, amadoriase, deglycation, fructosamine oxidase; HET: MSE FAD FSA EPE; 1.60A {Aspergillus fumigatus} PDB: 3djd_A* Back     alignment and structure
>2gag_B Heterotetrameric sarcosine oxidase beta-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_B* 1x31_B* 1vrq_B* 3ad7_B* 3ad8_B* 3ad9_B* 3ada_B* Back     alignment and structure
>3nlc_A Uncharacterized protein VP0956; FAD-binding protein, NESG, structural genomics, PSI-2, prote structure initiative; HET: FAD; 2.15A {Vibrio parahaemolyticus} Back     alignment and structure
>4hv4_A UDP-N-acetylmuramate--L-alanine ligase; MURC, yersinia pestis peptidoglycan synthesis; HET: AMP; 2.25A {Yersinia pestis} PDB: 2f00_A Back     alignment and structure
>3k6j_A Protein F01G10.3, confirmed by transcript evidenc; rossmann fold, oxidoreductase; 2.20A {Caenorhabditis elegans} Back     alignment and structure
>2ew2_A 2-dehydropantoate 2-reductase, putative; alpha-structure, alpha-beta structure, structural genomics, protein structure initiative; HET: MSE; 2.00A {Enterococcus faecalis} Back     alignment and structure
>3p2y_A Alanine dehydrogenase/pyridine nucleotide transhy; seattle structural genomics center for infectious disease, S tuberculosis; 1.82A {Mycobacterium smegmatis str} Back     alignment and structure
>1jnr_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 1.60A {Archaeoglobus fulgidus dsm 4304} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1jnz_A* 2fjb_A* 2fja_A* 2fjd_A* 2fje_A* Back     alignment and structure
>3hdq_A UDP-galactopyranose mutase; substrate and inhibitor, isomerase; HET: GDU FAD; 2.36A {Deinococcus radiodurans} PDB: 3hdy_A* 3he3_A* 3mj4_A* Back     alignment and structure
>3ghy_A Ketopantoate reductase protein; oxidoreductase, NAD-binding domain, PSI-2, NYSGXRC, structur genomics, protein structure initiative; 2.00A {Ralstonia solanacearum} Back     alignment and structure
>1lld_A L-lactate dehydrogenase; oxidoreductase(CHOH (D)-NAD (A)); HET: NAD; 2.00A {Bifidobacterium longum subsp} SCOP: c.2.1.5 d.162.1.1 PDB: 1lth_T* Back     alignment and structure
>2i0z_A NAD(FAD)-utilizing dehydrogenases; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: FAD; 1.84A {Bacillus cereus} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>3ps9_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; rossmann fold, oxidase, methyl transferase, FAD; HET: FAD SAM; 2.54A {Escherichia coli} PDB: 3awi_A* Back     alignment and structure
>2vvm_A Monoamine oxidase N; FAD, peroxisome, flavoprotein, oxidoreductase, enantioselectivity, directed evolution variant; HET: FAD; 1.85A {Aspergillus niger} PDB: 2vvl_A* 2vvl_G* Back     alignment and structure
>3pvc_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; structural genomics, PSI-biology; HET: FAD; 2.31A {Yersinia pestis} PDB: 3sgl_A* Back     alignment and structure
>3g3e_A D-amino-acid oxidase; FAD, flavoprotein, oxidoreductase, PER; HET: FAD G3E; 2.20A {Homo sapiens} PDB: 3cuk_A* 2e48_A* 2e49_A* 2e4a_A* 2e82_A* 2du8_A* 1ve9_A* 1dao_A* 1ddo_A* 1kif_A* 1an9_A* 1evi_A* Back     alignment and structure
>1pzg_A LDH, lactate dehydrogenase; apicomplexa, APAD, tetramer, rossmann fold, oxidoreductase; HET: CME A3D; 1.60A {Toxoplasma gondii} SCOP: c.2.1.5 d.162.1.1 PDB: 1pzf_A* 1pze_A* 1pzh_A* 3om9_A* 1sov_A 1sow_A* 3czm_A* Back     alignment and structure
>4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus} Back     alignment and structure
>2hjr_A Malate dehydrogenase; malaria, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: CIT APR; 2.20A {Cryptosporidium parvum} Back     alignment and structure
>2qcu_A Aerobic glycerol-3-phosphate dehydrogenase; glycerol-3-phoshate dehydrogenase, oxidoreductase; HET: BOG FAD TAM; 1.75A {Escherichia coli} PDB: 2r45_A* 2r46_A* 2r4e_A* 2r4j_A* Back     alignment and structure
>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 Back     alignment and structure
>3gg2_A Sugar dehydrogenase, UDP-glucose/GDP-mannose dehydrogenase family; structural genomics, oxidoreductase, PSI-2; HET: UGA; 1.70A {Porphyromonas gingivalis} Back     alignment and structure
>3c4n_A Uncharacterized protein DR_0571; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.40A {Deinococcus radiodurans R1} Back     alignment and structure
>3ego_A Probable 2-dehydropantoate 2-reductase; structural genomics, PANE, unknown function, cytoplasm, NADP, oxidoreductase; 1.90A {Bacillus subtilis} Back     alignment and structure
>1vl6_A Malate oxidoreductase; TM0542, NAD-dependent malic enzyme, structural genomics, JCS protein structure initiative, PSI; 2.61A {Thermotoga maritima} SCOP: c.2.1.7 c.58.1.3 PDB: 2hae_A* Back     alignment and structure
>1ez4_A Lactate dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.30A {Lactobacillus pentosus} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>1y6j_A L-lactate dehydrogenase; southeast collaboratory for structural genomics, secsg, protein struc initiative, PSI, oxidoreductase; 3.01A {Clostridium thermocellum} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>2raf_A Putative dinucleotide-binding oxidoreductase; NP_786167.1, NADP oxidoreductase coenzyme F420-dependent, structural genomics; HET: MSE NAP; 1.60A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>1v0j_A UDP-galactopyranose mutase; flavoprotein, isomerase; HET: FAD BCN; 2.25A {Mycobacterium tuberculosis} Back     alignment and structure
>1x13_A NAD(P) transhydrogenase subunit alpha; NAD(H)-binding domain, rossmann fold, oxidoreductase; 1.90A {Escherichia coli} PDB: 1x14_A* 1x15_A* 2bru_A* Back     alignment and structure
>1i8t_A UDP-galactopyranose mutase; rossman fold, FAD, contractase, isomerase; HET: FAD; 2.40A {Escherichia coli} SCOP: c.4.1.3 d.16.1.7 Back     alignment and structure
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Back     alignment and structure
>2v6b_A L-LDH, L-lactate dehydrogenase; oxidoreductase, radioresistance, NAD, cytoplasm, mesophilic, glycolysis; 2.50A {Deinococcus radiodurans} Back     alignment and structure
>2y0c_A BCEC, UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide, C fibrosis; HET: UGA; 1.75A {Burkholderia cepacia} PDB: 2y0d_A* 2y0e_A* Back     alignment and structure
>3qha_A Putative oxidoreductase; seattle structural genomics center for infectious disease, S mycobacterium avium 104, rossmann fold; 2.25A {Mycobacterium avium} Back     alignment and structure
>3eag_A UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME diaminopimelate ligase; UDP-N-acetylmuramate:L-alanyl-G glutamyl-MESO-diaminopimelate ligase; 2.55A {Neisseria meningitidis MC58} Back     alignment and structure
>1ur5_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle; HET: NAD; 1.75A {Chloroflexus aurantiacus} SCOP: c.2.1.5 d.162.1.1 PDB: 1uxg_A* 1guy_A* 1uxk_A* 1uxh_A* 1uxj_A* 1uxi_A* Back     alignment and structure
>3ado_A Lambda-crystallin; L-gulonate 3-dehydrogenase, structural genomics, riken struc genomics/proteomics initiative, RSGI, acetylation; 1.70A {Oryctolagus cuniculus} PDB: 3adp_A* 3f3s_A* Back     alignment and structure
>2rgh_A Alpha-glycerophosphate oxidase; flavoprotein oxidase, oxidoreductase; HET: FAD; 2.30A {Streptococcus SP} PDB: 2rgo_A* Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>3tl2_A Malate dehydrogenase; center for structural genomics of infectious diseases, csgid dehydrogenase, oxidoreductase, citric acid cycle; 1.70A {Bacillus anthracis} Back     alignment and structure
>2z3y_A Lysine-specific histone demethylase 1; chromatin, nucleosome, transcription, LSD1, alternative splicing, chromatin regulator, coiled coil; HET: F2N; 2.25A {Homo sapiens} SCOP: a.4.1.18 c.3.1.2 d.16.1.5 PDB: 2ejr_A* 2z5u_A* 3abt_A* 3abu_A* 2y48_A* 2v1d_A* 2h94_A* 2iw5_A* 2uxn_A* 2uxx_A* 2hko_A* 2dw4_A* 2x0l_A* 2l3d_A Back     alignment and structure
>3g17_A Similar to 2-dehydropantoate 2-reductase; structural genomics, putative 2-dehydropantoate 2-reductase, protein structure initiative; 2.30A {Staphylococcus aureus subsp} Back     alignment and structure
