BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 008879
         (550 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2AZ0|A Chain A, Flock House Virus B2-Dsrna Complex (P212121)
 pdb|2AZ0|B Chain B, Flock House Virus B2-Dsrna Complex (P212121)
 pdb|2AZ2|A Chain A, Flock House Virus B2-Dsrna Complex (P4122)
 pdb|2AZ2|B Chain B, Flock House Virus B2-Dsrna Complex (P4122)
          Length = 73

 Score = 28.9 bits (63), Expect = 7.5,   Method: Composition-based stats.
 Identities = 14/46 (30%), Positives = 29/46 (63%), Gaps = 2/46 (4%)

Query: 199 LQEVSNNLATAKQISVQKVF--LPSNVQSDIDNVESKLNSSASTVA 242
           +QE+ + + TA + ++   +   P+NV+ D+DN+ + LN +  TV+
Sbjct: 8   IQELPDRIQTAVEAAMGMSYQDAPNNVRRDLDNLHACLNKAKLTVS 53


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.320    0.134    0.404 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 14,116,497
Number of Sequences: 62578
Number of extensions: 524682
Number of successful extensions: 1088
Number of sequences better than 100.0: 4
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 4
Number of HSP's that attempted gapping in prelim test: 1088
Number of HSP's gapped (non-prelim): 4
length of query: 550
length of database: 14,973,337
effective HSP length: 104
effective length of query: 446
effective length of database: 8,465,225
effective search space: 3775490350
effective search space used: 3775490350
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 54 (25.4 bits)