>4ffl_A PYLC; amino acid, biosynthesis of pyrrolysine, isopeptide bond for ATP-grAsp fold, ligase, ATP-binding, L-lysine and 3R-methyl ornithine; HET: LYS ADP ATP; 1.50A {Methanosarcina barkeri} PDB: 4ffm_A* 4ffn_A* 4ffo_A* 4ffp_A* 4ffr_A* Back     alignment and structure
>1y0p_A Fumarate reductase flavoprotein subunit; flavocytochrome, mesaconate, oxidoreductase; HET: HEM FAD; 1.50A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1qjd_A* 2b7s_A* 1jry_A* 2b7r_A* 1ksu_A* 1jrz_A* 1jrx_A* 1m64_A* 1p2h_A* 1p2e_A* 1kss_A* 1e39_A* 1q9i_A* 1lj1_A* Back     alignment and structure
>1jw9_B Molybdopterin biosynthesis MOEB protein; MOEB: modified rossmann fold, (2) Cys-X-X-Cys zinc-binding M MOAD: ubiquitin-like fold; 1.70A {Escherichia coli} SCOP: c.111.1.1 PDB: 1jwa_B* 1jwb_B* Back     alignment and structure
>2xag_A Lysine-specific histone demethylase 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_A* 2xah_A* 2xaj_A* 2xaq_A* 2xas_A* 2com_A Back     alignment and structure
>3doj_A AT3G25530, dehydrogenase-like protein; gamma-hydroxybutyrate dehydrogenase, 4-hydroxybutyrate dehydrogenase; 2.10A {Arabidopsis thaliana} Back     alignment and structure
>1l7d_A Nicotinamide nucleotide transhydrogenase, subunit alpha 1; transhydrogenase domain I, oxidoreductase; 1.81A {Rhodospirillum rubrum} SCOP: c.2.1.4 c.23.12.2 PDB: 1hzz_A* 1f8g_A 1l7e_A* 1u28_A* 1u2d_A* 1u2g_A* 1xlt_A* 2oo5_A* 2oor_A* 2frd_A* 2fsv_A* 1nm5_A* 2fr8_A* 1ptj_A* Back     alignment and structure
>3g79_A NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; structural genomics, protein structure initiative; 2.40A {Methanosarcina mazei GO1} Back     alignment and structure
>3hwr_A 2-dehydropantoate 2-reductase; YP_299159.1, PANE/APBA family ketopantoate reductase, struct genomics, joint center for structural genomics; HET: NDP BCN; 2.15A {Ralstonia eutropha} Back     alignment and structure
>3k96_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA, IDP01976, oxidoreductase, phospholipid biosynthesis; HET: EPE; 2.10A {Coxiella burnetii} Back     alignment and structure
>2q3e_A UDP-glucose 6-dehydrogenase; hexamer, structural genomics, S genomics consortium, SGC, oxidoreductase; HET: NAD UPG; 2.00A {Homo sapiens} PDB: 2qg4_A* 3khu_A* 3itk_A* 3tdk_A* 3ptz_A* 3prj_A* 3tf5_A Back     alignment and structure
>2raf_A Putative dinucleotide-binding oxidoreductase; NP_786167.1, NADP oxidoreductase coenzyme F420-dependent, structural genomics; HET: MSE NAP; 1.60A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>1ks9_A KPA reductase;, 2-dehydropantoate 2-reductase; PANE, APBA, ketopantoate reductase, rossman fold, monomer, APO, oxidoreductase; 1.70A {Escherichia coli} SCOP: a.100.1.7 c.2.1.6 PDB: 1yon_A* 1yjq_A* 2ofp_A* Back     alignment and structure
>3da1_A Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9KDW6 X-RAY, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.70A {Bacillus halodurans} Back     alignment and structure
>1pjc_A Protein (L-alanine dehydrogenase); oxidoreductase, NAD; HET: NAD; 2.00A {Phormidium lapideum} SCOP: c.2.1.4 c.23.12.2 PDB: 1pjb_A* 1say_A Back     alignment and structure
>3lov_A Protoporphyrinogen oxidase; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: FAD; 2.06A {Exiguobacterium sibiricum} Back     alignment and structure
>3axb_A Putative oxidoreductase; dinucleotide-binding fold; HET: FAD; 1.92A {Aeropyrum pernix} PDB: 3vqr_A* Back     alignment and structure
>3vtf_A UDP-glucose 6-dehydrogenase; two discrete alpha/beta domains, oxidoreducta; HET: UPG; 2.00A {Pyrobaculum islandicum} Back     alignment and structure
>3cky_A 2-hydroxymethyl glutarate dehydrogenase; rossmann fold, two domain enzyme, oxidoreductase; 2.30A {Eubacterium barkeri} Back     alignment and structure
>1qo8_A Flavocytochrome C3 fumarate reductase; oxidoreductase; HET: HEM FAD; 2.15A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 Back     alignment and structure
>3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A* Back     alignment and structure
>3ego_A Probable 2-dehydropantoate 2-reductase; structural genomics, PANE, unknown function, cytoplasm, NADP, oxidoreductase; 1.90A {Bacillus subtilis} Back     alignment and structure
>2gjc_A Thiazole biosynthetic enzyme, mitochondrial; glutathione reductase type II family, thiazole synthase, mitochondria DNA repair; HET: AHZ; 1.82A {Saccharomyces cerevisiae} PDB: 3fpz_A* Back     alignment and structure
>4dsg_A UDP-galactopyranose mutase; rossmann fold, flavin adenine dinucleotide, isomerase; HET: FAD UDP; 2.25A {Trypanosoma cruzi} PDB: 4dsh_A* Back     alignment and structure
>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* Back     alignment and structure
>3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3gvi_A Malate dehydrogenase; NAD, oxidoreductase, tricarboxylic acid cycle, structural genomics; HET: ADP; 2.25A {Brucella melitensis biovar ABORTUS2308} PDB: 3gvh_A* Back     alignment and structure
>4e12_A Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1.93A {Acinetobacter baylyi} PDB: 4dyd_A* 4e13_A* Back     alignment and structure
>3pqe_A L-LDH, L-lactate dehydrogenase; FBP, oxidoreductase; 2.20A {Bacillus subtilis} PDB: 3pqf_A* 3pqd_A* Back     alignment and structure
>4e21_A 6-phosphogluconate dehydrogenase (decarboxylating; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.30A {Geobacter metallireducens} Back     alignment and structure
>4at0_A 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidoreductase, dehydogenase, steroid catabolism; HET: FAD; 1.60A {Rhodococcus jostii} PDB: 4at2_A* Back     alignment and structure
>3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>1kyq_A Met8P, siroheme biosynthesis protein Met8; homodimer, oxidoreductase, lyase; HET: NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.2.1.11 e.37.1.1 Back     alignment and structure
>1zcj_A Peroxisomal bifunctional enzyme; peroxisomal multifunctional enzyme type 1, L-bifunction enzyme, MFE-1, fatty acid beta oxidation; 1.90A {Rattus norvegicus} Back     alignment and structure
>1z82_A Glycerol-3-phosphate dehydrogenase; TM0378, structural genom joint center for structural genomics, JCSG, protein structu initiative, PSI; HET: MSE NDP G3H G3P; 2.00A {Thermotoga maritima} Back     alignment and structure
>3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} Back     alignment and structure
>1y7t_A Malate dehydrogenase; NAD-dependent-MDH-NADPH complex, oxidoreductase; HET: NDP; 1.65A {Thermus thermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1iz9_A* 2cvq_A* 1bmd_A* 1bdm_A* 1wze_A* 1wzi_A* Back     alignment and structure
>3p7m_A Malate dehydrogenase; putative dehydrogenase, enzyme, structural genomics, center structural genomics of infectious diseases, csgid; 2.20A {Francisella tularensis} Back     alignment and structure
>1pjq_A CYSG, siroheme synthase; rossman fold, nucleotide binding motif, SAM, NAD, phosphoserine, transferase/oxidoreductase/lyase complex; HET: SEP PGE SAH; 2.21A {Salmonella typhimurium} SCOP: c.2.1.11 c.90.1.1 e.37.1.1 PDB: 1pjs_A* 1pjt_A* Back     alignment and structure
>3pid_A UDP-glucose 6-dehydrogenase; rossmann fold, oxidoreductase; 1.40A {Klebsiella pneumoniae} PDB: 3pln_A* 3pjg_A* 3phl_A* 3plr_A* Back     alignment and structure
>2qrj_A Saccharopine dehydrogenase, NAD+, L-lysine- forming; sulfate, rossmann fold, alpha-aminoadipate pathway, fungal lysine biosynthesis; 1.60A {Saccharomyces cerevisiae} PDB: 2qrk_A* 2qrl_A* 2q99_A 3ugk_A 3uh1_A* 3uha_A* Back     alignment and structure
>1mv8_A GMD, GDP-mannose 6-dehydrogenase; rossman fold, domain-swapped dimer, enzyme complex with COFA product, oxidoreductase; HET: SUC NAD GDX; 1.55A {Pseudomonas aeruginosa} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1mfz_A* 1muu_A* Back     alignment and structure
>2gmh_A Electron transfer flavoprotein-ubiquinone oxidoreductase; HET: BHG FAD UQ5; 2.50A {Sus scrofa} SCOP: c.3.1.2 d.16.1.8 d.58.1.6 PDB: 2gmj_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 551
d1feca3128 d.87.1.1 (A:358-485) Trypanothione reductase {Crit 2e-33
d3lada3124 d.87.1.1 (A:349-472) Dihydrolipoamide dehydrogenas 1e-31
d1gesa1217 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase 1e-31
d1gesa1217 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase 3e-14
d1v59a3123 d.87.1.1 (A:356-478) Dihydrolipoamide dehydrogenas 3e-30
d1h6va3133 d.87.1.1 (A:367-499) Mammalian thioredoxin reducta 1e-29
d1dxla3123 d.87.1.1 (A:348-470) Dihydrolipoamide dehydrogenas 1e-29
d1gesa3115 d.87.1.1 (A:336-450) Glutathione reductase {Escher 8e-29
d1mo9a3140 d.87.1.1 (A:384-523) NADH-dependent 2-ketopropyl c 2e-28
d1onfa3119 d.87.1.1 (A:377-495) Glutathione reductase {Plasmo 3e-28
d3grsa3115 d.87.1.1 (A:364-478) Glutathione reductase {Human 1e-27
d1onfa1259 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase 3e-26
d1onfa1259 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase 2e-08
d1ojta3128 d.87.1.1 (A:471-598) Dihydrolipoamide dehydrogenas 6e-26
d1onfa2117 c.3.1.5 (A:154-270) Glutathione reductase {Plasmod 1e-25
d1gesa2116 c.3.1.5 (A:147-262) Glutathione reductase {Escheri 6e-25
d1ebda1223 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehyd 2e-24
d1ebda1223 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehyd 3e-15
d1ebda3115 d.87.1.1 (A:347-461) Dihydrolipoamide dehydrogenas 3e-24
d3grsa1221 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase 4e-24
d3grsa1221 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase 4e-17
d1feca1240 c.3.1.5 (A:1-169,A:287-357) Trypanothione reductas 5e-24
d1feca1240 c.3.1.5 (A:1-169,A:287-357) Trypanothione reductas 2e-17
d1mo9a1261 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketop 8e-24
d1mo9a1261 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketop 4e-12
d1xdia2118 d.87.1.1 (A:349-466) Dihydrolipoamide dehydrogenas 1e-23
d1h6va2122 c.3.1.5 (A:171-292) Mammalian thioredoxin reductas 6e-22
d1v59a1233 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehyd 7e-22
d1v59a1233 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehyd 1e-17
d1lvla3123 d.87.1.1 (A:336-458) Dihydrolipoamide dehydrogenas 9e-22
d1feca2117 c.3.1.5 (A:170-286) Trypanothione reductase {Crith 1e-21
d1aoga2117 c.3.1.5 (A:170-286) Trypanothione reductase {Trypa 2e-20
d1ojta1229 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide deh 3e-20
d1ojta1229 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide deh 2e-14
d1dxla1221 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehyd 4e-20
d1dxla1221 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehyd 5e-19
d1ojta2125 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase 3e-19
d1d7ya1183 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredo 8e-18
d1xhca2122 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductas 2e-17
d3grsa2125 c.3.1.5 (A:166-290) Glutathione reductase {Human ( 3e-17
d1lvla1220 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehyd 7e-17
d1lvla1220 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehyd 4e-10
d1aoga1238 c.3.1.5 (A:3-169,A:287-357) Trypanothione reductas 1e-16
d1aoga1238 c.3.1.5 (A:3-169,A:287-357) Trypanothione reductas 2e-14
d3lada1229 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehyd 2e-16
d3lada1229 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehyd 2e-13
d1q1ra1185 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductas 4e-16
d1ebda2117 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase 7e-16
d1h6va1235 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin 9e-16
d1h6va1235 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin 6e-13
d1nhpa3126 d.87.1.1 (A:322-447) NADH peroxidase {Enterococcus 2e-15
d1lvla2115 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase 2e-15
d3lada2119 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase 2e-15
d1v59a2122 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase 4e-14
d1d7ya2121 c.3.1.5 (A:116-236) NADH-dependent ferredoxin redu 6e-14
d1nhpa1198 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enter 1e-12
d1dxla2123 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase 1e-12
d1m6ia2137 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF 1e-12
d1xdia1233 c.3.1.5 (A:2-161,A:276-348) Dihydrolipoamide dehyd 1e-11
d1xdia1233 c.3.1.5 (A:2-161,A:276-348) Dihydrolipoamide dehyd 2e-11
d1xhca1167 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite 2e-10
d1djqa2156 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, 3e-10
d1d5ta1336 c.3.1.3 (A:-2-291,A:389-431) Guanine nucleotide di 2e-09
d1q1ra2133 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseud 2e-09
d1mo9a2121 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl co 1e-08
d1b5qa1347 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Mai 2e-08
d1rp0a1278 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi 2e-07
d1gtea4196 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine de 2e-05
d1vdca1192 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase 2e-05
d2gqfa1253 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein H 2e-05
d1fcda1186 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulf 5e-05
d1fl2a1184 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide 1e-04
d1fl2a1184 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide 0.003
d1trba1190 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase 4e-04
d2i0za1251 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {B 0.001
d1y0pa2308 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 ( 0.001
d1ps9a2162 c.3.1.1 (A:466-627) 2,4-dienoyl-CoA reductase, C-t 0.002
d2bcgg1297 c.3.1.3 (G:5-301) Guanine nucleotide dissociation 0.004
>d1feca3 d.87.1.1 (A:358-485) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Length = 128 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: CO dehydrogenase flavoprotein C-domain-like
superfamily: FAD/NAD-linked reductases, dimerisation (C-terminal) domain
family: FAD/NAD-linked reductases, dimerisation (C-terminal) domain
domain: Trypanothione reductase
species: Crithidia fasciculata [TaxId: 5656]

 Score =  121 bits (305), Expect = 2e-33
 Identities = 50/122 (40%), Positives = 75/122 (61%), Gaps = 1/122 (0%)

Query: 413 YSAVPSAVFSQPPIGQVGLSEEQAIQEYGDIDVFTANFRPLKATLSGLPDRIFM-KLVLC 471
           ++ V  AVFS PP+G  G  EE A ++Y  + V+ ++F PL   +SG   + FM ++V  
Sbjct: 1   HTKVACAVFSIPPMGVCGYVEEDAAKKYDQVAVYESSFTPLMHNISGSTYKKFMVRIVTN 60

Query: 472 AKTNKVLGLHMCGEDAPEIVQGFAVAVKAGLTKADFDATVGVHPTAAEEFVTLRTPTRKI 531
               +VLG+HM G+ +PEI+Q  A+ +K G   +DF  T+GVHPT+AEE  ++RTP    
Sbjct: 61  HADGEVLGVHMLGDSSPEIIQSVAICLKMGAKISDFYNTIGVHPTSAEELCSMRTPAYFY 120

Query: 532 RK 533
            K
Sbjct: 121 EK 122
>d3lada3 d.87.1.1 (A:349-472) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Length = 124 Back     information, alignment and structure
>d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} Length = 217 Back     information, alignment and structure
>d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} Length = 217 Back     information, alignment and structure
>d1v59a3 d.87.1.1 (A:356-478) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 123 Back     information, alignment and structure
>d1h6va3 d.87.1.1 (A:367-499) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 133 Back     information, alignment and structure
>d1dxla3 d.87.1.1 (A:348-470) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Length = 123 Back     information, alignment and structure
>d1gesa3 d.87.1.1 (A:336-450) Glutathione reductase {Escherichia coli [TaxId: 562]} Length = 115 Back     information, alignment and structure
>d1mo9a3 d.87.1.1 (A:384-523) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Length = 140 Back     information, alignment and structure
>d1onfa3 d.87.1.1 (A:377-495) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Length = 119 Back     information, alignment and structure
>d3grsa3 d.87.1.1 (A:364-478) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Length = 115 Back     information, alignment and structure
>d1onfa1 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Length = 259 Back     information, alignment and structure
>d1onfa1 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Length = 259 Back     information, alignment and structure
>d1ojta3 d.87.1.1 (A:471-598) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Length = 128 Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Length = 117 Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Length = 116 Back     information, alignment and structure
>d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Length = 223 Back     information, alignment and structure
>d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Length = 223 Back     information, alignment and structure
>d1ebda3 d.87.1.1 (A:347-461) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Length = 115 Back     information, alignment and structure
>d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1feca1 c.3.1.5 (A:1-169,A:287-357) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Length = 240 Back     information, alignment and structure
>d1feca1 c.3.1.5 (A:1-169,A:287-357) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Length = 240 Back     information, alignment and structure
>d1mo9a1 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Length = 261 Back     information, alignment and structure
>d1mo9a1 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Length = 261 Back     information, alignment and structure
>d1xdia2 d.87.1.1 (A:349-466) Dihydrolipoamide dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Length = 118 Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 122 Back     information, alignment and structure
>d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 233 Back     information, alignment and structure
>d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 233 Back     information, alignment and structure
>d1lvla3 d.87.1.1 (A:336-458) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Length = 123 Back     information, alignment and structure
>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Length = 117 Back     information, alignment and structure
>d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Length = 117 Back     information, alignment and structure
>d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Length = 229 Back     information, alignment and structure
>d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Length = 229 Back     information, alignment and structure
>d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Length = 221 Back     information, alignment and structure
>d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Length = 221 Back     information, alignment and structure
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Length = 125 Back     information, alignment and structure
>d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Length = 183 Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Length = 122 Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Length = 220 Back     information, alignment and structure
>d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Length = 220 Back     information, alignment and structure
>d1aoga1 c.3.1.5 (A:3-169,A:287-357) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Length = 238 Back     information, alignment and structure
>d1aoga1 c.3.1.5 (A:3-169,A:287-357) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Length = 238 Back     information, alignment and structure
>d3lada1 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Length = 229 Back     information, alignment and structure
>d3lada1 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Length = 229 Back     information, alignment and structure
>d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Length = 185 Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Length = 117 Back     information, alignment and structure
>d1h6va1 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 235 Back     information, alignment and structure
>d1h6va1 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 235 Back     information, alignment and structure
>d1nhpa3 d.87.1.1 (A:322-447) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Length = 126 Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Length = 115 Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Length = 119 Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 122 Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Length = 121 Back     information, alignment and structure
>d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Length = 198 Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Length = 123 Back     information, alignment and structure
>d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Length = 137 Back     information, alignment and structure
>d1xdia1 c.3.1.5 (A:2-161,A:276-348) Dihydrolipoamide dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Length = 233 Back     information, alignment and structure
>d1xdia1 c.3.1.5 (A:2-161,A:276-348) Dihydrolipoamide dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Length = 233 Back     information, alignment and structure
>d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Length = 167 Back     information, alignment and structure
>d1djqa2 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, C-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Length = 156 Back     information, alignment and structure
>d1d5ta1 c.3.1.3 (A:-2-291,A:389-431) Guanine nucleotide dissociation inhibitor, GDI {Cow (Bos taurus) [TaxId: 9913]} Length = 336 Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Length = 133 Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Length = 121 Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Length = 347 Back     information, alignment and structure
>d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} Length = 278 Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Length = 196 Back     information, alignment and structure
>d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 192 Back     information, alignment and structure
>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Length = 253 Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Length = 186 Back     information, alignment and structure
>d1fl2a1 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Length = 184 Back     information, alignment and structure
>d1fl2a1 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Length = 184 Back     information, alignment and structure
>d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Length = 190 Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Length = 251 Back     information, alignment and structure
>d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Length = 308 Back     information, alignment and structure
>d1ps9a2 c.3.1.1 (A:466-627) 2,4-dienoyl-CoA reductase, C-terminal domain {Escherichia coli [TaxId: 562]} Length = 162 Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 297 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query551
d1xdia1233 Dihydrolipoamide dehydrogenase {Mycobacterium tube 100.0
d1ebda1223 Dihydrolipoamide dehydrogenase {Bacillus stearothe 100.0
d3grsa1221 Glutathione reductase {Human (Homo sapiens) [TaxId 100.0
d1h6va1235 Mammalian thioredoxin reductase {Rat (Rattus norve 100.0
d1dxla1221 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 99.97
d1feca1240 Trypanothione reductase {Crithidia fasciculata [Ta 99.97
d1mo9a1261 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 99.97
d1lvla1220 Dihydrolipoamide dehydrogenase {Pseudomonas putida 99.97
d1v59a1233 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 99.96
d1aoga1238 Trypanothione reductase {Trypanosoma cruzi [TaxId: 99.96
d1ojta1229 Dihydrolipoamide dehydrogenase {Neisseria meningit 99.95
d3lada1229 Dihydrolipoamide dehydrogenase {Azotobacter vinela 99.95
d1gesa1217 Glutathione reductase {Escherichia coli [TaxId: 56 99.95
d1onfa1259 Glutathione reductase {Plasmodium falciparum [TaxI 99.95
d1v59a3123 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 99.93
d1feca3128 Trypanothione reductase {Crithidia fasciculata [Ta 99.93
d3grsa3115 Glutathione reductase {Human (Homo sapiens) [TaxId 99.93
d3lada3124 Dihydrolipoamide dehydrogenase {Azotobacter vinela 99.93
d1dxla3123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 99.93
d1ebda3115 Dihydrolipoamide dehydrogenase {Bacillus stearothe 99.93
d1xdia2118 Dihydrolipoamide dehydrogenase {Mycobacterium tube 99.93
d1lvla3123 Dihydrolipoamide dehydrogenase {Pseudomonas putida 99.93
d1gesa3115 Glutathione reductase {Escherichia coli [TaxId: 56 99.93
d1ojta3128 Dihydrolipoamide dehydrogenase {Neisseria meningit 99.93
d1onfa3119 Glutathione reductase {Plasmodium falciparum [TaxI 99.92
d1mo9a3140 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 99.89
d1h6va3133 Mammalian thioredoxin reductase {Rat (Rattus norve 99.89
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 99.87
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 99.86
d1d7ya1183 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 99.84
d1ojta2125 Dihydrolipoamide dehydrogenase {Neisseria meningit 99.84
d1feca2117 Trypanothione reductase {Crithidia fasciculata [Ta 99.83
d1nhpa1198 NADH peroxidase {Enterococcus faecalis [TaxId: 135 99.83
d1aoga2117 Trypanothione reductase {Trypanosoma cruzi [TaxId: 99.82
d1xhca1167 NADH oxidase /nitrite reductase {Pyrococcus furios 99.82
d1m6ia1213 Apoptosis-inducing factor (AIF) {Human (Homo sapie 99.81
d1nhpa3126 NADH peroxidase {Enterococcus faecalis [TaxId: 135 99.81
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 99.81
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 99.8
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 99.8
d1q1ra1185 Putidaredoxin reductase {Pseudomonas putida [TaxId 99.8
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 99.78
d1dxla2123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 99.75
d1h6va2122 Mammalian thioredoxin reductase {Rat (Rattus norve 99.75
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 99.74
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 99.73
d1xhca2122 NADH oxidase /nitrite reductase {Pyrococcus furios 99.72
d1q1ra2133 Putidaredoxin reductase {Pseudomonas putida [TaxId 99.72
d1vdca1192 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 99.66
d1fcda1186 Flavocytochrome c sulfide dehydrogenase, FCSD, fla 99.63
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 99.62
d1m6ia2137 Apoptosis-inducing factor (AIF) {Human (Homo sapie 99.62
d1djqa3233 Trimethylamine dehydrogenase, middle domain {Methy 99.61
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 99.6
d1trba1190 Thioredoxin reductase {Escherichia coli [TaxId: 56 99.6
d1djqa2156 Trimethylamine dehydrogenase, C-terminal domain {M 99.59
d2i0za1251 Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396] 99.57
d2gqfa1253 Hypothetical protein HI0933 {Haemophilus influenza 99.55
d1ps9a3179 2,4-dienoyl-CoA reductase, middle domain {Escheric 99.53
d1fl2a1184 Alkyl hydroperoxide reductase subunit F (AhpF), C- 99.51
d1d4ca2322 Flavocytochrome c3 (respiratory fumarate reductase 99.42
d1d5ta1336 Guanine nucleotide dissociation inhibitor, GDI {Co 99.39
d1ryia1276 Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} 99.38
d2gf3a1281 Sarcosine oxidase {Bacillus sp., strain b0618 [Tax 99.36
d2bs2a2336 Fumarate reductase {Wolinella succinogenes [TaxId: 99.31
d1chua2305 L-aspartate oxidase {Escherichia coli [TaxId: 562] 99.26
d1seza1373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 99.26
d1y0pa2308 Flavocytochrome c3 (respiratory fumarate reductase 99.26
d1b5qa1347 Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} 99.25
d2ivda1347 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 99.23
d1ps9a2162 2,4-dienoyl-CoA reductase, C-terminal domain {Esch 99.22
d1qo8a2317 Flavocytochrome c3 (respiratory fumarate reductase 99.21
d2iida1370 L-aminoacid oxidase {Malayan pit viper (Calloselas 99.19
d2v5za1383 Monoamine oxidase B {Human (Homo sapiens) [TaxId: 99.18
d1pj5a2305 N,N-dimethylglycine oxidase {Arthrobacter globifor 99.1
d1onfa1259 Glutathione reductase {Plasmodium falciparum [TaxI 99.08
d2gv8a1335 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 99.08
d1trba2126 Thioredoxin reductase {Escherichia coli [TaxId: 56 99.07
d1w4xa1298 Phenylacetone monooxygenase {Thermobifida fusca [T 99.05
d2cula1230 GidA-related protein TTHA1897 {Thermus thermophilu 99.02
d1gtea4196 Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su 99.01
d1fl2a2126 Alkyl hydroperoxide reductase subunit F (AhpF), C- 98.96
d1trba1190 Thioredoxin reductase {Escherichia coli [TaxId: 56 98.95
d1kf6a2311 Fumarate reductase {Escherichia coli [TaxId: 562]} 98.93
d1lqta2239 Ferredoxin:NADP reductase FprA {Mycobacterium tube 98.93
d1neka2330 Succinate dehydogenase {Escherichia coli [TaxId: 5 98.85
d2bcgg1297 Guanine nucleotide dissociation inhibitor, GDI {Ba 98.84
d1ps9a3179 2,4-dienoyl-CoA reductase, middle domain {Escheric 98.84
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 98.83
d2gmha1380 Electron transfer flavoprotein-ubiquinone oxidored 98.83
d1rp0a1278 Thiazole biosynthetic enzyme Thi4 {Thale cress(Ara 98.77
d1fl2a1184 Alkyl hydroperoxide reductase subunit F (AhpF), C- 98.71
d1vdca1192 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 98.69
d1xhca2122 NADH oxidase /nitrite reductase {Pyrococcus furios 98.69
d1w4xa1298 Phenylacetone monooxygenase {Thermobifida fusca [T 98.68
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 98.66
d1gtea3153 Dihydropyrimidine dehydrogenase, domain 3 {Pig (Su 98.65
d1fcda1186 Flavocytochrome c sulfide dehydrogenase, FCSD, fla 98.65
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 98.65
d1q1ra2133 Putidaredoxin reductase {Pseudomonas putida [TaxId 98.55
d1i8ta1298 UDP-galactopyranose mutase, N-terminal domain {Esc 98.53
d1vdca2130 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 98.53
d1cjca2230 Adrenodoxin reductase of mitochondrial p450 system 98.51
d1m6ia1213 Apoptosis-inducing factor (AIF) {Human (Homo sapie 98.5
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 98.49
d2dw4a2449 Lysine-specific histone demethylase 1, LSD1 {Human 98.46
d1xhca1167 NADH oxidase /nitrite reductase {Pyrococcus furios 98.44
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 98.38
d2voua1265 Dihydroxypyridine hydroxylase DhpH {Arthrobacter n 98.35
d2cula1230 GidA-related protein TTHA1897 {Thermus thermophilu 98.32
d2gv8a2107 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 98.31
d1m6ia2137 Apoptosis-inducing factor (AIF) {Human (Homo sapie 98.31
d1feca2117 Trypanothione reductase {Crithidia fasciculata [Ta 98.28
d2bi7a1314 UDP-galactopyranose mutase, N-terminal domain {Kle 98.28
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 98.27
d1d7ya1183 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 98.23
d1nhpa1198 NADH peroxidase {Enterococcus faecalis [TaxId: 135 98.22
d1c0pa1268 D-aminoacid oxidase, N-terminal domain {Rhodotorul 98.22
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 98.22
d1h6va2122 Mammalian thioredoxin reductase {Rat (Rattus norve 98.22
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 98.19
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 98.19
d1w4xa2235 Phenylacetone monooxygenase {Thermobifida fusca [T 98.15
d1gtea4196 Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su 98.15
d1ojta2125 Dihydrolipoamide dehydrogenase {Neisseria meningit 98.11
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 98.08
d2f5va1379 Pyranose 2-oxidase {White-rot fungus (Peniophora s 98.08
d2gjca1311 Thiazole biosynthetic enzyme Thi4 {Baker's yeast ( 98.07
d1cjca1225 Adrenodoxin reductase of mitochondrial p450 system 98.0
d1dxla2123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 98.0
d1aoga2117 Trypanothione reductase {Trypanosoma cruzi [TaxId: 97.96
d1jnra2356 Adenylylsulfate reductase A subunit {Archaeon Arch 97.92
d3c96a1288 Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 97.9
d1k0ia1292 p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a 97.89
d2voua1265 Dihydroxypyridine hydroxylase DhpH {Arthrobacter n 97.86
d2bcgg1297 Guanine nucleotide dissociation inhibitor, GDI {Ba 97.86
d1mo9a1261 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 97.83
d1pn0a1360 Phenol hydroxylase {Soil-living yeast (Trichosporo 97.78
d3c96a1288 Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 97.77
d1q1ra1185 Putidaredoxin reductase {Pseudomonas putida [TaxId 97.74
d1dxla1221 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 97.65
d3coxa1370 Cholesterol oxidase of GMC family {Brevibacterium 97.64
d1lqta1216 Ferredoxin:NADP reductase FprA {Mycobacterium tube 97.59
d1cjca2230 Adrenodoxin reductase of mitochondrial p450 system 97.55
d1djqa2156 Trimethylamine dehydrogenase, C-terminal domain {M 97.55
d1gesa1217 Glutathione reductase {Escherichia coli [TaxId: 56 97.52
d1k0ia1292 p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a 97.51
d1n4wa1367 Cholesterol oxidase of GMC family {Streptomyces sp 97.49
d1kdga1360 Flavoprotein domain of flavocytochrome cellobiose 97.47
d1djqa3233 Trimethylamine dehydrogenase, middle domain {Methy 97.47
d1lqta2239 Ferredoxin:NADP reductase FprA {Mycobacterium tube 97.35
d1ju2a1351 Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxI 97.25
d1gpea1391 Glucose oxidase {Penicillium amagasakiense [TaxId: 97.22
d1cf3a1385 Glucose oxidase {Aspergillus niger [TaxId: 5061]} 97.17
d1lvla1220 Dihydrolipoamide dehydrogenase {Pseudomonas putida 97.14
d1ps9a2162 2,4-dienoyl-CoA reductase, C-terminal domain {Esch 97.1
d1kifa1246 D-aminoacid oxidase, N-terminal domain {Pig (Sus s 97.09
d1h6va1235 Mammalian thioredoxin reductase {Rat (Rattus norve 97.06
d1xdia1233 Dihydrolipoamide dehydrogenase {Mycobacterium tube 97.01
d3lada1229 Dihydrolipoamide dehydrogenase {Azotobacter vinela 96.95
d1jnra2356 Adenylylsulfate reductase A subunit {Archaeon Arch 96.87
d1ebda1223 Dihydrolipoamide dehydrogenase {Bacillus stearothe 96.71
d3grsa1221 Glutathione reductase {Human (Homo sapiens) [TaxId 96.58
d1rp0a1278 Thiazole biosynthetic enzyme Thi4 {Thale cress(Ara 96.56
d2iida1370 L-aminoacid oxidase {Malayan pit viper (Calloselas 96.4
d1seza1373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 96.39
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 96.27
d1n4wa1367 Cholesterol oxidase of GMC family {Streptomyces sp 96.06
d1l7da1183 Nicotinamide nucleotide transhydrogenase dI compon 95.85
d3coxa1370 Cholesterol oxidase of GMC family {Brevibacterium 95.8
d2dw4a2 449 Lysine-specific histone demethylase 1, LSD1 {Human 95.75
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 95.75
d2bi7a1314 UDP-galactopyranose mutase, N-terminal domain {Kle 95.69
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 95.6
d1c0pa1268 D-aminoacid oxidase, N-terminal domain {Rhodotorul 95.56
d2ivda1347 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 95.52
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 95.41
d1fcda2141 Flavocytochrome c sulfide dehydrogenase, FCSD, fla 95.36
d1b5qa1347 Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} 95.36
d1w4xa2235 Phenylacetone monooxygenase {Thermobifida fusca [T 95.25
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 95.05
d1d5ta1336 Guanine nucleotide dissociation inhibitor, GDI {Co 94.82
d1ez4a1146 Lactate dehydrogenase {Lactobacillus pentosus [Tax 94.8
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 94.78
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 94.71
d1i8ta1298 UDP-galactopyranose mutase, N-terminal domain {Esc 94.68
d1kyqa1150 Bifunctional dehydrogenase/ferrochelatase Met8p, N 94.44
d1vg0a1491 Rab escort protein 1 {Rat (Rattus norvegicus) [Tax 94.4
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 94.36
d1mv8a2202 GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos 94.21
d1f0ya2192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 94.21
d1kyqa1150 Bifunctional dehydrogenase/ferrochelatase Met8p, N 94.18
d1pn0a1360 Phenol hydroxylase {Soil-living yeast (Trichosporo 94.14
d2gv8a1335 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 94.13
d2v5za1383 Monoamine oxidase B {Human (Homo sapiens) [TaxId: 94.1
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 93.89
d1pzga1154 Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 93.83
d1ryia1276 Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} 93.8
d1f0ya2192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 93.79
d1n1ea2189 Glycerol-3- phosphate dehydrogenase {Trypanosome ( 93.72
d2gqfa1253 Hypothetical protein HI0933 {Haemophilus influenza 93.72
d1wdka3186 Fatty oxidation complex alpha subunit, middle doma 93.65
d1ojta1229 Dihydrolipoamide dehydrogenase {Neisseria meningit 93.64
d2i0za1251 Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396] 93.58
d1v59a1233 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 93.47
d1wdka3186 Fatty oxidation complex alpha subunit, middle doma 93.37
d1gtea3153 Dihydropyrimidine dehydrogenase, domain 3 {Pig (Su 93.3
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 93.15
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 92.94
d1pj5a2305 N,N-dimethylglycine oxidase {Arthrobacter globifor 92.79
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 92.74
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 92.57
d2gf3a1281 Sarcosine oxidase {Bacillus sp., strain b0618 [Tax 92.55
d1txga2180 Glycerol-3- phosphate dehydrogenase {Archaeoglobus 92.23
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 91.98
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 91.37
d1i0za1160 Lactate dehydrogenase {Human (Homo sapiens), heart 91.34
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 91.25
d1ldna1148 Lactate dehydrogenase {Bacillus stearothermophilus 91.15
d2pv7a2152 Prephenate dehydrogenase TyrA {Haemophilus influen 90.91
d1dlja2196 UDP-glucose dehydrogenase (UDPGDH) {Streptococcus 90.88
d1y0pa2308 Flavocytochrome c3 (respiratory fumarate reductase 90.45
d1nyta1170 Shikimate 5-dehydrogenase AroE {Escherichia coli [ 90.37
d2gv8a2107 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 90.03
d1guza1142 Malate dehydrogenase {Chlorobium vibrioforme [TaxI 89.81
d1y6ja1142 Lactate dehydrogenase {Clostridium thermocellum [T 89.62
d1gpja2159 Glutamyl tRNA-reductase middle domain {Archaeon Me 89.6
d1j6ua189 UDP-N-acetylmuramate-alanine ligase MurC {Thermoto 89.47
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 89.46
d1llda1143 Lactate dehydrogenase {Bifidobacterium longum, str 89.43
d1hyha1146 L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La 89.42
d1trba2126 Thioredoxin reductase {Escherichia coli [TaxId: 56 89.34
d1nyta1170 Shikimate 5-dehydrogenase AroE {Escherichia coli [ 89.3
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 89.16
d1d4ca2322 Flavocytochrome c3 (respiratory fumarate reductase 89.04
d2gmha1380 Electron transfer flavoprotein-ubiquinone oxidored 88.97
d1uxja1142 Malate dehydrogenase {Chloroflexus aurantiacus [Ta 88.93
d1fl2a2126 Alkyl hydroperoxide reductase subunit F (AhpF), C- 88.89
d1ojua1142 Malate dehydrogenase {Archaeon Archaeoglobus fulgi 88.67
d1jaya_212 Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae 88.67
d1hyea1145 MJ0490, lactate/malate dehydrogenase {Archaeon Met 88.27
d1id1a_153 Rck domain from putative potassium channel Kch {Es 88.14
d2gjca1311 Thiazole biosynthetic enzyme Thi4 {Baker's yeast ( 88.13
d1mlda1144 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 88.09
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 88.06
d1a5za1140 Lactate dehydrogenase {Thermotoga maritima [TaxId: 88.05
d1a9xa4121 Carbamoyl phosphate synthetase (CPS), large subuni 88.05
d2ldxa1159 Lactate dehydrogenase {Mouse (Mus musculus) [TaxId 87.96
d1l7da1183 Nicotinamide nucleotide transhydrogenase dI compon 87.95
d1kjqa2111 Glycinamide ribonucleotide transformylase PurT, N- 87.84
d2f5va1379 Pyranose 2-oxidase {White-rot fungus (Peniophora s 87.83
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 87.79
d1id1a_153 Rck domain from putative potassium channel Kch {Es 87.61
d2bs2a2336 Fumarate reductase {Wolinella succinogenes [TaxId: 87.6
d1lqta1216 Ferredoxin:NADP reductase FprA {Mycobacterium tube 87.58
d1a9xa4121 Carbamoyl phosphate synthetase (CPS), large subuni 87.54
d3etja278 N5-carboxyaminoimidazole ribonucleotide synthetase 87.51
d1qo8a2317 Flavocytochrome c3 (respiratory fumarate reductase 87.42
d1vdca2130 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 87.39
d1kjqa2111 Glycinamide ribonucleotide transformylase PurT, N- 86.82
d1kifa1246 D-aminoacid oxidase, N-terminal domain {Pig (Sus s 86.74
d1npya1167 Shikimate 5-dehydrogenase-like protein HI0607 {Hae 86.72
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 86.71
d1n1ea2189 Glycerol-3- phosphate dehydrogenase {Trypanosome ( 86.54
d1a9xa3127 Carbamoyl phosphate synthetase (CPS), large subuni 86.43
d1t2da1150 Lactate dehydrogenase {Malaria parasite (Plasmodiu 85.8
d1jaya_212 Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae 85.72
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 85.7
d1qyda_312 Pinoresinol-lariciresinol reductase {Giant arborvi 85.63
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 85.34
d1li4a1163 S-adenosylhomocystein hydrolase {Human (Homo sapie 84.59
d3cuma2162 Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru 84.5
d1mv8a2202 GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos 84.5
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 84.27
d1vpda2161 Hydroxyisobutyrate dehydrogenase {Salmonella typhi 84.17
d2c5aa1363 GDP-mannose-3', 5'-epimerase {Thale cress (Arabido 84.04
d1rjwa2168 Alcohol dehydrogenase {Bacillus stearothermophilus 83.83
d1p3da196 UDP-N-acetylmuramate-alanine ligase MurC {Haemophi 83.82
d3etja278 N5-carboxyaminoimidazole ribonucleotide synthetase 83.72
d1o6za1142 Malate dehydrogenase {Archaeon Haloarcula marismor 83.08
d1hdoa_205 Biliverdin IX beta reductase {Human (Homo sapiens) 82.88
d1i36a2152 Conserved hypothetical protein MTH1747 {Archaeon M 82.75
d1d1ta2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 82.63
d1kola2195 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 82.54
d2pgda2176 6-phosphogluconate dehydrogenase {Sheep (Ovis orie 82.43
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 82.37
d1txga2180 Glycerol-3- phosphate dehydrogenase {Archaeoglobus 82.16
d1jw9b_247 Molybdenum cofactor biosynthesis protein MoeB {Esc 82.09
d1kdga1360 Flavoprotein domain of flavocytochrome cellobiose 82.03
d1pgja2178 6-phosphogluconate dehydrogenase {Trypanosoma bruc 81.95
d2g5ca2171 Prephenate dehydrogenase TyrA {Aquifex aeolicus [T 81.79
d2pv7a2152 Prephenate dehydrogenase TyrA {Haemophilus influen 81.73
d1li4a1163 S-adenosylhomocystein hydrolase {Human (Homo sapie 81.57
d1neka2330 Succinate dehydogenase {Escherichia coli [TaxId: 5 81.41
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 81.38
d2dt5a2126 Transcriptional repressor Rex, C-terminal domain { 81.36
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 81.3
d1p3da196 UDP-N-acetylmuramate-alanine ligase MurC {Haemophi 81.19
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 80.66
d1qyda_312 Pinoresinol-lariciresinol reductase {Giant arborvi 80.51
d1e3ia2174 Alcohol dehydrogenase {Mouse (Mus musculus), class 80.06
>d1xdia1 c.3.1.5 (A:2-161,A:276-348) Dihydrolipoamide dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: FAD/NAD(P)-binding domain
superfamily: FAD/NAD(P)-binding domain
family: FAD/NAD-linked reductases, N-terminal and central domains
domain: Dihydrolipoamide dehydrogenase
species: Mycobacterium tuberculosis [TaxId: 1773]

Probab=100.00  E-value=9.4e-33  Score=261.74  Aligned_cols=213  Identities=27%  Similarity=0.471  Sum_probs=167.9

Q ss_pred             ccEEEECCChHHHHHHHHHHhC---CCcEEEEccCCCCCCCCCCCCCCCeeccCCCcchHHHHHhhhhhhHhhhccCCCc
Q 008860           73 FDLFTIGAGSGGVRASRFAANF---GASVAICELPFSTISSETTGGVGGTCVLRGCVPKKLLVYASKFSHEFDESNGFGW  149 (551)
Q Consensus        73 ~dVvIIGgG~aGl~aA~~l~~~---G~~V~liE~~~~~~~~~~~~~~GG~~~~~g~~p~~~l~~~~~~~~~~~~~~~~g~  149 (551)
                      .+|+||||||||++||.++++.   +++|+|||          +..+||+|+|+||+|+|.|+..++..+.+++...||+
T Consensus         2 ~~viVIG~GpaG~~aA~~aa~~~~~~~~V~liE----------k~~~GG~cln~GciPsK~ll~~a~~~~~~~~~~~~G~   71 (233)
T d1xdia1           2 TRIVILGGGPAGYEAALVAATSHPETTQVTVID----------CDGIGGAAVLDDCVPSKTFIASTGLRTELRRAPHLGF   71 (233)
T ss_dssp             EEEEEECCSHHHHHHHHHHHHHCTTTEEEEEEE----------SSCTTHHHHHTSHHHHHHHHHHHHHHHHHTTTTTTTB
T ss_pred             cEEEEECCCHHHHHHHHHHHHcCCCCCEEEEEe----------cCCCCceeecccccccEEEEeecchhhhhhhhhhcCC
Confidence            4899999999999999998874   46899999          7789999999999999999999999999999999998


Q ss_pred             ccC-CCCCCChHHHHHHHHHHHHHHHHHHHHHHHhCCeEEEEeEEEEecCC------EEEE---cC--EEEEeCeEEEcC
Q 008860          150 KYG-TEPQHDWSTLIANKNAELQRLTGIYKNILINAGITLIEGRGKIVDPH------TVDV---DG--KLYSARHILISV  217 (551)
Q Consensus       150 ~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~~~~~i~~~------~v~v---~g--~~~~~d~lviAt  217 (551)
                      .+. ....++|..+..+...............++..+|+++.+.+.+++..      .+.+   ++  .++.+|.+++||
T Consensus        72 ~i~~~~~~~d~~~~~~~~~~v~~~~~~~~~~~~~~~gV~vi~G~~~~~~~~~~~~~~~v~v~~~dg~~~~i~ad~viiAt  151 (233)
T d1xdia1          72 HIDFDDAKISLPQIHARVKTLAAAQSADITAQLLSMGVQVIAGRGELIDSTPGLARHRIKATAADGSTSEHEADVVLVAT  151 (233)
T ss_dssp             C------CBCHHHHHHHHHHHHHHHHHHHHHHHHHTTCEEEESEEEECCSSSCCSSEEEEEECTTSCEEEEEESEEEECC
T ss_pred             cccccCceeeeeeeccccceeeeeeecceehhhcccceeEEECcccccccccccccceEEEEecCCceeeeecceeeeec
Confidence            755 34678999999888877777777788888999999999877766532      2222   11  234455555555


Q ss_pred             CCCCCCCCCCCCCceecchhhhcCCCCCCeEEEEcCcHHHHHHHHHHHhCCCeEEEEeecCccCCCCCHHHHHHHHHHHH
Q 008860          218 GGRPFIPDIPGSEYAIDSDAALDLPSKPEKIAIVGGGYIALEFAGIFSGLTSEVHVFIRQKKVLRGFDEDIRDFVAEQMS  297 (551)
Q Consensus       218 G~~p~~p~i~g~~~~~~~~~~~~~~~~~~~vvViG~G~~g~e~a~~l~~~g~~Vtlv~~~~~~l~~~~~~~~~~l~~~l~  297 (551)
                      |.+|+.++.                                                                       
T Consensus       152 G~~p~~~~~-----------------------------------------------------------------------  160 (233)
T d1xdia1         152 GASPRILPS-----------------------------------------------------------------------  160 (233)
T ss_dssp             CEEECCCGG-----------------------------------------------------------------------
T ss_pred             Ccccccccc-----------------------------------------------------------------------
Confidence            444332210                                                                       


Q ss_pred             hcCcEEEcCcccEEEEEcCCceEEEEECCCeEEEeeEEEEecCcCCCCCCCCccccCeeecCCCCeEeCCCCCCCCCcEE
Q 008860          298 LRGIEFHTEESPQAILKSTDGSLSVKTNKGTVDGFSHVMFATGRRPNTKNLGLEKVGVKMTKNGAIEVDEYSGTAVPSIW  377 (551)
Q Consensus       298 ~~Gv~i~~~~~v~~i~~~~~~~~~V~~~~G~~i~~d~vi~a~G~~p~~~~l~l~~~gl~~~~~G~i~vd~~~~t~~~~vy  377 (551)
                                                                |..++.+.++++..+++++++|+|.||++|||++|+||
T Consensus       161 ------------------------------------------~~~~~~~~l~l~~~gv~~~~~G~I~vd~~~~T~~~gIy  198 (233)
T d1xdia1         161 ------------------------------------------GSVPNTSGLGLERVGIQLGRGNYLTVDRVSRTLATGIY  198 (233)
T ss_dssp             ------------------------------------------CEEECCSSSCTTTTTCCCBTTTBCCCCSSSBCSSTTEE
T ss_pred             ------------------------------------------cccccccccccchhhhcccCCCcCCcCCCcccCCCCEE
Confidence                                                      12233445567888999999999999999999999999


Q ss_pred             EeCcCCCCCCChHHHHHhHHHHHHHHcCCCC
Q 008860          378 AVGDVTDRINLTPVALMEGGALAKTLFQAEP  408 (551)
Q Consensus       378 a~GD~~~~~~~~~~A~~~g~~aa~~i~g~~~  408 (551)
                      |+|||++.+.+++.|..||++||.||+|...
T Consensus       199 A~GDv~~~~~l~~~A~~~g~~aa~~~~g~~~  229 (233)
T d1xdia1         199 AAGDCTGLLPLASVAAMQGRIAMYHALGEGV  229 (233)
T ss_dssp             ECSGGGTSCSCHHHHHHHHHHHHHHHTTCCC
T ss_pred             EEEEeCCCchhHHHHHHHHHHHHHHHcCCCC
Confidence            9999999999999999999999999998654
>d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6va1 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1feca1 c.3.1.5 (A:1-169,A:287-357) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1mo9a1 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1aoga1 c.3.1.5 (A:3-169,A:287-357) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d3lada1 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1onfa1 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1v59a3 d.87.1.1 (A:356-478) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1feca3 d.87.1.1 (A:358-485) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d3grsa3 d.87.1.1 (A:364-478) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3lada3 d.87.1.1 (A:349-472) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1dxla3 d.87.1.1 (A:348-470) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1ebda3 d.87.1.1 (A:347-461) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1xdia2 d.87.1.1 (A:349-466) Dihydrolipoamide dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1lvla3 d.87.1.1 (A:336-458) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1gesa3 d.87.1.1 (A:336-450) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ojta3 d.87.1.1 (A:471-598) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1onfa3 d.87.1.1 (A:377-495) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1mo9a3 d.87.1.1 (A:384-523) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1h6va3 d.87.1.1 (A:367-499) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1m6ia1 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nhpa3 d.87.1.1 (A:322-447) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1djqa2 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, C-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fl2a1 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Back     information, alignment and structure
>d2bs2a2 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure
>d1chua2 c.3.1.4 (A:2-237,A:354-422) L-aspartate oxidase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d1ps9a2 c.3.1.1 (A:466-627) 2,4-dienoyl-CoA reductase, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d1onfa1 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1trba2 c.3.1.5 (A:119-244) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d2cula1 c.3.1.7 (A:2-231) GidA-related protein TTHA1897 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1fl2a2 c.3.1.5 (A:326-451) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kf6a2 c.3.1.4 (A:0-225,A:358-442) Fumarate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lqta2 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1neka2 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1fl2a1 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gtea3 c.3.1.1 (A:288-440) Dihydropyrimidine dehydrogenase, domain 3 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vdca2 c.3.1.5 (A:118-243) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1m6ia1 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d2cula1 c.3.1.7 (A:2-231) GidA-related protein TTHA1897 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2gv8a2 c.3.1.5 (A:181-287) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1w4xa2 c.3.1.5 (A:155-389) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} Back     information, alignment and structure
>d2gjca1 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Thi4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1cjca1 c.3.1.1 (A:107-331) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1jnra2 c.3.1.4 (A:2-256,A:402-502) Adenylylsulfate reductase A subunit {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1mo9a1 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} Back     information, alignment and structure
>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d3coxa1 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of GMC family {Brevibacterium sterolicum [TaxId: 1702]} Back     information, alignment and structure
>d1lqta1 c.3.1.1 (A:109-324) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1djqa2 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, C-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1n4wa1 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]} Back     information, alignment and structure
>d1kdga1 c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain of flavocytochrome cellobiose dehydrogenase (CDH), FAD-binding domain {Fungus (Phanerochaete chrysosporium) [TaxId: 5306]} Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1lqta2 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ju2a1 c.3.1.2 (A:1-293,A:464-521) Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxId: 3755]} Back     information, alignment and structure
>d1gpea1 c.3.1.2 (A:1-328,A:525-587) Glucose oxidase {Penicillium amagasakiense [TaxId: 63559]} Back     information, alignment and structure
>d1cf3a1 c.3.1.2 (A:3-324,A:521-583) Glucose oxidase {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1ps9a2 c.3.1.1 (A:466-627) 2,4-dienoyl-CoA reductase, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kifa1 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1h6va1 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xdia1 c.3.1.5 (A:2-161,A:276-348) Dihydrolipoamide dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d3lada1 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1jnra2 c.3.1.4 (A:2-256,A:402-502) Adenylylsulfate reductase A subunit {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1n4wa1 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]} Back     information, alignment and structure
>d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d3coxa1 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of GMC family {Brevibacterium sterolicum [TaxId: 1702]} Back     information, alignment and structure
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d1fcda2 c.3.1.5 (A:115-255) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1w4xa2 c.3.1.5 (A:155-389) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vg0a1 c.3.1.3 (A:3-444,A:558-606) Rab escort protein 1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} Back     information, alignment and structure
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Back     information, alignment and structure
>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1gtea3 c.3.1.1 (A:288-440) Dihydropyrimidine dehydrogenase, domain 3 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Back     information, alignment and structure
>d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1dlja2 c.2.1.6 (A:1-196) UDP-glucose dehydrogenase (UDPGDH) {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gv8a2 c.3.1.5 (A:181-287) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1guza1 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} Back     information, alignment and structure
>d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d1j6ua1 c.5.1.1 (A:0-88) UDP-N-acetylmuramate-alanine ligase MurC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} Back     information, alignment and structure
>d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} Back     information, alignment and structure
>d1trba2 c.3.1.5 (A:119-244) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} Back     information, alignment and structure
>d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1uxja1 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} Back     information, alignment and structure
>d1fl2a2 c.3.1.5 (A:326-451) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ojua1 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1hyea1 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gjca1 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Thi4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1mlda1 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a5za1 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1a9xa4 c.30.1.1 (A:556-676) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ldxa1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d1kjqa2 c.30.1.1 (A:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bs2a2 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure
>d1lqta1 c.3.1.1 (A:109-324) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1a9xa4 c.30.1.1 (A:556-676) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3etja2 c.30.1.1 (A:1-78) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d1vdca2 c.3.1.5 (A:118-243) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1kjqa2 c.30.1.1 (A:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kifa1 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Back     information, alignment and structure
>d1a9xa3 c.30.1.1 (A:1-127) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t2da1 c.2.1.5 (A:1-150) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1li4a1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1p3da1 c.5.1.1 (A:11-106) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d3etja2 c.30.1.1 (A:1-78) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1o6za1 c.2.1.5 (A:22-162) Malate dehydrogenase {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1jw9b_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kdga1 c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain of flavocytochrome cellobiose dehydrogenase (CDH), FAD-binding domain {Fungus (Phanerochaete chrysosporium) [TaxId: 5306]} Back     information, alignment and structure
>d1pgja2 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1li4a1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1neka2 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d2dt5a2 c.2.1.12 (A:78-203) Transcriptional repressor Rex, C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p3da1 c.5.1.1 (A:11-106) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure